ELF>@=/@8 @X X   ***h}.E+U+U+ $$Std Ptd@'@'@' QtdRtd***GNUGNUr]_5Ig/Vt $Q!x`|<ҤB^??   ^  jAX f !  V sG &/9s  cN 2p    O Po cQ V c {, { U4 , _RF":  !x  - (  3(1:yF ~ ^h | V  - . !d &B;  m  DHfY?  `s\; 8 kt b \ `  @v  x  b@ Nk n/N (7 \yG  x) (& N .  1*q  }i [   z'__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizestrlenstrcmpstrncmplstat64__stack_chk_faildm_event_handler_createdm_event_handler_set_dmeventd_pathdm_event_handler_set_dsodm_event_handler_set_uuiddm_event_handler_set_timeoutdm_event_handler_set_event_maskdm_event_handler_destroystrdupdm_event_get_registered_devicedm_event_handler_get_dsodm_event_handler_get_event_maskdm_event_register_handlerdm_event_unregister_handlerusleepcallocmemcmpmemcpymallocmemsetstrncpyfopen64__errno_locationstrerrorstrstrgetlinefclosestrcasecmp__ctype_b_locsd_id128_get_machine_app_specificgetenvfgetsctime_rumaskunamegetpidmalloptsetlocalesyscallfcntl64stdinsetvbufstdoutsetlinebufmemmovestrchrtoupper__isoc23_strtollstrtodfputcstrspnfwriteio_destroyio_submitio_geteventssysconfio_setuplseek64posix_memalignrealloc__isoc23_sscanfopendirreaddir64closediralphasort64scandir64udev_device_new_from_devnumudev_device_unrefudev_enumerate_newudev_enumerate_add_match_subsystemudev_enumerate_scan_devicesudev_enumerate_get_list_entryudev_list_entry_get_nameudev_device_new_from_syspathudev_device_get_devnodeudev_device_get_devlinks_list_entryudev_list_entry_get_nextudev_enumerate_unrefstrcpymkdirunlinkatoictimefflushrenamefsyncflockudev_device_get_is_initializedioctlfstat64udev_device_get_property_valuestrrchrreadlinkdirname__xpg_basenameblkid_get_tag_valueblkid_probe_lookup_valueblkid_new_probe_from_filenameblkid_probe_enable_partitionsblkid_probe_set_partitions_flagsblkid_probe_enable_superblocksblkid_probe_set_superblocks_flagsblkid_probe_step_backblkid_do_probeblkid_free_probestderrvfprintfgetchartolowerfeofversionsort64fdopenrand_raccessferrorfputsvsnprintflocaltimestrftimesprintfprlimit64gnu_dev_minorgnu_dev_majorgnu_dev_makedevdup2__isoc23_fscanfopenlogcloselogclock_gettimelocaltime_rabortsd_journal_printv_with_locationvsyslogsd_journal_send_with_locationqsort__isoc23_strtoul__assert_failforkexecvpwait4pipewaitpidgethostnamesigprocmasksigactionsigismembersigdelsetsigaddsetsigfillsetudev_newudev_unrefudev_queue_newudev_queue_get_udev_is_activeudev_queue_unrefgetpagesizegetrlimit64mallinfomlockmunlockmlockallmunlockallgetprioritysetprioritysd_bus_open_systemsd_bus_call_methodsd_bus_error_has_namesd_bus_message_readsd_bus_error_freesd_bus_message_unrefsd_bus_flush_close_unrefstrncasecmpmktime__isoc23_strtolrmdirsymlinksetmntentgetmntentendmntentputchar__isoc23_strtoullnl_langinfooptargoptindgetopt_longperrorgetppiddirfdgetuidgeteuidunsetenvnanosleeprewindsetsidlvm2_runlvm2_initlvm2_exitlvm2_disable_dmeventd_monitoringlvm2_log_levellvm2_log_fnlvm2_init_threadedsocketconnectselectffsmknodmemchrmatchpathconis_selinux_enabledsetfscreateconfreeconlsetfileconchownsemctlsemgetsemopftruncate64gmtime_risspacememccpynearbyintlfloorlpthread_mutex_lockpthread_mutex_unlockstrnduplibdevmapper-event.so.1.02.1libsystemd.so.0libblkid.so.1libaio.so.1t64libselinux.so.1libudev.so.1libm.so.6libc.so.6liblvm2cmd.so.2.03BaseGLIBC_2.2.5LIBAIO_0.4LIBAIO_0.1LIBSELINUX_1.0LIBSYSTEMD_222LIBSYSTEMD_233LIBSYSTEMD_221LIBSYSTEMD_209LIBUDEV_183BLKID_2.23BLKID_1.0BLKID_2.17BLKID_2.15GLIBC_2.13GLIBC_2.14GLIBC_2.4GLIBC_2.28GLIBC_2.3GLIBC_2.33GLIBC_2.38GLIBC_2.3.3GLIBC_2.17                 ^ q J  ui v  0t0 q0 -     q  Pb b b b =  #  PA  e A  A   T  % ii 0 : ii E  O  Z si e  q ui v *-*i*p-**% *]%(*%0*%8*%@*%H*(%P*A%*\%*%p*mx*t*y*&*&*&*&*&(*&@*&X*hR!p*"&*)&*>&*L&*R!*_&*R!*R!0*h&H*h&`*v&x*&*&*&*&*S!*&*& *&8* &P*'&h*1&*A&*O&*(S!*T&*n&*z&*&(*8&H*W4&`*`4&x*k4&*r4&*w4&*}4&*4&*4&*4&*4&*W4&*4&*4&H*r4&`*w4&x*}4&*4&*4&*k4&*4&*4&*4& *85&8*4&P*4&h*5&*+5&*@5&*L5&*4&*\5&*l5&*|5&(*5&@*5&*k&*k&*k&*k&*k&*k&*k&*k&*l&* l&*l&*'l&*3l&*;l&*Cl& *Ll&(*[l&0*ml&8*yl&@*l&H*l&P*l&X*l&`*l&h*l&p*l&x*l&*l&*m&*m&*"m&*/m&*&*L&*R!*_& *R!8*R!P*h&h*h&*v&*&*&*&*&*S!*&(*&@*&X* &p*'&*1&*A&*O&*(S!*T&*n&*z&0*&H*8&`* z&h*'x*z&*'*z&*'* z&*'*'z&*'*+z&*'*2z&*'*6z&*' *>z&(*'8*Bz&@*'P*Lz&X*'h*Pz&p*'*Yz&*'*]z&*'*dz&*'*hz&*'*qz&*'*uz&*D'*zz&*P'(*z&0*t'@*z&H*t'X*i%`*t'p*z&x*'*%*'*%*'*z&*'*z&*'*&*'*z&*'*z& *'0*`z&8*'H*z&P*'`*z&h*'x*z&*'*z&*'*z&*4 '*z&*4 '*z&*@ '*z&*@ '*z&*L ' *z&(*L '8*z&@*X 'P*z&X*X 'h*z&p*d '*z&*p '*z&*p '*z&*| '*z&*| '*z&* '*{&* '*{&* '(*{&0* '@*{&H* 'X*{&`* 'p*{&x* '*'{&* '*+{&* '*4{&* '*'*'*'*'(*'8*'H*'X*'h*'x*'*'*'*'*'*'*'*'*'*'*'(*'8*a{&H*BX&X* 'h*'x*'*'*'*'*'*'*'*'*'*'*'(*'8*'H*'X*'h*'x*'*'*'*'*'*'*'*'*'*'*'(*'8*'H*'X*'h*'x*'*'*'*'*'*'*'*'*'*'*'(*a{&8*BX&H*|&X*'h*Si&x*|&*8&*?*?*8&*8&*8&*8&*8&* '*`,*"(**0*,8*8&H**P*,X*8&h**p*,x*8&* **,*8&*0**,*8&*@**0,*8&*P**`,*8&*`**,*8&(*p*0*,8*8&H**P*,X*8&h**p*,x*8&*** ,*8&*** ,*8&***@ ,*8&***` ,*8&*** ,*8&(**0* ,8*8&H**P* ,X*8&h**p* ,x*8&* **!,*8&*0** !,*8&*@**@!,*8&*P**`!,*8&*`**!,*8&(*p*0*!,8*8&H**P*!,X*8&h**p*!,x*8&***",*8&*** ",*8&***@",*8&***`",*8&***",*8&(**0*",8*8&H**P*",X*8&h**p*",x*8&* **#,*8&*0**@#,*8&*@**#,*8&*P**#,*8&*`**$,*8&(*p*0*@$,8*8&H**P*$,X*8&h**p*$,x*8&***$,*8&***$,*8&***%,*8&*** %,*8&***@%,*8&(**0*%,8*8&H**P*%,X*8&h**p*&,x*8&* **0&,*8&*0**P&,*8&*@**&,*8&*P**&,*8&*`**&,*8&(*p*0*&,8*8&H**P*',X*8&h**p* ',x*8&***@',*8&***`',*8&***',*8&***',*8&***',*8&(**0*',8*8&H**P*(,X*8&h**p* (,x*8&* **@(,*8&*0**`(,*8&*@**(,*8&*P**(,*8&*`**(,*8&(*p*0*(,8*8&H**P*),X*8&h**p*0x*8&***0*8&*** ),*8&***@),*8&***`),*8&***),*8&(**0*),8*8&h*}&p*]&x*0*8&*8&*8&*}&*i*}&*}&**}&*}&**}&*}&*(*("0*}&8*H*}&P*}&X*Ƴh*}&p*}&x*ܳ*~&*C~&**)~&*A~&**8&*8&*H~&*U~&**8&*8&p*ox*^~&*4*X"0*78*"*<*"*'=*"P*k8X*@"*q*q~&*R*|~&p*3x*"*͐*"0*8*"*~*~&**~&P*X* "*x*P"*՞*"p*=x*"*V*"0*۔8*~&*d*"** "P*\X*H"*U*p"*U*"p*Vx*"**T*~&0*8*"*w*~&*d>*P"P*>X*"*0k*"*sB*"p*Cx*H"*L*"0*vM8*"*{*"*{*H"P*u|X*"*}*"*}*"p*@~x*&**&0*8*X"*O*"*O*"P+PX+"+ Q+H"+L7+"p+7x+"+9+"0+98+H"+:+"+;+"P+<X+(#+O<+p#+I$+4&p+l/x+#+/+#0+z8+ #+b+H#+D+p#P+.X+#++B&+Ɂ+_&p+P1x+#+1+#0+9W8+P#+ג+y&++&P +nX +# + +# +d +&p +x +# +x +0#0 +8 +h# +Jy +# +Jy +#P +X +& +i +& +ݠ +&p +Qx +& +š +&0+98+&++,&+*+#P+_,X+@&+,+`#++]&p+ix+#+ҝ+#0+8+o&+j+#+W+(#P+XXX+X#+Y+#+Y+#p+Zx+#+!+&0+8+&+ +#+}+Ā&P+>2X+@#+0+݀&+p+^~&p+rmx+h#+ +&0+{ 8+&++ &+t+#P+6uX+#+u+&+R+#p+lx+<&+Pl+P#0+k8+#+2+@#+Շ+#P+9X+#++#+4U+@#p+4Ux+h#+I$+4&0+;q8+#+q+#+R+#P+RX+P #++Y&++ #p+x+l&++ #0 +@08 +݀& +o +^~& + +&P!+`3X!+@#!+b!+&"+"+&p"+&x"+&"+"+ #0#+8#+ȁ&#+R#+ށ&#+#+&P$+X$+ &$+%[$+ #%+n%+ #p%+nx%+H #%+n%+H #0&+ o8&+ #&+o&+ #&+RQ&+ #P'+4UX'+@#'+4U'+ #(+4U(+0 #p(+4Ux(+h #(+4U(+!&0)+;t8)+ #)+[w)+6&)+Wx)+E&P*+4UX*+ #*+I$*+4&++s++ #p++1rx++@ #++r++h #0,+v8,+ #,+cv,+ #,+'s,+ #P-+3X-+Z&-+]-+H #.+].+p #p.+`x.+ #.+a.+ #0/+fb8/+n&/+c/+#/+Dd/+8#P0+dX0+p#0+RQ0+#1+RQ1+#p1+fx1+0#1+1+p#02+Ih82+#2+j2+#2+i2+#P3+X3+0#3+6g3+h#4+g4+#p4+\\x4+#4+\4+(#05+e85+p#5+uf5+#5+I$5+4&P6+q"X6+#6+#6+@#7+#7+#p7+5!x7+#7+!7+#08+[88+X#8+z-8+#8+_%8+#P9+,X9+#9+9+#:+:+@#p:+@x:+h#:+_:+#0;+8;+#;+{;+&;+N;+#P<+=X<+#<+<+0#=+^=+X#p=+x=+&=+̧=+#0>+8>+#>+:>+#>+>+#P?+X?+@#?+?+x#@+@+#p@+4Ux@+#@+4U@+&A+6A+#A+mUA+8#PB+XB+Ԃ&C+4UC+&pC+xC+&C+C+&0D+8D+ &D+D+5&D+D+J&PE+XE+]&E+E+s&F+F+&pF+UxF+&F+UF+&PG+T&hG+%&G+%G+҅&G+&G+'G+&H+`., H+/,PH+?&hH+`xH+2H+H+H+cH+H+۰H+ٷH+ٷH+8I+%I+(I+8I+HHI+XI+hI+xI+ʏI+YI+MI+MI+uI+uI+I+I+J+EJ+(J+8J+'HJ+9XJ+9hJ+ƼxJ+J+J+J+J+J+J+?J+J+K+5K+ (K+m8K+mHK+XK+hK+xK+R+ҢR+L(R+͠8R+HR+XR+fhR+ƣxR+ҥR+R+7R+R+R+R+l&R+ 'R+ 'R+S+8&S+8&pS+xS+ 'S+S+ 'T+7T+%T+T+ 'PU+XU+ '`+`++ '+ '+4&+ '+ '+y&+ '+ ' +Z5&(+ '0+& '8+z5&@+* 'H+4 'P+4&X+8 '`+B 'h+z&p+F 'x+g&+3&+P '+Z '+[ '+] '+g '+ '+l '+v 'Ȇ+&І+{ '؆+ '+&+ '+ '+&+ '+ '+%+ ' + '(+'0+P '8+Z '@+&H+ 'P+ 'X+y&`+ 'h+ 'p+Z5&x+ '+& '+z5&+* '+4 '+4&+8 '+B '+z&+F 'ȇ+ 'Ї+3&؇+P '+ '+[ '+ '+ '+ '+ '+ '+& + +(+ +0+0+8+0+@+@+H+@+P+P+X+P+p+Bx+N+N+B+V+/U+hVȈ+U+D[+h +g(+S[8+oX+?n`+1oh+ n+#s++rȉ+s}+O++P+#sX+ɘ`+h+x+4+O++Ȋ+8%Њ+?%؊++M%+A&+W%+ &+d%+t%+%(+%x+&+@ȋ+%+%+S&P+ph+S&++&++%@+X+3B&++k|&+6'H+&++ &Ў+8+$y& +%8+&p+`+@%+؏+%+(+%8+ڕH+`+Hx+I&+%+Ȑ+b=&ؐ+%++%h+%+0+%ȑ+ٗ&++1&+Ѭ&@+X+9%+P+I%+x+&+Y%0+pH+h%X+'&+@+&+|%Г+ +%+|% +88+h&H+LX+R+%++7ؔ+%+8&(+%x+&+ȕ+%+X+%P+ h+%+ +%Ȗ+%+ +%@+ X+3%h+'&+ +G%+ +c%0+@ H+v%+ +%И+X +~% +( 8+H p+h +%+x ؙ+%+0 (+%x+%+X Ț+ %+ +%P+h h+ + +%%+P +=%@+ X+L%+ +[%Ȝ+l%+ + 0+ H+X$ +$ +%Н+$ +% + & 8+%H+'h+`& p+%+%+& ؞+x%+'+P' (+t&`+( x+t&+@) ȟ+%+) +%(+^P+* h+%+@, +, + - +%@+`- X+%+(. +*%+'+. +=%+Y%0+/ H+a%+(1 +o%+ՖТ+h1 +% +2 8+%p+3 +%+3 أ+%+4 (+%`+x5 x+%+6 Ȥ+ %+7 +%P+@8 h+9%+x8 +N%+8 +g%@+ 9 X+x%+9 +%+: +%0+; H+%+@< +%Ч+< +% +> 8+%p+? +%+'&+@ ب+ %+C (+U&`+E x+%+PF ȩ+,%ة+=%+I +I%(+@J P+J h+Z%x+hK +K +J&+xN +p%@+N X+w%+xP +A&+P +&0+P H+~%+Q +%Ь+Q +% +xR 8+%p+R +%+ '+R ح+k|&+S (+%x+%+HT +T Ȯ+4%خ+U +U +F%(+U P+PV h+&+V +%ȯ+:د++ W +k&@+xW X+%h+ x+ŕ+W +%+0X +%0+XX H+%+X +%б+X +#& +0Y 8+&&H+z&p+Y +%+Y ز+&+Z (+k|&`+[ x+%ȳ+S&س+{%+%%h+6%+&ȴ+H%+N%+m%+l%(+q%@+\ X+{%+%+\ +%H+%+%+%+%ж+\ +% +] 8+&p+X_ +&+/&ط+E&+_ (+P` x+^&+x` ȸ+q&ظ+п&+&+a +&P+e h+&x+&+&+f +&ȹ+*&ع+ &+i +Xl @+l X+$&+m +5&+A&H+Z&+n +b&л+o +o& +o 8+&p+Pp +&+8&+q ؼ+&+&+&+s (+&8+&H+&`+`u x+$&+;&+Q&+v Ƚ+c&ؽ+v +w +v&(+&P+8x h+&+px +&+y +&+&(+&@+z X+&h+&x+&&+X| +7&+O&ȿ+f&+} +y&+v 0+} H+&X+&+~ +&+&+&+~ +&+& +8 8+&p+x +&+&+&&+P +3&+ٗ&+ (+D&`+X x+@%+ +S&+`&+ȅ +w&P+ h+&+H +&+؊ +&@+ X+&+ +&+ +&+Si&0+h H+&+ +&+ؑ +& +` 8+&p+ +9&+h +)&+h (+E&`+H x+[&+ + +n&+ +˴&P+ h+f&x+'&+ +&+&+H +&+@+ X+&h+&+ +&+fM&+ +خ +&0+ H+ &+ +h + +&& +p 8+C&p+ص +a&+ +}&+ (+&`+ x+ &+@ +&+ؼ +&P+` h+&x+&+ +&+ +&@+x X+&+ +&+ +&0+ H+&+H +&+ +3&+ +( 8+B&p+@ +`&+S&(+X&x+c&+m&+P&h+ U&+z&+&+ +&@+ X+&h+8&+0 +D&+ +&0+ H+~&+ +t&+4&+@ +&+& +p 8+b&p+ +=&+ +&+ (+&`+h x+&+&+@ + &+&+ +&&(+p P+ h+4&x+p + +J&+S&+ +c&+ @+ X+l&h+ + +}&+&+8 +&+ 0+ H+&X+P + +&+&+( +&+ + 8+&H+0 p+p +&+&+ + &+p + (+ &8+ `+p x+&+&+ + &+ + + &(+ P+@ h+- &x+; &+ +B &+P &+P +W &+e &@+ X+l &h+} &+@ +n &+ &+ + &+&0+H H+ &X+&+ + &+S&+H + &+ & + 8+ &H+ &p+` + &+ + &+ (+4 &8+ `+ x+C &+ +P &+ +0 +a &(+@ P+` h+u&x+n &+` + &+ &+ +&+n &@+!X+&h+ &x+ &+!+ &+!+&0+@!H+%+!+ &+!+ & +8!8+ &p+!+&+ٗ&++3+%+R+{ +&(+&0+ &8+V&@+&H+:&+M+++_++c(+h++-&+4&+&4&+04&+:4&+D4&+N4&+)+u+ + ++)+ ++0+8+@+,H+P+{X+`+h+Sp+x+++ʕ++e+ؖ+!++E+++Y+++8 +E(+$0+~@+H+CP+NX+O`+2Th+Up+Zfx+c+`q+q+[r(+=&0+=&8+=&@+8&H+8&P+RD&X+Si&`+&h+XD&p+%x+&+8&+%+_D&+8&+jD&+38&+N&+nD&+.&+o&+&+ٗ&+^G&+[V&+n&+o&+&+& +&(+*&0+h&8+d&@+M&H+jG&P+eG&X+zG&`+uG&h+#H&p+G&x+G&+ױ&+G&+G&+&+W&+S&+6'+M&+&+e&+&+&+G&+G&+п&+&+G&+G&+G&+G& +G&(+G&0+G&8+G&@+H&H+ H&P+H&X+i&`+D&h+&p+&x+H&+Pb&+/H&++%+%+G+G+H+H+%+rH+%+%+%++%+GV+ W +H(+W0+^X8+W@+VH+%P+%X+%`+h+Hp+Ix+VI+I+%+I+%+%+J+vL+MJ++J+K+K+L+JK+%+%+L+YO+0M+iM +(+M0+N8+N@+-NH+%P+%X+O`+Qh+Pp+hPx+P+P+kQ+%+2Q+%+%+R+]T+>R+wR+R+;S+S+S+%+%+%+%+U+% +T(+!U0+%8+U@+%H+%P+%X+%`+Xh+oZp+Xx+4Y+Y+6Z+%+%+%+%+%+%+%+%+%+%+%+%+%+%+%+%0+S'8+,-@+J)H+)X+f9h+1p+/x+<+O?++@+W>+>+$?+j&+j&+j&+++ױ+n++9++w+c+y+j++ +H+ &`+h+x+[&+++p&+*++p&+p++p& +(+8+p&P+X+h+p&+֬++p&+֬++p&+֬++p&+֬+(+p&@+֬H+X+q&p+֬x++q&+֬++*q&+֬++?q&+֬++Nq&0+֬8+H+aq&`+֬h+x+sq&+֬++q&+++q&+֬++q& +֬(+8+q&P+֬X+h+q&+++q&+++q&+++q&++(+q&@+H+X+q&p+x++M&+M++r&+++r&+++ r&0+֬8+H+-r&`+֬h+x+?r&+֬++Nr&+֬++br&+++vr& +(+8+r&P+X+h+r&+5++r&+n++ &+++ܤ&++(+r&@+NH+X+r&p+x++r&+++r&+++r&+W++&0+8+H+ s&`+h+x+s&++++s&+++s&+2++'s& +x(+8+8s&P+X+h+@s&+++Ms&+++Us&+++`s&,d,(,ls&@,H,X,ts&p,Gx,,s&,,,s&,`,,s&,֬,,%0,֬8,H,s&`,!h,x,s&,[,,s&,,,s&,֬,,s& ,֬(,8,s&P,֬X,h,t&,֬,,t&,֬,,6t&,J,,%t&,,(,2t&@,H,X,Ct&p,Qx,,Pt&,,,u&,֬,,]t&,֬,,ot&0,֬8,H,t&`,֬h,x,t&,֬,,t&,֬,,t&,֬,,t& ,֬(,8,t&P,֬X,h,t&,֬,, u&,֬,,u&,v,,*u&,֬,(,:u&@,֬H,X,Ju&p,֬x,,^u&,֬,,qu&,֬,,u&,֬,,u&0,֬8,H,u&`,֬h,x,u&,֬,,u&,֬,,u&,֬,,v& ,֬(,8,v&P,BX,h,v&,,,&,7,,9&,,,& , ,( ,#v&@ ,֬H ,X ,,v&p ,֬x , ,5v& , , ,Av& ,E , ,Mv& ,֬ , ,7&0 ,8 ,H ,Xv&` ,h ,x ,`v& , , ,hv& ,8 , ,pv& ,v , ,xv& ,֬( ,8 ,v&P ,֬X ,h ,v& ,֬ , ,v& , , ,v& , , ,v& ,% ,( ,v&@ ,\H ,X ,v&p ,x , ,v& , , ,v& , , ,v& ,֬ , ,w&0 ,֬8 ,H ,w&` ,@h ,x ,w& ,o , ,0w& , , ,7w& , ,,& ,(,8,?w&P,OX,h,Gw&,֬,,Vw&,֬,,dw&,֬,,pw&,֬,(,w&@,֬H,X,w&p,֬x,,w&,֬,,w&,֬,,w&,,,w&0,8,H,w&`, h,x,w&,D,,w&,{,,w&,,,w& ,(,8,x&P,#X,h,x&,V,,Z:&,,,a:&,,,0x&,,(,%x&@,H,X,9x&p,"x,,Bx&,[,,Mx&,,,Vx&,,,^x&0,]8,H,ix&`,h,x,vx&,4,,x&,m,,x&,,,x& ,(,"8,.N&P,X,h,`&,;,,x&,k,,x&,K,,x&,{,(,l:&@,H,X,x&p,x,,x&,,,x&, ,,o&,,,P&0,8,H,0V&`, h,x,x&,J,,T&,,,,%, ,,x% ,(,8,`&P,X,h,@V&,,,x&,,, &,=,,y&,{,(,z&@,H,X,y&p,x,, y&,,,)y&,P,,7y&,,,Ey&0,8,H,%`,.h,x,\y&,x,,my&,,,t&,֬,,t& ,֬(,8,yy&P,֬X,h,y&,֬,,%,֬,,%,֬,,y&,֬,(,y&@,֬H,X,9%p,֬x,,y&,֬,,y&,֬,,x%,֬,,%0,֬8,H,%`,֬h,x,%,֬,,%,֬,,%,֬,,% ,֬(,8, %P,֬X,h,%,֬,,y&,֬,, &, ,,z&,<,(,8&@,֬H,`,{3&h,&p,M%x,[{&,&,',&,',}X&,',}X&,',&,'0,&8,'`,h&h,'p,',h&,',',%,',%,',Yw&,' ,Yw& ,' ,}X&( ,'@ ,}X&H ,'` ,&h ,' ,& ,' ,L& ,' ,L& ,' ,& ,'!,&!,' !,a{&(!, <&0!,k{&@!,BX&H!,z&P!,'`!,v{&!,{&!,{&!,'!,{&!,{&!,'!,{&!,{&!,'!,{&!,{&!,'",&",' ",&(",'@",&H",'`",&h",'",{&", &",'",{&", &",'",{&",{&",'",{&",{&",'#,{&#,%#,{&#,'@#,{&H#,%P#,{&X#,'#,{&#,%#,{&#,'#,{&#,%#,{&#,'$,{&$,%$,{&$,'@$,{&H$,%P$,{&X$,'$,{&$,j&$,'$,{&$,j&$,'$,|&$,&$,'$,|&$,&$,'%,.%%,' %,.%(%,'@%,|&H%,'|&P%,2|&X%,'%,|&%,'|&%,2|&%,'%,7|&%,N|&%,]|&%,'&,7|&&,N|&&,]|&&,'0&,J&8&,'P&,J&X&,'&,f|&&,&&,'&,f|&&,&&,'&,`&&,'&,`&&,'',v|&',i}&',' ',v|&(',i}&0','@',&H','`',&h','',&','',&','',&','',&','(,&(,' (,&((,'@(,a{&H(, <&P(,k{&`(,BX&h(,z&p(,'(,|&(,|&(,|&(,s&(,'&(,Si&(,|&(,|&(,|&(,|&(,|&),8&),M% ),8&(),M%@),8&H),M%`),8&h),M%),8&),M%),8&),M%),),),),),),),),0*,),*,8&*,8&*,*,*,*,+,+,+,+,+,+, +,+,(+,(+,0+,(+,+,),(,,j&8,,8&h,,h,,p,,h,,,,,,,,,,,,,,,,,,,,,,,,,,(-,8-,H-,Ӽ`-,*p-,Zx-,-,-,-,-,>-,i-,I-,x-,-,-,-,-,.,.,i(.,p.,fx.,H.,'.,.,.,,.,.,.,_.,.,W.,/,/,(/,!8/,8P/,ZX/,`/,h/,_/,/,S/,0,0,_@0,M&H0,[&P0,&X0,[&`0,[&h0,&p0,%e&x0,%0,E&0,0,0,0,0,0,0,0,r0,*0, 0,0,1,1,j@1,P1,X1,`1,rh1,x1,1,1,1,1,j1,r1,1,?1,M&1,3&2,V&2,Z& 2,g&(2,V&02,s&H2,&P2,V&X2,&h2,up2,&x2,&2,&2,B2,˔&2,&2,2,&2,&2,&2,g2,ʔ&2,Ҕ&2,ܔ&3,3,&3,˔& 3,&03,IJ83,l&H3,&X3,IJ`3,&p3,&3,IJ3,V&3,&3,IJ3,-&3,&3,۲3,&3,&4,%&4,,& 4,IJ(4,?&04,N&84,h&H4,P4,w&X4,~&`4,&p4,x4,&4,&4,&4,4,ȕ&4,b#4,ҕ&4,4,ߕ&4,&4,&4,&4,&4,&5,&&5,5,2& 5,>&(5,%&85,_@5,1&H5,9&P5,&`5,h5,&p5,&x5,K&5,5,W&5,_&5,q&5,H5,}&5,&5,&5,ŭ5,&5,&5,&6,ɵ6,&6,&6,&(6,-06,+&86, &@6,ɖ&P6,X6,֖&`6,ߖ&h6,&x6,ر6,&6, &6,&6,N6,*&6,3&6,F&6,56,U&6,`&6,e&6,ơ6,v&7,{%7,&7,IJ 7,&(7,c#07,&@7,lH7,&P7,Hc#X7,&h7,ֳp7,&x7,c#7,&7,&7,ė&7,͗&7,ޗ&7,7,&7,&7,&7,w7,&7,-&7,B&8,8,W&8,h& 8, &08,\88,n&@8,n&H8,u&X8,`8,&h8,c#p8,&8,8,&8,&8,&8,8,Ƙ&8,ј&8,ޘ&8,8,&8,&8,&8,T9,&9,"&9,9& 9,.(9,H&09,d#89,S&H9,P9,b&X9,`d#`9,m&p9, x9,z&9,d#9,&9,&9,"&9,&:,&(:,d#0:,&H:,&`:,e#h:,Ι&:,ٙ&:,h#:,&:,&:,h#:,&:,&;,h#;, &(;,&@;,`i#H;, &`;,,&x;,i#;,6&;,B&;,i#;,L&;,V&;,j#;,^&<,i& <,m#(<,r&@<,&X<,n#`<,&x<,&<,o#<,&<,&<,p#<,ǚ&<,Қ&=,r#=,ۚ& =,&8=,s#@=,&X=,&p=,Xv#x=,&=,6&=,v#=,L&=,Z&=,0w#=,f&>,t&>,& >,&8>,&P>,&X>,Л&p>,&>,y#>,&>,&>,&>,#&>,-&>,y#?,5&?,H&0?,Pz#8?,Y&P?,i&h?,z#p?,P&?,w&?,H{#?,&?,&?,&?,&?,Ȝ&@,0|#@,՜&0@,&H@,ȃ#P@,&h@,&@,#@,%&@,7&@,8#@,G&@,R&@,#@,[&A,m&(A,H#0A,}&HA,&`A,#hA,&A,&A,X#A,&A,&A,@#A,ŝ&A,ҝ&B,H#B,ݝ&(B,&@B,#HB,&`B,&xB,X#B, &B,&B,#B,/&B,J&B,#B,>&C,J& C,Џ#(C,T&@C,i&XC,P#`C,|&xC,&C,#C,&C,&C,#C,&C,מ&D,#D,& D,&8D, #@D,&XD,/&pD,F&xD,W&D,m&D,#D,&D,&D,#D,&E,&E,8# E,&8E,ɟ&PE,@#XE,ן&pE,&E,0#E,&E,&E,`#E,&E,&E,#F,#&F,/&0F,#8F,9&PF,G&hF,#pF,S&F,`&F,#F,k&F,x&F,`#F,&F,&G,X#G,&0G,&HG,&PG,&hG,ʠ&G,#G,ܠ&G,&G,p#G,&G,&G,Л#G,&H, &(H,0#0H,0&HH,>&`H,p#hH,J&H,[&H, #H,j&H,}&H,#H,&H,&I,X#I,&(I,&@I,Т#HI,á&`I,͡&xI,0#I,&I,ա&I,#I,&I,&I,x#I,&J,& J,#(J,&@J,+&XJ,#`J,5&xJ,A&J,p#J,K&J,\&J,P#J,k&J,z&K,#K,& K,&8K,#@K,&XK,&pK,P#xK,&K,Ţ&K,#K,Ѣ&K,&K,8#K,&L,&L,# L, &8L,&PL,(#XL,&pL,.&L,h#L,;&L,J&L,#L,W&L,f&L,#M,s&M,&0M,#8M,ݨ&PM,&hM,@#pM,_&M,&M,в#M,&M,ɣ&M,#M,٣&M,&N,&0N, &HN,ȴ#PN,&hN,.&N,#N,A&N,W&N,#N,&N,k&N,#N,u&O,&(O,#0O,&HO,&`O,#hO,&O,ڤ&O,ظ#O,&O, &O,#O,&O,*&P,#P,5&(P,A&@P,#HP,K&`P,]&xP,@#P,|&P,m&P,#P,w&P,&P,#P,&Q,& Q,#(Q,&@Q,&XQ,#`Q,&xQ,Υ&Q,#Q,Ӣ&Q,ݥ&Q,x#Q,&Q,&R,(#R,& R,&8R,#@R,#&XR,,&pR,3&xR,L&R,Y&R,H#R,d&R,r&R,8#R,~&S,&S,# S,&8S,&PS,#XS,&pS,&S,#S,Φ&S,ߦ&S,h#S,&S,&S,#T,&T,#&0T,#8T,4&PT,H&hT,@#pT,Z&T,h&T,#T,t&T,`&T,#T,&T,&U,8#U,&0U,&HU,#PU,&hU,&U,X#U,ȧ&U,է&U,h#U,&U,&U,&U,&V,&&(V,(#0V,5&HV,D&`V,F&hV,1&V,Q&V,0#V,X&V,g&V,@#V,t&V,&W,#W,&(W,&@W,#HW,&`W,&xW,h#W,&W,ʨ&W,#W,ب&W,&W,#W,&X, & X,#(X,&@X,$&XX,#`X,,&xX,9&X,H#X,D&X,T&X,#X,b&X,o&Y,#Y,z& Y,&8Y,@#@Y,&XY,&pY,#xY,&Y,&Y,#Y,&Y,&Y,Ʃ&Y,&Z,&Z,h# Z, &8Z,&PZ,(#XZ,$&pZ,4&Z,#Z,B&Z,S&Z,#Z,b&Z,z&Z,h#[,&[,&0[,#8[,&P[,ɪ&h[,#p[,֪&[,&[,#[,@&[,&[,#[,&[,&\,8#\,&0\,&P\,(&h\,6&\,B&\,Q&\,^&\,l&\,x&],&0],&H],&h],&],Ϋ&],&],&],&],&&^,<&(^,P&H^,b&`^,x&^,&^,&^,&^,&^,&_,& _,#(_,Ǭ&@_,Ϭ&X_,`#`_,լ&x_,&_,@#_,&_,&_,#_,&_,,&`,@$`,9& `,H&8`,$@`,U&X`,e&p`,F&x`,s&`,&`,H$`,&`,&`,p$`,&a,&a,$ a,&8a,ŭ&Pa,x$Xa,ϭ&pa,ޭ&a,$a,&a,&a,$a,&a, &a,$b,&b,(&8b,ڢ&Pb,9&hb,$pb,@&b,J&b,8 $b,&b,J&b,&b,Q&c,X&c,&0c,&Hc, $Pc,&hc,l&c,8 $c,v&c,"&c,&c,&c, $c,&d,&(d,P $0d,&Hd,&hd,ʮ&d,`&d,x $d,֮&d,`&d,x$d,&d,&e,$e,&(e,&@e,$He,1&`e,=&xe,$e,s&e,G&e, $e,N&e,_&e,n&e,&f,& f,p$(f,&@f,&Xf,$`f,&xf,&f,$f,&f,˯&f,$f,߯&f,&g,$g,& g,&8g,P$@g,&Xg,&pg,P$xg,)&g,:&g,$$g,?&g,I&g,h%$g,P&h,[&h,h&$ h,d&8h,v&Ph,&$Xh,&ph,&h,&h,&h,'$h,&h,&h,*$i,°&i,ٰ&0i,x+$8i,&Pi,&hi,H,$pi, &i,&i,,$i, &i,3&i,D&i,N&j,x-$j,V&0j,d&Hj,-$Pj,p&hj,}&j,.$j,&j,&j,&j,a&j,.$j,&k,&(k,/$0k,&Hk,ձ&`k,3$hk,&k,&k,h9$k,&k,&k,&k,&l,9$l,&(l,!&@l,<$Hl,5&`l,(&xl,H=$l,/&l,B&l,>$l,S&l,\&l,H@$l,c&m,\& m,@$(m,o&@m,|&`m,&xm,J&m,B$m,f&m,&m,&m,&n, C$n,& n,Ҳ&8n,E$@n,&Xn,&pn,H$xn,&n,&n,I$n,&n,J&n,xI$n,%&o,.&o,J$ o,5&8o,"&`o,?&po,8&o,H&o,V&o,c&o,r&o,&o,&o,&o,&p,&p,г& p,&0p,&@p,&Pp,&`p,5&pp,K&p,`&p,r&p,&p,&p,&p,Ŵ&p,۴&p,&q,&q,& q,&0q,&&@q,8&Pq,M&`q,a&pq,z&q,&q,&q,&q,׵&q,&q,&q,&q,)&r,:&r,L& r,]&0r,r&@r,&Pr,&`r,&pr,&r,ȶ&r,޶&r,&r,&r,&r,-&r,A&r,U&s,h&s,{& s,&0s,&@s,·&Ps,ѷ&`s,߷&ps,&s,&s,&s,5&s,P&s,j&s,8&s,t&s,8&t,}&t,o& t,&0t,&@t,&Pt,ױ&`t,&pt,*&t,&t,&t,^&t,h&t,&t,v&t,Ÿ&t,&u,͸&u,& u,ٸ&0u,&@u,&Pu,&`u,&pu,&u, &u,G&u,&u,п&u,&u,G&u,'&u,G&v,1&v,G& v,;&0v,&@v,F&Pv,Si&`v,P&pv,`&v,Y&v,&v,h&v,Pb&v,v&v,8&v,&v,ٗ&v,&w,&w,& w,ù&(w,ӹ&8w,&@w,&Pw,&Xw,&hw,/&pw,?&w,U&w,g&w,|&w,&w,&w,&w,˺&w,ٺ&w,&w,&w,&x,+&x,@&x,Q&(x,e&0x,u&@x,&Hx,M$Xx,&`x,M$px,&xx,N$x,(N$x,ٻ&x,&x,&x,&x,PN$x,)&x,G&x,d&x,}&y,&y,&y,& y,ϼ&0y,&8y,&Hy,&Py,#&`y,<&hy,xN$xy,N$y,N$y,N$y,O$y,Q&y,8O$y,n&y,&y,&y,`O$y,&y,O$z,O$z,O$ z,P$(z,(P$8z,PP$@z,׽&Pz,&Xz,pP$hz,P$pz,P$z,P$z, &z,#&z,Q$z,@Q$z,9&z,R&z,hQ$z,g&z,&z,&{,Q${,Q${,Q$({,R$0{,8R$@{,pR$H{,R$X{,&`{,R$p{,R$x{,S${,@S${,hS${,S${,S${,S${,Ծ&{,&{,&{,&{, T$|,PT$|,.&|,E& |,X&0|,l&8|,|&H|,&P|,&`|,&h|,T$x|,T$|,ֿ&|,&|,&|,&|,$&|,?&|,U$|,8U$|,V&|,l&|,`U$},U$},U$ },U$(},~&8},&@},&P},&X},&h},&p},&}, &},&},3&},F&},Y&},h&},}&},V$},@V$},&},&~,&~,&~,&(~,&0~,&@~,&H~,(&X~,<&`~,L&p~,b&x~,t&~,&~,&~,&~,&~,&~,&~,&~,&~,&~,.&,C&,T&,g& ,v&0,&8,&H,&P,&`,&h,`V$x,V$,&,&,&,&,$&,@&,X&,u&,&,&,&,&,& ,&(,&8,&@,&P,&X,,&h,?&p,N&,d&,v&,&,&,&,&Ȁ,&Ѐ,&,&,&,&,&,#&,0&(,C&0,R&@,g&H,x&X,&`,&p,&x,&,&,&,&, &,%&,:&Ё,Q&؁,d&,&,&,&,&,& ,&0,&8,"&H,8&P,J&`,`&h,r&x,&,&,&,&,&,&,&Ȃ, &؂, &,2&,C&,P&,i&,~& ,&(,&8,&@,&P,&X,&h,&p,&,$&,2&,G&,X&,i&,v&ȃ,&Ѓ,&,&,&,&,&, &, &(,4&0,D&@,Z&H,l&X,}&`,&p,&x,&,&,&,&,&, &,&Є,3&؄,D&,T&,`&,s&,&,& ,&0,&8,&H,ZR&`,&h,V$x,`,&,V$ ,LK,&,V$Ȝ,RX,&`,W$p,`,&,&,K,S&,&,1 P,!&X,0W$h,@Z+?HZ+@PZ+AXZ+B`Z+DhZ+EpZ+FxZ+GZ+HZ+IZ+JZ+KZ+LZ+OZ+PZ+QZ+RZ+SZ+TZ+VZ+WZ+YZ+ZZ+\[+][+^[+_[+` [+a([+b0[+c8[+d@[+eH[+fP[+gX[+h`[+ih[+jp[+kx[+l[+m[+n[+o[+p[+q[+r[+s[+t[+u[+v[+w[+x[+y[+z[+{[+|\+}\+~\+\+ \+(\+0\+8\+@\+H\+P\+X\+`\+h\+p\+x\+\+\+\+\+\+\+\+\+\+\+\+\+\+\+\+\+]+]+]+]+ ]+(]+0]+8]+@]+H]+P]+X]+`]+h]+p]+x]+]+]+]+]+]+]+]+]+]+]+]+]+]+]+]+]+^+^+^+^+ ^+(^+0^+8^+@^+H^+P^+X^+`^+h^+p^+x^+^+^+^+^+^+^+^+^+^+^+^+^+^+^+^+^+_+_+_+_+ _+(_+0_+8_+@_+H_+P_+X_+`_+h_+p_+x_+_+HHyO)HtH5"H)%$H)@hfhfhfhfhfhfhfhrfhbfh Rfh Bfh 2fh "fh fhfhfhfhfhfhfhfhfhfhrfhbfhRfhBfh2fh"fhfhfhfh fh!fh"fh#fh$fh%fh&fh'rfh(bfh)Rfh*Bfh+2fh,"fh-fh.fh/fh0fh1fh2fh3fh4fh5fh6fh7rfh8bfh9Rfh:Bfh;2fh<"fh=fh>fh?fh@fhAfhBfhCfhDfhEfhFfhGrfhHbfhIRfhJBfhK2fhL"fhMfhNfhOfhPfhQfhRfhSfhTfhUfhVfhWrfhXbfhYRfhZBfh[2fh\"fh]fh^fh_fh`fhafhbfhcfhdfhefhffhgrfhhbfhiRfhjBfhk2fhl"fhmfhnfhofhpfhqfhrfhsfhtfhufhvfhwrfhxbfhyRfhzBfh{2fh|"fh}fh~fhfhfhfhfhfhfhfhfhrfhbfhRfhBfh2fh"fhfhfhfhfhfhfhfhfhfhfhrfhbfhRfhBfh2fh"fhfhfhfhfhfhfhfhfhfhfhrfhbfhRfhBfh2fh"fhfhfhfhfhfhfhfhfhfhfhrfhbfhRfhBfh2fh"fhfhfhfhfhfhfhfhfhfhfhrfhbfhRfhBfh2fh"fhfhfhfhfhfhfhfhfhfhfhrfhbfhRfhBfh2fh"fhfhfhfhfhfhfhfhfhf%A)fD%9)fD%9)fD%9)fD%9)fD%9)fD%9)fD%~9)fD%v9)fD%n9)fD%f9)fD%^9)fD%V9)fD%N9)fD%F9)fD%>9)fD%69)fD%.9)fD%&9)fD%9)fD%9)fD%9)fD%9)fD%8)fD%8)fD%8)fD%8)fD%8)fD%8)fD%8)fD%8)fD%8)fD%8)fD%8)fD%8)fD%8)fD%8)fD%8)fD%8)fD%~8)fD%v8)fD%n8)fD%f8)fD%^8)fD%V8)fD%N8)fD%F8)fD%>8)fD%68)fD%.8)fD%&8)fD%8)fD%8)fD%8)fD%8)fD%7)fD%7)fD%7)fD%7)fD%7)fD%7)fD%7)fD%7)fD%7)fD%7)fD%7)fD%7)fD%7)fD%7)fD%7)fD%7)fD%~7)fD%v7)fD%n7)fD%f7)fD%^7)fD%V7)fD%N7)fD%F7)fD%>7)fD%67)fD%.7)fD%&7)fD%7)fD%7)fD%7)fD%7)fD%6)fD%6)fD%6)fD%6)fD%6)fD%6)fD%6)fD%6)fD%6)fD%6)fD%6)fD%6)fD%6)fD%6)fD%6)fD%6)fD%~6)fD%v6)fD%n6)fD%f6)fD%^6)fD%V6)fD%N6)fD%F6)fD%>6)fD%66)fD%.6)fD%&6)fD%6)fD%6)fD%6)fD%6)fD%5)fD%5)fD%5)fD%5)fD%5)fD%5)fD%5)fD%5)fD%5)fD%5)fD%5)fD%5)fD%5)fD%5)fD%5)fD%5)fD%~5)fD%v5)fD%n5)fD%f5)fD%^5)fD%V5)fD%N5)fD%F5)fD%>5)fD%65)fD%.5)fD%&5)fD%5)fD%5)fD%5)fD%5)fD%4)fD%4)fD%4)fD%4)fD%4)fD%4)fD%4)fD%4)fD%4)fD%4)fD%4)fD%4)fD%4)fD%4)fD%4)fD%4)fD%~4)fD%v4)fD%n4)fD%f4)fD%^4)fD%V4)fD%N4)fD%F4)fD%>4)fD%64)fD%.4)fD%&4)fD%4)fD%4)fD%4)fD%4)fD%3)fD%3)fD%3)fD%3)fD%3)fD%3)fD%3)fD%3)fD%3)fD%3)fD%3)fD%3)fD%3)fD%3)fD%3)fD%3)fD%~3)fD%v3)fD%n3)fD%f3)fD%^3)fD%V3)fD%N3)fD%F3)fD%>3)fD%63)fD%.3)fD%&3)fD%3)fD%3)fD%3)fD%3)fD%2)fD%2)fD%2)fD%2)fD%2)fD%2)fD%2)fD%2)fD%2)fD%2)fD%2)fD%2)fD%2)fD%2)fD%2)fD%2)fDH=-H-H9tHv2)Ht H=y-H5r-H)HH?HHHtHE2)HtfD=E-u+UH="2)Ht H=n2)d-]wUHH@H}HuHUHEH@H@ H@`Ht]HEH@H@ L@`HUHMHEHHAЅu4Lq1Hҹ#Hƿ4HEH@Hw HEH@HHEbHEHxHHpHUHEHHu4Ls#<HN#HƿHEHHEHEH@HH9EuHEH@HAw HEH@H[| HEHEH@H@ H@`Ht]HEH@H@ L@`HUHMHEHHAЅu4LpCH#HƿEHEHUHHHHHȋHEHUHHHHHȋHHEHUHHHHHH@Hx HEH}tLHUHMHEHHu1Lڷ#MH#HƿEHEЋ@L9EUHH0H}HuHUHEHHEWHUHMHEHHu1LI#_H$#HƿV#HEHHEHUHEHH9uUHH@H}HuHUȉMHEH@PHHHEEĉ¾H-HdHEHEVHPL f-LnmHg#HƿHHEH@ HEuHEsHEtF3CtL -LnuH#HƸ) HEH@HEHEuFBtL -Lun{H#HƸHE<@"HEHEuFqBtL /-L@nH0#HƸgGHEH6#HHudHEHHEH(HHYmu1HEH@PHHEH(HH,m.HEHHEHHlu&HEH@PHHEHHlHEH@PHHUHEHHuUHUHEHt8HUHEH#HƿpHEHEHEEzHEHؚHEHEHEHEHPHEHHmu0EHEPHEЉHEPHEȉHEP HEHEHEHEH;Eu}tNHEHEȋHEЋHuHQRPILʭ##HM#HƿH HEHEUHH}uHUMEHUΉ$UHHH $H`HHdH%(HE1DžH9#HHHHDžG,HHHIHH#HǸ艍$H<-uHƄ_~HHILe#CH#HƿHHm$HHuH0#HiHHHH#HǸhy;HIL^fLH#HƿH,HHH,HUdH+%(tDUHH0H}HuUHMLELMu4Le[Hw#Hƿ}tkHMHUHuHEHt`HUHEHH$u1L(#dH#Hƿ5HMHUHuHEHUHH@H}HuЉUdH%(HE1LEH}HMUHuHEMIHHUdH+%(tUHH H}HuHUuHUHEHƿ:UHSHxH}HuUHMLELMdH%(HE1}tft}HEH@XH%HEHj HHu}HuHEHjjHURAAHqH u4L#H]#HƿEuEH}t HEHUHPH}t HEHX }tHEH讝HDM DEUHuHEHuSHMQHHH u1LƧ#H#HƿfH}uEZUHEUHEPEHEPEȉHEP ẺHEPUHEPUHEPUHEPHUdH+%(tH]UHH0H}HuUHMDEDM5u5HMUHuHEHj}W}WAAHtH UHH H}HuUHMu1HMUHuHEHjjjAAHH UHSH8H}HuHUȉMDEHEHPHEHPHEH@HETu HEH@XH-HEHH" HEHHEH}u4L#H#Hƿ,HEHH8HEHpHUHEHjjjIIйH H HEH@XH%HEHx8HEHPHMHuHEHjjjIIHѺHH tbHEȋ@HuVHuHEHjjjAAHfH uHEH@P@8u HE@HEHEHPHuHEHjMQMQAAHѺHH u4L#H#Hƿ,HEHH8HUHuHEHjjjIIйHxH QHEHa HEH@XHtHEHHt HEL@8AHEHPH}HuHEHjMQMQMIHѺHH u4L # H#Hƿ-HEȋ@tFHEȋ@Ht:HEHH8HUHuHEHjjjIIйHbH ;HEH` )HEHve HEHe HEHEHX8HEHc HHEHPHuHEHjMQMQIIHѺHH u4L#H#Hƿ|HEȋ@HtHEH@XH$tOHEȋ@HuCHEHHAIL3]Hs#HƿHEHd HEHEH@XHHEHPHuHEHjMQMQAAHѺHH u4L#1H֠#HƿqHEȋ@tgHEHX8HEHH@Ha HHEHHpHEHjjjIIйH(H HEHUHP@HEH@XHHEHx8HEHPHMHuHEHjjjIIHѺHH tOHEȋ@HuCHuHEHjjjAAHwH u HE@DHEL@8HEHPH}HuHEHjMQMQMIHѺHH H]UHHPH}udH%(HE1HEH@PHHUHuAAHѺHtEЅu E؅u H:E‹E܉։6}t;HEHM>ILxZ`Hx#Hƿ9HEH>IL=ZcH=#HƿoE‹E܉։9<}t;HEH=IL ZjH۝#Hƿ 9HEHu=ILYmH#Hƿz*tE@ 4HEH=ILYxH.#Hƿ`HEH@PHHUHuAAHѺHtEЅu4L#{Hʜ#HƿE؅u E̍PU̅%}t;HEH1<IL9#H\#Hƿ9HEH;IL#H!#HƿSHUdH+%(t}UHH H}4u HEH;IL2XH#HƿHEH@PHHEH@PHHH HEH}u1Lp#HK#Hƿ}UHUHEHHE}u*L##H#Hƿ0HEH| EUHH H}HuHEH@PHHuAAHu HEH::ILWHe#HƿHEH@PHHEH@PHHH HEH}u1L+#H#Hƿ8YHUHMHEHH E}u*Lڙ#H#HƿHEH3 EUHH@H}HuUHMLEHEHHu(HEHZ @LuHE3HuHEAAHu HEH8ILUH٘#Hƿ HEH@PHHEH@PHHH& HEH}u1L#Hz#Hƿ`H}HMЋUHuHEIH E}u*LG#H"#HƿTHEH EUHHH}HuHEH@PHHUHuAHѺH0UHH H}HudH%(HE1HEH@PHHuAAHhu HEH@HHUHRPHHPIL+TH+#Hƿ]HHUHEHH u1L #H#Hƿ'HEH@HP@HEHHEHHHUdH+%(tUHH0H}HudH%(HE1EHEHHEH@PHHuAAH&u HEH5IL1SH#Hƿ+HUHEHHu1Lݕ#H#Hƿ|HEH@HP0HEH@PHH@HHHUHHEHHu1Ls#HN#HƿEHEHH莮EHUdH+%(tUHH H}HudH%(HE1HEHEH@PHHuAAHu HEH@HHUHRPHHPILQHn#HƿHHUHEHH u1LN#H)#Hƿ[%HEH@P HEHEHHXHUdH+%(t^UHH H}HudH%(HE1HEHHEH@PHHuAAHru HEH3ILP,HE#HƿwHUHEHHu1L)#0H#Hƿ6'HEH@HPHEHHEHH1HUdH+%(t7UHH0H}HudH%(HE1EHEHHEH@PHHuAAHDu HEH1ILOCH#HƿIHUHEHHu4L#GH֑#HƿHEH@H@8Ht9HEH@HP8HEH@PHH@HHHUHHEHHu1L}#MHX#HƿEHEHH蘪EHUdH+%(tUHSH8H}HudH%(HE1HEEHEH3R H@H@%HHEH@XH%HEHQ HH@H@XHH!Hu)HEHQ HH@XHH!HtCHEH0ILNdH.#Hƿ`HEH/IL NiH#HƿzHEH@PHHuAAHu4LMoH#HƿHUHEHHu4L`#tH;#HƿmHEH@H@8Hu6HEILMwH#Hƿ!^HEH $HHYtPHEH>L$HH?t6HEILMMH#HƿHEH@H@8HA#HHtRHEH@HX8HEH-uSILMH#HƿGHHEH@PHHEH@PHHHYHEH}u1Lҍ#H#Hƿ?HUHMHEHHIEH}t HEHHEHHEHUdH+%(tH]UHH0H}HudH%(HE1HEH@PHHEH@PHHHwHEH}u1L#Hˌ#HƿeHMHUHuHEHuDHEH&Et*L#Hk#HƿHUdH+%(tUHH H}HuEHEH@PHHuAAHu4L3JHӋ#HƿHEH@PHHEH@PHHHHEH}u1L#Hj#Hƿ)HUHMHEHHEHEHEUHH0H}HudH%(HE1HEH@XH-t|HEHH8uHEHHEH}uCHEHq*ILIH#Hƿ-HEH@HEHEH@XH2tCHEH*ILIH:#HƿlHEH@PHHEH@PHHH}HEH}u1L#Hщ#HƿeHMHUHuHEH#uDHEH,Et*L#Hq#HƿHUdH+%(tUHH@H}؉uHUdH%(HE1HEH@PHHEH@PHHHvHEH}u1L#Hʈ#HƿkH}HMȋUHuHEIHi uDHEHEt*L#Hd#HƿHUdH+%(tUHH@H}؉uHUdH%(HE1HEH@PHHEH@PHHHiHEH}u1L# H#HƿkH}HMȋUHuHEIHR uDHEHEt*L|#HW#HƿHUdH+%(tUHH0H}HudH%(HE1HEH@PHHEH@PHHH_HEH}u1L؆#"H#HƿaHMHUHuHEHE}u1Et*L#&HZ#HƿHEHEHUdH+%(tUHH@H}؉uHUdH%(HE1HEH@X% HHEH@PHHEH@PHHHKHEH}u1Lą#;H#HƿkH}HMȋUHuHEIHquDHEHEt*L^#@H9#HƿkHUdH+%(tUHH H}HudH%(HE1HUHEHu1Lք#NH#Hƿ!HEP HEHEHHHUdH+%(tUHSHHH}HudH%(HE1HUHuHEAAHѺH ubat H@m$H#HEH#HSILlC[H̃#HƿHEHUdH+%(tH]UHH@H}HudH%(HE1HUHuHEAAHѺH?u1LP#iH+#Hƿ]EHUdH+%(tUHH H}HuHEH@X% HHEH@PHHEH@PHHH3HEH}u1L#vH#HƿYHUHMHEHHDE}u*L[#yH6#HƿhHEHEUHH0H}HuHUEHE@EHEH@X% HHEH@PHHEH@PHHH8HEH}u/L#H#HƿHEH@PHHUHHlHEPHMHUHuHEHE}u*L>#H#HƿKHEHUHEPEUHH H}HEH@PHHEH@PHHH;HEH}u1L#H#HƿUHUHEHH薜E}u*Lg#HB#HƿtHEHEUHH0H}HuU܉MHEH@PHHUHHHEPHEH@X% HHEH@PHHEH@PHHH0HEH}u1L#H#Hƿ_}؋MHUHuHEAHE}u*LR#H-#Hƿ_HEHEUHH H}ECu HEHHEEHEH@H@ t&HEHPHEHHH@EHEHHEHUHEHH9uHEHUHPAL>HI~#Hƿ{HEUHH H}Egu HEHHEDHEH@H@ t%HEHPHEHHH3EHEHHEHUHEHH9uHEHUHPAL~~#Hn}#Hƿ蠾HEUHH H}HudH%(HE1EHEH@HtnHEH@ H@XHt,HEH@ HHXHUHEHхt Eu1L<H|#HƿHUdH+%(tUHHH}HEH@PHHUHHUHH0H}HuHU؉MDE褹HEH}u4L?|#H|#HƿLDHEHHu!HEHHUHHEHHEHHt/L{# H{#HƿɼH}tCHUHEHH-t,Lo{#HJ{#Hƿ|kHUHEHHzt,L,{#H{#Hƿ9(UHEH UHEHHEHEHUHHH $H0HdH%(HE1HH<HHHHH(!HH7HUdH+%(t裺UHH H}HuHEH@XH%t H {#HESHEH@XHt Hz#HE3HEH7 uHEt Hz#HEHEHEH@HUHMHHUHHPH}HuHUHMLEHEHEHUHEHHHEH}u4L1y#FH y#Hƿ>HuHEAHoHEH}u4Lx#IHx#Hƿ߹3HEH臲E}tH}u EELkx#QHFx#HƿxH}tHEH蓺HUHHEHHt`HEHHEH@HH`HUHHEHHu3ELw#XHw#HƿH]UHHpH}HuUMLELMdH%(HE1f)E)E)EEEEEH}HMHUHuHEIIȹHHUdH+%(t谒UHH@H}HudH%(HE1HEH@PHHUHuAAHѺHͪtQEЅtJEԅtCHEHqILHQ#HƿΒHEH*GHHEH@PHHUHuAAHѺH4tNEЅtGEԅt@HEHIL;HQ#Hƿ5HUdH+%(tXUHAUATSHxH}HuHUMLxdH%(HE1Eu EHxH uEHxH@XHH!Hu(HxH@XH H!Hu HE@ HE@t L%R#L%>9$HE@t HQ#H#9$HxHATSILkR#HO#HƿHEXHE@t L-R#L-8$HE@tGHxH@XH%t HR#/HxH@XH$t HQ#H)Q#H`8$}t L%S8$L%Q#HxHHAUSATILQ#HN#Hƿ H HE@HEPHMHxHEAAH聧u/LN#HmN#Hƿ蟏Et E,}t/LKN#H&N#HƿXHE@t,HxH@XH%tHEHP#HH Ep HE@ubHxH tOHxHHE(HEHxH@pHNt\HEHHEHxHH9EuHxH HHPE}tEHxHEHHHEPHE@$HUHxHHu,LL# HL#HƿgHEHO#HH HUHxHEHu*L{L# HVL#Hƿ舍EEHUdH+%(t譌He[A\A]]UHHpH}HuUMDELMdH%(HE1f)E)E)EEEEEċEEHMHUHuHEIȹHHUdH+%(tUHH`H}HuUHMdH%(HE1f)E)E)EEEHMHUHuHEIȹHcHUdH+%(t襋UHH H}EHEHHxHE-HEH@pH蘫uEHEH@xHxHEHEHPxHEHH9u}tHHEHTHHEPIL N HtJ#Hƿ見HEUHH`H}HuHUdH%(HE1E{u  tEHEHILL#` HI#HƿElHEHxILL#e HI#HƿՊHEH u'HEH@XHuHEH HEHt /LGI#j H"I#HƿTHEH HEHLH#o HH#HƿVHUHuHEAAHѺH脡u/LH#r HpH#Hƿ袉EЅ=EHEHHE~HEHxHppHUHEAAHѺHu/L H#{ HG#HƿrEЅt EHEHHEHEHH9EnHEH@XHtpHUHuHEAAHѺH^u/LoG# HJG#Hƿ|EЅtE؅uE}HuHEHq$H7u*LF# HF#Hƿ HEHI#HHHEHE}tcHEH@XH tPHEH u@HEH'IL HRF#Hƿ脇EHEHSI#HHHEEHE HUHuHEAAHѺHȞtEЅt@HEHsILv HE#HƿІEEăHU ȈEHUdH+%(t΅UHH H}HuHUHMyuHEkHUHEHHauEHEHIL HD#HƿHE HEUHAVAUATSHpH}HuHUMLxdH%(HE1E賒u }tbHxHEHH虒uHHxHIL HD#Hƿ8EzHE@uHEHxH@XHt{HxH@XH teHxH]tRHE⿈HEL HAC#HƿsHxH@PH@HxH@XHHxH@XHH!HtHxH# uAHxHpIL HB#Hƿ̓HxH@PHuAHxHIL H>B#HƿpHE@uHEHxH@XHtyHxH5 HhHEHxH@XHuH}tBHEH@XHt/L HA#Hƿ蹂HxHY tAHxHIL H3A#HƿeHxH tAHxHIL H@#HƿZ| tHHxHjILC# H@#HƿǁE HxH urHxHȧuCHxHu0HxHuHxH@XHH!HtHE@HEHxHP(%}tHxHEHHHEPHE@ t L5C#L5($HE@t L-B#L-($HE@t L%ͯ#L%($HEt H[#H($HxH AVAUATSILB# H1?#HƿcH HUHxHEHѺH^u/L?# H>#Hƿ[EtxEuqEȅtj]HMHxHHg9uHEHxH6ILA# Ha>#HƿHxHx HEHEA#HH; HUHxHHE}u*L>#' H=#HƿHEH@#HH }tLHUHxHEHu,L=#+ H=#Hƿ~EHUdH+%(t}He[A\A]A^]UHHpH}HuUMDELMdH%(HE1f)E)E)EEEEE܋EEHMHUHuHEIȹH5u1L<#9 H<#Hƿ}HUdH+%(t}UHHpH}HuUMDELMdH%(HE1f)E)E)EEEEE܋EEHMHUHuHEIȹHru1L<#G H;#Hƿ*}HUdH+%(tM|UHH H}HuH}uEBuE'uHEH9EuEUHH`H}dH%(HE1EuHEH}u4L;;#h H;#HƿH|HUHEHH蹆HEH9bHUHEHHXHEHEtEЅt{TtHEH}u1L:#s Hb:#Hƿ{5HUHEHHtHEHaEHEHEHUdH+%(tzUHH0HdH%(HE1HDžHHHHH@HHHHH@H@PHHAIHH<#HǸy1L\9# H79#HƿizTHHu:HHHHHHH9(HUdH+%(t=yUHH H}HEH HEEHEHUHHHHHȋu8HEHUHHHHHH@H;u HEHHtZHEHUHHHHHȋu5HEHUHHHHHH@HuEHE@L9E%UHHH}Hut HEH@@Hu>HEH@@H@(H%cuHEH@@HUHHTUH t*L H 7#Hƿ>xp]UH讨]UHH H}HuHEHEHEH@XHu6HEH@XH u#HEH@XH%tHEH t HE苀t1HEH@PHHuAAH+uHEH薹HEH肝u:HEHPu*HEHduHEH@XHH!HtHEH tPHEHhILD9# H5#HƿvHEHUHUHH0H}dH%(HE1HEHEHjRHEHEH9EtHEH莸t6HUHEHH uHUHEH HH8HEHUdH+%(tMuUHH H}HEH@XHuHEH@XH t HEHHEHEH@H@HHEH}t HEHEH@H@H觷tOHEH@H@HIL7# H4#Hƿ3uHEH@H@'HEHHEHUHEHH9OUHH H}HuHEHEHEH@XH%uHE苀t5HEH@PHHUHHPuHEHUHUHSH(H}dH%(HE1HEHEH@PHHUHHuCHEHIL' H2#HƿtHUHEH HHd6ujHEHDHHEHtHEH,H$HSIL- HI2#Hƿ{sHHUdH+%(trH]UHSH(H}HuHEH uHEHHEHEHbHEH}tZHEHmHHEH^HSILD H1#HƿrHERHEH>s HHEH@XH,HEH@XH+HEIAѺHEEH]UHH H}HuHEHr HHEH}EEUHH H}HuHEH4#HH HEH}r HHMHEIIйHEEUHH H}HuHEH"4#HHY HEHr HHMHEIIйHYEEUHH H}HuHEHq HHEIAHEHEH3#HH EUHH H}HuHEHbq HHEIAH;EHEH53#HH4 EUHH H}HuHEHp HHEIAHEHEH2#HH EUHHH}HEHƿpUHHH},H(HQH(HBH(H3H(H$H,H,HuM~Hh,Ha,Hu)}՛H<,H5,HuUHH}u%,,]UHHH},,,uiUHHEH(HE&HEH@HHsW uEHEHHEHUHo(H9uʋEUH,]UHH}HuHEHHEHEH@H9EuHEHEHHEHEH9Eu׸]UHH}HuHEHHE HEH@H9EuHEHHEHEH9Euָ]UHH(H֦tH(Hæt]UHH H}HuH(HEHEH@HFHEH}u1LH0#Hƿ0mGHEHPHEHPHUHEHH貤HEHHEHUH(H9mUHH H}HEH(HHHHEH}tEHEHsIL4@HY/#HƿvlHEHHEHb(HHHEH}tEHEHsIL@H.#HƿlHEH谤UHH H}HEHHEHEHHE+HEHyHEHeHEHEHEHHEHEH9EuHEHUHH H}HEHHEHH HEH}u@HEHrIL0H.#Hƿ"k*HEuHEtUHHH}HuHE@<u HEƀHE@<u HEƀHEHUH@HH@UHH H}uUHEH@HEHEHHESHE@<9Eu4HEHHEP@E HEP@HUHEHH5%HEHEHEHHEHUHEHH9uUHHPH}HuHUHMHUHEHHHEH}u6HEILHr,#HƿiHEH@HEHEH@@HEHEHHEJBHEH}t!HEHUHPHUHEHH۠HEHEHEHHEHUHEH@H9uHEHHEHUHEHH9lUHHPH}HuHUHMHUHEHHHEH}u6HEIL H^+#Hƿ{hHEH@HEHEH@HEHEHHEJ.HEH}t!HEHUHPHUHEHHǟHEHEHEHHEHUHEHH9uHEHHEHUHEHH9lUHH H}uHEHHEHH7HEH}uAHEH@HEHE@<9EuHE!HEHHEHUHEHH9uҸUHHH}HEHEuHEH˟HEH蕞HEH@PUHH H}HuH}tPH(HE1HEHHTHE HHfuHEkHEHHEHUH(H9uIHu(HE,HEHPHHEHHeuHE HEHHEHUH8(H9uĸUHHPH}HudH%(HE1HEHEHEHEEH}tHMHEк HHhH}H̘,HUHH誖HEH}H}HEH@HHUHHdHEH@HHUuPILeH/(#HƿLeHHD,HUHHHEH}t)HEHHTHEк HHeu HE6,HE#H}t~,utH̗,HUHH袕HEH}tSHEt;HEIL]wHR'#HƿodHEH}Z,tzEЄtHEHUHH!HEH}tMHEt8HEILH&#Hƿc HEHUdH+%(tbUHHH}HuHUHEHHBUHHH}HEHƿUHH H}HuHEHEHHEH}t HEH@HHEH}tH}tHUHEHH3CHEUHH H}Hu,tTHEHHEH}L!#Hy%#HƿbH,HUHH^HEH}u1L4!#H$%#HƿAbGHEt1HEtHEHPTHEH@HH BUHH H}Hu,t%HUHEHHHEH}u/CH,HUHH耒HEH}uHEtUHSHhH}HuUdH%(HE1HEHEHEHEEH ,HtH}u HMHE HHcHՓ,HUHH軑HEH}u H}t{HEH@hHtnHEH@hH9Et`HEHgHHEH@hHgHHEPSIL@H*##HƿG`HHEHUdH+%(tg_H]UHH H}HuUUHMHEHHUHH}HEH@`]UHH}HEH@PHtHEH@PH@H]UHHPH}dH%(HE1HEHEHEHEEHMHEк HH3bH,(HEiHEH@0HE?HEH@HHEк HH)_uHEH@HHEHHEHUH(H9uHEHHEHUHEHH9uUHHH}HEHy(HHFUHSHHhdH%(HE1H:(HpHpH@HHHQHEHUHAHQHEHUHMHE@HHK=u*L#mH#HƿZHpH@HaHHHEPIL&oHK#HƿhZHHpHHpHpHH(H9H8(HpHpH@HHHxHxHxH@hHHHQHEHUHAHQHEHUHMHE@HH<u*Lm#yH]#HƿzYHxH@hHHxH@hH`HUSPIL{H#Hƿ"YHHpHHpHpH(H9HEdH+%(t!XH]UHSHxH}HuHUHMLEHEHEHEEEHEHH}tHEH艑uH}uLHEH谒u;HEIL<H #Hƿ&XHEILAH#HƿWH}HEH@hHEHEH@ HcHEH@(H%H9u#HMHEHH~tE}t0HUHEHH?HEH}t=HEHEHEHE+HMHEHH݅HEH}tHEHEHEHHEwHEH@HEHEH@ HcHEH@(H%H9u#HMHEHH证tE}tHUHEHH>HEHMHEHH%HEH}u`H}tYHEH]HHEH]SuILH#HƿVHElH}`H}uHEHEHEHEEHUHEHH*Ut`HEH]HHEH]HuSuIL>Hc#HƿUH E}tbH}t[HEH\HHEH\HUHSPuILH#HƿUH fHEHU\HHEHF\HSILH#HƿTHE}t HEHEHEHHEHEH9E{}u}uZH}tCHEH[uuILH#Hƿ3THHEHUHH]UHSHXH}HuHUHMLEHEEHEHH}t6HEHHcHEH@hH@(H%H9u HEH@hHEHEHHEHEH@HEHEHHcHEH@(H%H9ulH}t[HEHZHHEHZHUSPILH#Hƿ SHEJHEHE'HuHEȹHu EHEHHEHEH9E"}t[H}tDHEHYHuILHB#Hƿ_RHHEHUHH]UHAUATSHXHHHdH%(HE1HHHpHDžxHDžHDž`HDžhDžDžDžDžHEHHEHHDž0HDž(HDž HW(H@H@HHHH0u0H@HEHHH@H@HH0>H@H@HH0HHH(HHEHHu(HHEdH+%(H0HHPH(HMH0HPHIH.HPH(HHPHPhH(H9uHPH@hHEH(HVH0ILFHS#HƿpOHKHEH}t%H(HEHPHUHHHކH(HUHHH@H@tH@H訇HEHFVH0ILH#HƿNHHPH9&HDžPHHL@HHHUHHAHE@P%HEPPHPH(HHPH@hHEHEHmUH0ILH#HƿMHHPH`%HDžPHHL@HHHUHHAHE@P%HEPPHEH@H@HHHH@H@HEHEHTH0ILBH#HƿMHH@H蝅HHL@HHHUHHAHE@P%HEPPHHH@H@HHHH@HEH9H HMH0HPHIH*hHPH HHPHPhH H9uHPH@hHEH H:SH0IL3H#HƿKHHEH}t%H HEHPHUHHHH HUHHH@H@tH@HHEHRH0ILH #HƿJHHPHv"HDžPHHL@HHHUHHAHE@P%HEPPHPH HH HQH0ILH #Hƿ)JHHEH}t%H HEHPHUHHH藁H HUHHcH@H@tH@HaHPH HHPH@hHEHEHPH0ILH( #HƿEIHHPH HDžPHHL@HHHUHHAHE@P%HEPPHEH@H@HHHH@H@HEHEHOH0ILGHL #HƿiHHH@HHHL@HHHUHHAHE@P%HEPPHHH@H@HHHH@HEH9;H0HQHPHPHEHHEHH@H@HH@HHHH@H@HNH0HPIL'@)H #Hƿ GHhHEHpH@H@H@HXH0IL@0H #HƿFbHPH@hHMH0HPIL@3H< #HƿYFHHPH@hHXHEH@ H@H@HEHXH;E HXH(HHHEH(HHuDu;HXHˤ(HHHEH(HHlHXH@(H%HXH@(HXH@(H % ЉHEH@(H%HEH@(HEH@(H % ЉHHXHHu HDžHHEHHqu HDžH@H@HHHEHH9EHH9EH@H@HHHEH}t[HXHKHHEHHCHEHkKHHEHHVCH@H@HHHHHxHxHHzfftKHXHHH%rH`HMHHHrHhH`t'HxH`HHBHht'HxHhHHPBHXHAAH3HuHAAHc3HXHpHHFHUHpHHcF ։։H]HuH#HEH1IIHXHIH@HRHHSRRATRRPIL$@~HI#HƿfAH@LhMuL%$HEHHIH`HuHe$HXHtHHHxHuH@$H@HIHHATAUSRPIL@H#Hƿ@H0LHEHGHLHXHGH@HRH˜HAUSATPuILp@H%#HƿB@H0t L%#L%#HEHoGIŃt H#H#HXHDGH@HRH˜ATAUSPIL@H#Hƿ?H t L%#L%#HEHFIŃt Ha#H^#HXHFH@HRH˜ATAUSPIL@H#Hƿ?H t L%d$L%#HEH=FIŃt H<$H#HXHFH@HRH˜ATAUSPIL#@HZ#Hƿw>H t L%#L%#HEHEIŃt Ha#H\#HXHyEH@HRH˜ATAUSPIL@H#Hƿ=H t L%#L%#HEH EIŃt H#H#HXHDH@HRH˜ATAUSPIL#@H(#HƿE=H H`H7HhH7HDž`HDžhDžt&uDžHH#H8vtuH##H8QtuH[h#H8,t&uDžH,h#H8tuH"H8t&uDžH"H8tuH"H8t&uDžHS"H8UtuHE"H80t&uDžH"H8tuH"H8t&uDžH"H8tuH"H8t#uDžH"H8\tuH"H8:t#uDžHm"H8Ht"H8t HEHXHXH8HH@HH@H@HEH9HPHXHFAH0HPIL@H"Hƿ9HHUHXHH+HEH}udHXH@H0HPILXH-"HƿJ9HHUHEHHsHUHHHqHPH@hH9X:HXHB@HHPH@hH,@H0SPIL@ H"Hƿ8HHUHXHHHEH}udHXH?H0HPILAH"Hƿ38HHUHEHHrHUHHHpHEH}t{HPHPhHEHPHUHHHooPHPH@hH?H0HPIL@%HX"Hƿu7HHUHEHHq6He[A\A]]UHH`H}HuHUMdH%(HE1HEHnHUHEHHNHEH}u4L"[H"Hƿ6HEH@HEw.HEH}u4L _HW"Hƿt6HEHPhHEHPHUHEHHmHEHHEHUHEHH9tHEHEHEH@HUHEHHEHUHEH9uHUHEHH0HEH}t1HEILdlH"Hƿ5}t HEHHUHEHH:HEHHUHEHHnHEHEHEHHE+HEHmHEH/HEHEHEHHEHUHEH9uHUHEHHPHEH}u8HEILyH"Hƿ4HUdH+%(t3UHH H}HuHUHUHuHEH*UHH H}HuHUHUHuHEHUHH0H}HuHUHUHEHHaHEH}u1L"H"Hƿ3tHEH@HEPHEH@hHu1L~"Hn"Hƿ3!HEHHEHUHEHH9uUHATSHpH}dH%(HE1HEHEHEHH#HHI2HEHHzA#HH$2EH(HEHEHHE6HEH@HEHEHHEHEH@hHEHEHHHEHEHHHEHEH@`HEEEHEHuPHUHEHHu9HEHg9IL,"H"Hƿ1H}tHEHtHEH9EtEH}tRHEغH "HH)u3HEH@hH@(H%HHEHHH9tE}u }}tp}uj}tdHEH8HHEHuHş#HMHuHRPQIL H"Hƿ0H 4HEH.8HHEHuHa#HMHuHRPQIL׽Hl"Hƿ0H HuHEHH]HuH#HELHEH7HuSATILH"Hƿ0H HEЋ@P%HEЉPPHEHsHEHL@HEHHUHEHAHEHEHEHHEHUHEHH9HEHEHEHHEHUHM(H9HEdH+%(t.He[A\]UHH`H}dH%(HE1HEHfLL"@BH"Hƿ.H؍(HHٍ(HHEHyHuHEH述HEHguHEHHUHEHH膶Hf(HgHEHeHEHeL"@vH"Hƿ!.HUHMHEHHHEHEHEH@HF5IL@{H"Hƿ-HEH@HH:HEH}t HEHHEHHEHUHEH9pHEHE_HEH@H4IL"@H "Hƿ)-HEHPHEHHeHEHHEHUHEH9uHEHH(HvgHEHtL_"@H"Hƿ,HUdH+%(t+UHH0H}HuHU؉MH}HEH@ H HEH}u4LH"Hƿ#,HEH@HUHH/ HUHBHEH@HUHEHHcMH(HE$}uHEH@HHq HEH@ H@HEH}u4LOH<"HƿY+HEHPTHEH@HHa HUHBHEHPHHEH@HH> HUHBHEH@Ht HEH@Hu1LH"Hƿ*:HUHEHHWbHEHHEHUHu(H9UHH0H}HuHUHEH6HEH}t1HEH@XHtH}tHEH@XHPHEHHEH@hUHH H}H(HE9HEH@HHE HH)u HEHHEHUH(H9uUHHH}HEH@HHg#HEHHT#HEHHA#HEHH.#HEH"#UHHH}HuH}t HEHH}HEH@HH HEHHatnHEHPHH[,HHYH9EuHEHPHH[,HHZHEHPTH[,HHYHEH*aHEHUHHH}HEH@ht-H6[,Ht!HEH@hHH[,HHYHEHPPHEHHHEH@XH@HHH HEHPXHEH@XH@HHHEH@XH{HEH!UHH H}HEHHEHH HEH}t HEHUHATSH H}HuHUH}t'H}t HEHHTHEغ HH='u H}t&HE@TtHEHPTHY,HHQXH}uXH}tHEH@hH'.HEH@HILd"@H}"Hƿ&HEHT!HHEHHTHEغ HH=)HEHHTHFY,HUHH\WuH8IL۲AH"Hƿ5$ H8H"HH`HPHH`H@HHuMH`HH8ILFH"Hƿ#H`HH [H`H H [H`H0HZH`H HP@HbV,H`H8HHfTuVH`H@HHH`HL"QH"Hƿ"H0H`HƿbuVH`H@HHH`HLt"WHd"Hƿ"TH`HHI(H Z1H@HPPH@HHH0H蟾H`H`EH`H@HH8HHI! H`H@HHUP8ILcH"Hƿ!HH8HH`H`H`HHTH0 HHo!H@H@hH(H8HEPILDfH"Hƿ!HL"gH"Hƿ H`H8HHEPIL@qHf"Hƿ H^H`H`u>H8IL֮tH"Hƿ0 H8HHH`HPHH`H@HHuMH`HH8ILyH"HƿH`HHWH`H HWH`H0HVHoR,H8HHBPHhHhH8IL@H"HƿHhHHTH0 HHHhHPTHhH@HH8HRP0IL_Ht"HƿH H`H@HH]H`HN>H(HHHH$ XHhHHHHH \X\HhHHTHp@HHIu*L"H"HƿH`ƀHhƀP,H8HpPHEPILQH."HƿKHLSH"HƿXu%\uH`ƀHhƀ\XHO,H8HHNHO,H`H8HHMH8ILHC"Hƿ`3HRO,H`H8HHVMu`H8ILH"HƿH`H@HHH`HH`HHz(HSH`H HP@H@H`HPPH@H`HHH$SH@H@hH"08IL"@H"Hƿ,HHUdH+%(tRUHATSH0H}uHUHMLEH}t HEH@PHu HEH@P@P3EHtkEHt Hl#Hz"HEH@PL`HHEH@hH!SATIL4@H1"HƿNHHEH@PUPPH}HEH@PHHt&HEH@PHHEHHRHEH@PHHHEHXPHEHHHHu;HEILHk"HƿHEH@PHXHHEH@hH uSILg@H"Hƿ1HH}HEH@PHHt&HEH@PHHEHH=HEH@PHHHEHXPHEHzHHHu;HEIL٩HV"HƿsnHEH@PHXHHEH@hHuSIL@H"HƿHH}HEH@PHHt&HEH@PHHEHH(HEH@PHHHEHXPHEHeHHHu8HEILHA"Hƿ^\HEH@PHXHHEH@hHuSIL@H"Hƿ HHe[A\]UHH H}HuHUHuHMHUHEIL#H=UHH H}HuHEH0HNHEH@hHEHEHHE6HEHOHEHUH0HHMHEHEHEHHEHUHEHhH9uUHAWAVAUATSHHH}HuHUHEHHEHEHHEH}uOHEH@PHuBLɧ+H"HƿHEH@`HHHEHEHEHEHU tLHEH@PHt?HEHH t+HEH@PH@HH u豒 t \HEL@`HEHx@HMHUHuHEMIHu;HEIL"?H"HƿHEHHPHUHEHHHu;HEILȦHHe"HƿHE@Pu"HEH@XHuHE@Tu hHE@`uHEPPHEHE@`uHEPPHEHEuHEPPHErHEHE@P9u HEHURP9s HEƀ1HEHE@P9sHEƀHEPPHEHEH@PHEH}u |HEȋHEPPHEȉHEPTHEȉHEHPXHEHHELpXHEDhTHED`PHEX`HEH@hH?HAVAUATuSIL$@H"HƿH0BHEPPHEȋ9HEƀHELpXHEDhTHED`PHEX`HEH@hHHAVAUATuSILͤ@H"HƿH0&HE@PHUȋ9HEƀHEPPHEȉHEPTHEȉHEHPXHEHHELpXHEDhTHED`PHEX`HEH@hHHAVAUATuSIL<@H)"HƿFH0HEHHEH@XH9uHEȋHE@T9HELHEDHELhXHED`THEX`HEH@hH%HUAWAVAUATSPILʣHw"HƿH0HEƀHEPdPdHEHp@HEHHHHEHP8HEH@0HEIH#u1HEILAH"HƿHUHEHH7He[A\A]A^A_]UHAUATSH(HdH%(HE1HDž0HDž8HDž@HDžHƅPHDžHDžHDžHDžƅ H`HHHHH`HH@`HEHHHEHHHEHHHhH HHHH`HJ HH~HHHHHɪHHuEHHILH"Hƿ/HH@HHHHDžHHH=HH@HP@HH@hH9u Dž+HHHHHHH9uHDHLHHH@hHHAUATSILŠ H"Hƿ H @,P@,u*LԠ H"Hƿ HHHHqHHH HHH Hu IL@ H"HƿzϔH`H`u4L" H"Hƿ6H`H HPH`HHqc(H"<Ht HHHH@hHPHHH@hHHP HHt]HHH@hHHHH@hH- PSILi@ H"HƿHHHH@XH@H90H0H@L`8HHH@XH@H@HX8HHH@hH ATSIL H"HƿHHHH@XH@VH0HsVHHHBXHHH@XHu4L" H"Hƿ:HHH@XHHHP H{5,HPHH^3HhHhH;Hu1HHH@hHHP HHIHHH@ht$HHH@hHH4,HHV3HHH@hH!HHHH@hHHP HHH4,HHHPHH2uAHPILq" H3"HƿPEHEHHpHXt0HXt"HXHpHJ HHHpHHH8HHu]DtMH3,HPHH2HHH@hƀHHH@XHkHHH\HHHUdH+%(tHe[A\]UHHH}HEHHEH@hƀHEH@XHPSHEHUHH0H}؉uԉUL"@ H"HƿH2,HtH2,H-H2,H2,Ht3H~2,H6HH5He2,Hd-HR2,H[2,HtHO2,H>-H<2,H^(HEHEHHE+HEH7HEHeHEHEHEHHEHUH](H9uH](H7u*Lǔ5 H"HƿH](H6H](H芒H](HH](H9Hn](HbHO](HS}HEHFu*L"N H"HƿHEH@pHETHEHHHHUHEHHu*L"R H"HƿHEHHEHUHEHpH9uUHH H}HuHUMEHcHEHpHUHEH UHHH}HuHEH@hHHuHE HUHH H}HuHEH@HESHUHEHHu1L"o H"Hƿ!HEHHEHUHEHH9uUHSH8H}HuHUHEH@XHuCHEH\ IL{ H"Hƿ9HEH@XHPHEHHEHPhHEHP@HEHP`HEHP`HEH@pH HHEHHEH"HPpHEȺ HHEH@hHHEȺ HHyHEHHuGHEH@hHIL" H,"HƿIHEH H5tcHEH@hHpHHEH H[5HSALK H"HƿHHEH0H 5vcHEH@hHHHEH0H4HSAL  H@"Hƿ]HHEH@ HE%HEH@H HHEHHEHHEHUHEH H9uHEH@0HE?HEH@H HHEHHEH@H HHEHHEHHEHUHEH0H9uH]UHSHH}HuHEH@`H9EtYHEH@`HX8HEH@hHHSIL H"Hƿ1HH]UHHH}HEH@HtHEHH2HEHH`0HEH@@HtHEH@H2HEH@H30UHHH}HEH@ HtHEH H$/HEH H/UHHH}HEH@0HtHEH0H/HEH0H/UHH0H}HuHUHMDELMHEHpHEH@`LEH}HUuЋMQMIHHH//HUHH H}HuHUHEHp HUHEHH¿K-UHH H}HuHUHEHp0HUHEHH¿b.UHH}HuHUHEHH HHEHPpHEHUHP`]UHH H}HuHEH@ HtfHEHHuDHEH@ HE%HEH@H HHEHHEHHEHUHEH H9uHEH H5-HEH H.HEHH HHEH Hƿ,u1L" H "Hƿ&UHH H}HuHEH@0HHEHHunHEHHu^HEH@0HE?HEH@H HHEHHEH@H HHEHHEHHEHUHEH0H9uHEH0H,HEH0H,HEHH HHEHH HHEH0Hƿ&,u1L߳" HϷ"HƿUHH0H}HuHUHEH@HETHUHEHMHHхu1Li" HY"Hƿv!HEHHEHUHEHH9uUHH0H}HuHUHEH@HETHUHEHMHHхu1Lײ" HǶ"Hƿ!HEHHEHUHEHH9uUHHH}HEHH-UHH0H}HuHUHEH@ HEXHEHHHEHUHH҅u1L"* H"Hƿ,!HEHHEHUHEH H9uUHH0H}HuHUHEH@0HEXHEHHHEHUHH҅u1L"7 Hy"Hƿ!HEHHEHUHEH0H9uUHH H}HEHHאHEH}tHEH@hH9Eu HEH@XUHHH}HEHH聐HtUHH}HEH@X]UHH}HEH@p]UHH}HuHEHUHPp]UHH}HEH@h]UHH}uHEUPx]UHH}HE@x]UHH}uHEUP|]UHH}HE@|]UHHH}H}uHEHHa UHH}HEH@`]UHH H}HEH@XHu HO(HEHEPTHE9HEHPXHEHH9HEH@HH HEHPHHEHHEHHEHP8HE@PHEHP0HEHEPPHEH!H/HEHHTHEH HH$HEHHEHUHN(H9UHH H}HkN(HECHEHHt(HEHHgV#HHu HEHHEHUHN(H9uUHH@H}HuHUHEHEHM(HEHEH@HHEHEȋ;Es HEȋUHEH@HE:HEH@hHHEHEЋ;Es HEЋUHEHHEHUHEHH9uHEHHEHUH9M(H9aUHH0H}HuHUEHEH蕊HEH}t%HEHHEHH EEUHH0H}HuHUH}tH}u)HEH'HEH}t HEUHH}H ,Hu HEH ,H ,H;Es HEHo ,]UHH] ,]UHHPH}HudH%(HE1HEHEHEHEEHMHEк HHHEH@HE9HEH@hHHEк HHu!HEHHEHUHEHH9uHUdH+%(tUHH0H}HuHUHMH}tH}u HEH襈HEH}u}HEHH藊HEH}uOHEu:HEt$HEHU9sUHH@H}HuHUHMHUHEHH輇HEH}u3HEIL@? H"Hƿ2pHEH@ HENHEH@H%HEH}tAHEHPhHEHPHUHEHH"HEHHEHUHEH H9uUHH@H}HuHUHUHEHHHEH}u,LR HA"Hƿ^IHEH@ HEHEHHEHEHHEHEHEHHEHUHEH H9uUHH@H}HuHUHMLEHEHHUHEHH!HEH}u,Le H"HƿJHEH@ HE+HEH@hH9EuHEHPHEHHEHHEHUHEH H9uUHH0H}HuHUHMHUHEHHoHEH}u1Ljy Hϫ"HƿDHEH@ HE HEH@hH9Eu!HEHHEHUHEH H9uϸUHH}HE@T t HRHE@Tt H8HE@Tt H"HE@Tt H HE@Tt H"HE@T@t H"HE@T%t H~"HE@T%t H"HE@T%t HHE@T%t HfHE@T%t HH"MHE@T%t HM"4HE@T% t HR"HE@Tt HN"HX"]UHH H}HEH]HEH}t;HE@TtHEHH)HEHHt H"H"H"UHHH}HEHƿUHH}]UHSHhH}HuHUdH%(HE1HEHEHEHEH #HHיuXHEH@HXHHEHVHSILN~3Hh"HƿHZ HUHEH I #HHuXHEH@HXHHEHHSIL~6H"HƿrH HUHEH@H@PHHb HEH}uYHEH@HXHHEHbHUSPIL}9Hs"HƿHe HUHEAHu4L"<H"Hƿ HEHy#HHuXHEH@HXHHEH藘HSILg}?H"Hƿ)H HUHEH zy#HH^uXHEH@HXHHEH!HSIL1}BH3"HƿH% HUHEH@H@PHH!a HEH}uYHEH@HXHHEH裗HUSPIL|EH"Hƿ4HHEHpHEH "HHluXHEH@HXHHEH%HSIL|IH7"HƿH)HEHUHPXHEHUHhHEH@HPXHEH@H HPXHUHEHHPu4L "PH"Hƿ-HEHxPHJHEH"HH蒕HEHxHEH o"HH詓uXHEH@HXHHEHHSIL{VH"HƿzHHEHEH"HHHEHHEH ϧ"HHuXHEH@HXHHEH9HSIL){\HK"HƿH=HEHEHW"HH4HEHHEH ."HHKuXHEH@HXHHEH芔HSILzzbH"HƿHHEHEH"HH腓HEHHEH "HH蜑uXHEH@HXHHEHۓHSILyhH"HƿmHHEHEH"HH֒HEHHEH "HHuXHEH@HXHHEH,HSILynH>"HƿH0HEHEH#HH'HEHHEH #HHďuXHEH@HXHHEH}HSILmxtH"HƿHHE HEHl#HHxHEHHEH C#HHuXHEH@HXHHEHΑHSILwzH"Hƿ`HHE@HEHĹ#HHɐHEHHEH #HHfuXHEH@HXHHEHHSILwH1"HƿH#HEʀHEHn"HHHEHHEH E"HH跍uXHEH@HXHHEHpHSIL`vH"HƿHtHEHEHǢ"HHk=HUHEH "HHuXHEH@HXHHEHȏHSILuHڡ"HƿZHHUHEH F"HH菍uUHEH@HXHHEHRHSILBuHd"HƿHYHUHEH@H@PH@HHHUHHUHEH@H@PH@HH轺HUHHUdH+%(tH]UHH}HuHE]UHHH}HuHEHhHPHHEH 7"HHǸ)u4L̘"HY"HƿHEHH@HPHHEH +6#HHǸu4Lf"H"Hƿs:HEpHEH "HHǸfu4L "H"HƿHEt^HEHxHEH 1"HHǸu4L"H&"HƿmHEt^HEHHEH ן"HHǸu4L)"H"Hƿ6HEt^HEHHEH |"HHǸu4L"HF"HƿHEt^HEHHEH ""HHǸu4LI"H֝"HƿVHEt^HEHHEH ˞"HHǸ6u4Lٕ"Hf"HƿHE t]HEHEH u"HHǸu4Lj"H"Hƿw>HE@t]HEHEH "HHǸXu4L"H"HƿHEtkHEt]HEHEH "HHǸu4L~"H "HƿRHEt]HEHEH 0"HHǸlu4L"H"HƿHEHHHEHHHEHHEH "HHǸu1L"H"Hƿ`HEHHEH z"HHǸu1L."H"Hƿ;UHHH}HEHUHH@H}HuHUdH%(HE1u ,,HuHMHUHEIIHѺH5i#H,,uZEu1LmHǙ"HƿG"EvQ,K,M,HUdH+%(tMUHHH}HEH,UHH H}HuHUHMHEHh#HHFu1LKmH"HƿuUHHPH}HuHUHMLELMHEH@H@HH!Hu4L m+H{"HƿHEHhHu4Ll0H7"Hƿ,u{HEtiHEt[HEH@H@HILl5Hʗ"HƿJHEǀHEI,umHEt[HEH@H@HILl;HS"HƿHEǀHEHEHhHS E}y4L^"AH"Hƿk6HEHHHHEH,"HH- HEH}u4L"DH"HƿHEHhHEH}#HH;- HEH}u1L"GH'"HƿuHEHxHEDpDEHMHUHuHEHWH\Hu1L*"NH"Hƿ7UHH H}HuHQHEH}u4LkgHV"HƿHEH/d#HP(HEHHHHEH-(HP HUHEHHǔu1LN"pH۔"Hƿ[:HEH@(ILa"qH"HƿUHHH}HEHƿUHH}]UHSHhH}HuHUdH%(HE1HEHEHEHEHEHEHEH@HHEHHEHEH"HHuXHEH@HXHHEHrHSILje8HM"HƿH HUHEH e"HH9uXHEH@HXHHEHHSIL4e;Hה"HƿH$ HUHEH@H@PHHI HEH}uYHEH@HXHHEH~HUSPILh>HX"HƿH HUHEAHu4L"AH"HƿM HEHHEH "HHi}uXHEH@HXHHEHHSILhFH"Hƿ:H HUHEH "HHo}uXHEH@HXHHEH2HSILgKH "HƿHZ HEHHvXHEH@HXHHEH~HSILgNH"HƿZHHMHEHHHEHPHEH {"HH}{uXHEH@HXHHEH6~HSIL^gUH"HƿH^HEHP HEH 8"HH{uXHEH@HXHHEH}HSIL,gZH"HƿNHHUHEH "HH{uXHEH@HXHHEHF}HSILf_H!"HƿHnHUHEH@H@PH@HHبHUHBHEH@HuXHEH@HXHHEH|HSILfbH"HƿLHHEH"HH{HUHEH "HHczuXHEH@HXHHEH&|HSILvfhH"HƿHNHUHEH@H@PHH&E HEH}uYHEH@HXHHEH{HUSPIL7fkH"Hƿ9HHEH֣#HHzt}HEHHEH #HHWxuXHEH@HXHHEH{HSILepH"HƿH8HEH"HHzHEHPHEH ݎ"HHwuXHEH@HXHHEHxzHSILewHS"Hƿ HHEP8P8HEHm"HHyyHEHPHEH G"HHwuXHEH@HXHHEHyHSILd}H"HƿdHHEP8P8HEHڍ"HHxHEHP HEH "HHsvuXHEH@HXHHEH,yHSILTdH"HƿHTHEP8P8HEHC"HH-xHEHP$HEH "HHuuXHEH@HXHHEHxHSILcHa"HƿHHEP8P8HEHϊ"HHwHEHP(HEH "HH'uuXHEH@HXHHEHwHSILcH"HƿrHHEP8P8HEH "HHvHEHP,HEH "HHtuXHEH@HXHHEH:wHSILbbH"HƿHbHEP8 P8HEHy"HH;vHEHP0HEH S"HHUtuXHEH@HXHHEHvHSILaHo"Hƿ&HHEP8@P8HEHUHPXHEHUHHEH@HPXHEH@HHPXH}tHEH@XH HHEHPXH}tHHUHEHHu1L["H"HƿhHUdH+%(tH]UHH}HuHE]UHH H}HuHEHHEHEHH@HPHHEH [#HHǸu4L"H"HƿzHEHHEH g"HHǸu4L8"H"HƿEHUHEH "HHǸ>u4L~"H7"HƿHEPHEH ʈ"HHǸu4L~"H݇"Hƿ蔿kHEP HEH "HHǸu4L-~"H"Hƿ:HEHPHEH #"HHǸ/u4L}"H("Hƿ߾HEHHtbHEHHPHHEH Ƈ"HHǸu4L`}"H"HƿmDHE苀t]HE苐HEH k"HHǸRu4L|"HK"HƿHE@8tZHEPHEH "HHǸu4L|"H"Hƿ虽pHE@8tZHEPHEH "HHǸu4L#|"Hy"Hƿ0HE@8tZHEP HEH n"HHǸu4L{"H"HƿǼHE@8tZHEP$HEH "HHǸu4LQ{"H"Hƿ^5HE@8tZHEP(HEH Dž"HHǸEu4Lz"H>"HƿHE@,tWHEP,HEH s"HHǸu1Lz"Hك"Hƿ萻jHEH@0HtXHEHP0HEH )"HHǸ{u1Lz"Ht"Hƿ+UHHH}HEHUHH@H}HuHUdH%(HE1u ++HuHMHUHEIIHѺH5"H++uFEtEw1LZHx"Hƿ/Y+HUdH+%(tQUHH H}HuHUHMHEH"HH-u1LYH"Hƿ謹UHH@H}HuHUHMLELMHEHEH@H@H H!Hu4LpYHs"Hƿ*HEHHHHEHH\ HEH}u4Lw" H"Hƿȸ&HEHHt^HEHHEHH HEH}u4LMw"$H"HƿZHEHHu1LX(H_"HƿwHEȋAHEHHEHHMHUHEEIHGu1Lv"0H"Hƿ褷UHH H}HuH`HEH}u4LWIH"HƿCHEHA"HP(HEH HHHEH(HP HUHEHH4}u1Lu"RH"Hƿȶ:HEH@(IL~"SH~"Hƿ茶UHHH}HEHƿ苶UHHH}HuHEIL"*H"Hƿ!UHH H}HEHEH@H@H t$HEHH@XH4t HEHESHEH@H@Ht HEHE2HEH@H@H HEHH5 HEHE@THEH@H@PHHHILD"?H"Hƿ$HEHt7HEHAL"CH~"HƿߴHELt9HEH¹IL~"FH~"Hƿ蘴HEHPHt8HEHPIL~"IHI~"HƿPHEHXHt5HEHXH@HEH}tHEH HHUBL[#OH}"HƿUHSHH}HEHPHucHEHF"HPHEHPHEH@HHSIL2T]HU}"Hƿ\HHE苀Hu^HEǀHHE苘HHEH@HHSILSdH|"HƿHHE苀LucHEǀLHEHHHEH@H'HSILSjHx|"HƿHH]UHSH(H}HuHEHEH@H@PH@HEHEH+"HHetzHEHPTHEH "HHrcuXHEH@HXHHEH+fHSIL+SxH{"Hƿ轱HHEH{"HH:eHEкH {"HH\HEH}uXHEH@HXHHEHeHSILRH{"Hƿ!HHEHLHEHHCuXHEH@HXHHEHeHSILRHz"Hƿ諰HzHEH@"HH(dHEкH "HHZHEH}uXHEH@HXHHEH}dHSIL=RHz"HƿHHUHEHHHUHPHEHPHuXHEH@HXHHEHcHSILQHy"Hƿ良HXHEHy"HH]HEH}.HEHPHuXHEH@HXHHEHjcHSILQHx"HƿHHEH@ HtUHEH@HXHHEHcHSILQHx"Hƿ藮HiHMHEHHdHUHXHEHXHu1L"m"H(x"Hƿ/H]UHH H}HuHE@TtZHEPTHEH Bx"HHǸu4Ll"Hw"Hƿ训HE苀LHE苀L7HEH}u4L?l"HEw"HƿLvHUHEH w"HHǸEu4Lk"Hv"HƿHEHPHHEHPHEH "HHǸu4Lvk"H|v"Hƿ胬HEHXHHEHXHHv"HH蘫tBHEHXHILLOHu"Hƿ3HEHXH@HtHEHXHEHH%UHSHHH}HuHUHEHEH8P#HH4_uXHEH@HXHHEH_HSILNH>u"HƿEHfHEH O#HHUHEH}uXHEH@HXHHEH5_HSILNHt"HƿǪHHEH@H@PHUHH5( HEH}uYHEH@HXHHEH^HUSPILFNHAt"HƿHHiHEH(#HH]uXHEH@HXHHEHD^HSIL,NHs"Hƿ֩HHEH #HH:THEH}uXHEH@HXHHEH]HSILMHQs"HƿXHyHEH@H@PHUHH& HEH}uYHEH@HXHHEHH]HUSPILMHr"Hƿ٨HHEHJ{"HHV\HEHHHEH !{"HHYtHEȋHtnHEȋHt_HEH@HXHHEH\HUȋHSPAL_MHr"HƿH:HEȋHu%HEH@HPXHEH@HH HPXHUHEHHPu4Lf"Hq"Hƿ薧HUHEHHe1 u1L>f"HDq"HƿKsHUHEHHZ/ u1Le"Hp"Hƿ+HEH@HHu HEHH]UHH}HuHE]UHSHH}HuHEHH@HPHHEH p"HHǸu4L,e"H2p"Hƿ9HEHHPHHEH p"HHǸ'u4Ld"Ho"Hƿץ#HE苀HwaHE苐HHEH &p"HHǸLOd"HUo"Hƿ\HE苘HHEH@HHSILJHn"HƿHQHUHEHHu1Lc"$Hn"Hƿ趤H]UHHH}HEHkUHH@H}dH%(HE1EHEH"HH!#HHEH}͢ğPHp"PL #Ln">Hm"HƿHHEHUHH莟Ht:EHEIL`n"CHm"Hƿ莣HUHMHEHHHuHEHFHEH躣tLPHn"PL #Lm"IHm"Hƿ HEHUdH+%(t3UHHPH}HuHUdH%(HE1ӯu ++HuHMHUHEIIHѺH5"Hp++u4L(a"xH.l"Hƿ5iE؅tE؃uXEԃwPM+UЋEԋMRPALG}Hk"HƿҡHEEHHH>'+!ЅEHHH>'EHHHI>'E9r>EHHH.>'E9|EHHH>'U9]EHHPH='HILk"Hj"HƿܠEHHH=' + Љ+EHHH='E9r>EHHHl='E9NEHHHQ='U9/EHHHV='t%EHHP H='HHHu0EHHPH<'HHP HEHH跱EHHH<'HHtEHHH<'HHG#UHHJH<'HH HPILEHdi"HƿkHEHHHA<'EHHH1<' ‹~+ Љv+mEHHH <'uUEHHPH;'HHPL Lj#L EHh"HƿʞHE}H}+HEȺH\HEH}HEH@ HEHEt3L D#LH h"Hƿ'wHEH@HEHEt_ENEHHPH:'HHEHHtu"EHHH:'+ Љ+E}vHEH@HEH}4+Љ+EEHHHW:'+!ЅtsEHHH7:'~+!ЅuSEHHPH:'HH#RPL #LdCHf"HƿHE}_+ +!HE+HUdH+%(tUHH H}HuHUHMHEH"HHu1LBHEf"HƿLUHSHXH}HuHUdH%(HE1HEHf"HHOuXHEH@HXHHEH PHSILBHe"Hƿ貛H HEH tf"HHFHEH}uXHEH@HXHHEHOHSILBBH-e"Hƿ4Hw HEH@H@PHUHH HEH}uYHEH@HXHHEH$OHUSPILBHd"Hƿ赚H HEH"HH2NuXHEH@HXHHEHNHSILAH H_"Hƿ莕HHEH(HEH ``"HH@GuXHEH@HXHHEHIHSIL> H _"HƿHTHEH0HEH _"HHFuXHEH@HXHHEHIHSILz>H^"Hƿ蔔HHEH_"HHH|HEH@H@PH@ HlHUH8HEH8HuXHEH@HXHHEHTHHSIL >H]"HƿH)HUHEH ^"HHFuXHEH@HXHHEHGHSIL=Hi]"HƿpHHUHEH8HHwuXHEH@HXHHEHhGHSIL=H\"HƿH=HEH]"HHwF|HEH@H@PH@ HckHUH@HEH@HuXHEH@HXHHEHFHSIL:=HE\"HƿLHHUHEH A]"HHDuXHEH@HXHHEHDFHSIL=H["Hƿ֑HHUHEH@HHHvuXHEH@HXHHEHEHSIL<!HY["Hƿ`HHEH@XHH HEHPX*HEHH7uHEH( H-HuHEAH u1LO",HZ"Hƿ軐HUdH+%(tޏH]UHH}HuHE]UHH@H}HudH%(HE1HEHH@Hu4LO">H Z"HƿHEHHPHHEH ["HHǸu4LN"@HY"Hƿ豏HEHH@HPHHEH "HHǸ蛪u4L>N"AHDY"HƿK"HEȋ`tSHEHTZ"HHǸ:u4LM"DHX"HƿHEHH@XH4HEȋHHEH 5Y"HHǸ迩u4LbM"GHhX"HƿoFHUHEHH5u4LM"JHX"Hƿ$HEHHEH HEG"Hƿ{H## HEHtHPHEHHH[HEH}u4L)CHF"HƿzHUHEHH HEu8HEIL(JHF"HƿTzTHE H wF"HHeru1L(OH9F"HƿzHEUHHPH}HudH%(HE1HEHEH}tHEt HEu4Lp8"_HE"Hƿ}yHEH"HH{HEH}?wtHUHPILqE"bH?E"Hƿ yHWHEHEHEHEt(0sHHEHHH% uHEHE<#H}t>HEt3HEILO'rHD"HƿYxhHEHEHE<#u HEHEHEuHUHEHHHEHUHMHEHHwHHEHqHEH:xt*L6"HC"HƿwHEHUdH+%(tvUHAWAVAUATSHH $HhHHdH%(HE1HDžHHC"HHnuCHHHHHHHHHHH@C"HH`nuSHH@HHuHHHH"HPHHB"HHmHDžHDžHH T`#HU`#HHRutKttqHSIL%H B"HƿuH|DDDDDDDDxtHHRQ|QAWAVAUATSASARAQAPVDxDtH$$H¾Hpy*L3"H@"HƿtHHHHHNHH@"HHktHH@"HHkuxHH譜HHHHH|@"HǸHHHHHHHG"HH8kuBHHHHHHHqH=HIL"H`?"Hƿ+sHHUdH+%(tJrHe[A\A]A^A_]UHH H}Hm?"H"HƿurBH?"HpHuHNp"H"HHqu HEH@UHH0H}HuHUHEHEHEH"u/L!H="Hƿq:HEHH"HH`>"H¾H+HǸ}y/L!H="HƿgqH"HH+HrHEH}olH+t H;Z#H #HRH="RPL \+L="H="HƿpH ;HB+HH+H u*H*+Hp="HHou H+HE HEH¾Hij+HiHuHEHptonkH+t HEY#H#HRH:"RPL f+L<"H<"HƿoH H}u,L: H;"HƿoHUHMHEHHUHH@H}؉uHUEMHEغH.HEH}u;HEIL HN;"HƿolHEH@ HEMHEt6HEILH:"HƿnHEH@HB"HH6fu HEH@Hy"HHfu MHEH@H#HHeu MHEH@H;"HHeuMfHEH@H;"HHeuMBHEH@HUHPIL#H9"HƿmHHEH@HEH}EUHH0H}EHEغqHMHEH}u4L0Ht9"Hƿ?mNHEH@ HE/HEt/L6H$9"HƿlHEH@Ho"HHcdu HEH@H܋"HH;du MHEH@H0"HHdu MsHEH@H"HHcu MLHEH@HT"HHcu M%HEH@HF#HHcu M HEH@H]"HHxcu M@HEH@HH6#HHQcu MHEH@HF"HH'cu MHEH@HF"HHbu M\HEH@HO"HHbu M5HEH@ILSH67"HƿkHEH@HEH}EUHH@H}؉uHUEMHEغH芦HEH}u;HEILCaH6"HƿujHEH@ HEHEt3HEILgHS6"HƿjcHEH@HnE}tE EBHEH@HUHPILnH5"HƿiHHEH@HEH}HEUHH`H}dH%(HE1EHEgH葟HULHELtVWHEkH舖HU0HE0W ˴ uHEfHHU<HE<I HEeHHU8HE8 HElH讞WHEH葞WHEnHHUHxHEHxHWZ HE|H1HUDHED~ HEjHtEHEhH?HEH}tUUHEȉHOHEoH訝THEHHU4HE4ALJHY3"Hƿ$gHE4 HEH3"rHrWHEH3"sHSWHEH>"iHHUtHEtW+jHEHUHEHHiEHEIL3"H2"HƿLf&\uH#gHO\*VbUHEdH+%(tSeUHHH}H.3"HRdHLH1"HƿeLH1"HƿeHEIL2"H1"HƿaeUHH H}uUHEHx]HEH}tHUHEHH|^HEH}u HEHUHH H}HEHu HEHךEHEH@t*HEH+tHEHu7}t1L1"Hj0"Hƿ5dUHH0H}HEغH葌HEHEu/LH/"HƿcoHEHEH}%HEHEE}EuHEHEEH 'H+3}OuHEHEEH'H+H'H+HEH׶+HEH8EtHEH+HEHuH+HEHL!"H."Hƿbo]HHUHH%@tHE,LfH."HƿpbHEE}HE6HEILY#HX."Hƿ#bUHSH(H}HEHHEغ}HzHEHEHH HUHHEHHu;HEIL.H-"HƿaHEغ~H著HU؃  ȈHEغH\HU؃  ȈHEغH#HU؃  ȈHEغHHU؉THEغH*HUHGHEH\HUHGHEHGHuH]UHH0H}EHEHǀHE⿈HEغHߊHEH}tHEtEHEغHcHEH}u H]"HE}tKHEH,"HH^t1HEILOH+"Hƿl_HEH"HH^u HUHEHHHEH}t!HEtHEHUHJHEIL]H +"Hƿ^HE@UHHH $HH(dH%(HE1HDž8Dž0H(Hwu4L-"pHo*"Hƿ:^Q H({H肋H(H(`4H(94tIH(4HPAL'+"wH)"Hƿ]HH(HHH(HHHH*"HǸ3y4LK}HR)"Hƿ]4 H(HHHݚHj("Hvu4L"H("Hƿ\ H(H.H8H8toH8H"HH[tRH8H=,"HH[t5LH^("Hƿ)\HDž8H8tgH8H+"HHN[uJL t [ 5LVH'"Hƿ[HDž8H8tH8H1"HHZu H(HHH(HH"HHt%"HǸy4L7H>'"Hƿ [ H(H"taH(HH"H蠉 uHH(HH"ILH&"HƿZH(ƀH"HH(HHDHH胘H(HvH(PH(PpfH(H7H( ȈH(H]HPHPHW"HH@QuH(ǀ`dHPH$"HHQuH(ǀ`4LbHq%"HƿH(H H`HHQtH(H"H H(H Hd"HHVH(H HI#HHnVnH(H H`HHQH(H IL. H""HƿVNUERIL5$"H""HƿuVL H""HƿKVH(HS"H x%=`tzH(H IL H""HƿULx H!"HƿUH(H•"H H(HeHXHXtzHXH@ H@\H@uH@H@u*LS HR!"HƿUH@H@H@H@uH(HH( ȈH(2HWHHHHLHHHhIL H "HƿZTHHDžHHHHHޝ H(HPH(  ȈH(HH(  ȈH(Hu4Lq"H"Hƿ~SH(H苉tH!"H詟 H(Hu1L" H@"Hƿ S%H(HVo HUdH+%(tRUHHH}HuHEHHUHH2ILZ "H"HƿrRHEH(HEHHUHH`u8HEILHQ"HƿRUHH0H}HuHUHEHEHETHEH@ H3HEHH"HHQHEHEH@ HEH@ HEHEt>HEHIL/Hu"Hƿ@QHEHHEH@HHkPuHEHEH@HEH}jHEHH"HH#Pu5L":H"HƿP HEH@HEH}UHH@H}HudH%(HE1HMHEȺ HHvHEH}t HEH@Hu HEȋ8u|HMHEȺHHFt`HEHHEHHu4L"PH"HƿOlHEǀ8HEH@HE=HEH@ HHEHHEHE<@uHEHEH誨 u>HEHIL[HF"HƿOHEH@Ht^EHEHHHUHEHHu1L "aH"HƿNoE܅tKHUHEHHu5LN "fH"Hƿ[N HEH@HEH}HUdH+%(tcMUHH0H}HuUH"HEHEt H^"HE}tH"HEHG"HEHEHHHMHUIIHH"H¾HZ+HǸry4L{H"Hƿ\M@HEHH%HEH}u4LWH>"Hƿ MHEH¾H+H%CHUHBHEH@Hu4L "H"HƿLHEHUHHH-HEtLHEHPHEHHuDL$ "Hf"Hƿ1LHEHPHEH UHHH}HEHug:HUH HEH Hu1L"H"HƿK\UHEH u"HHQu1L4 "Hv"HƿAKUHH H}HEH(HE\HEHHHEHHu1L "H"HƿJ#HEHHEHUHEH(H9uUHH H}HEHsHEH}u4L4 "Hv"HƿAJHEHHHEH8H'+HUHHEHHu4L("H"HƿIHEHHH)HEHH HHEHHHEHHu1LHs"Hƿ>IUHH H}HuHEHHtS#7HEH}u4L"H"HƿHHEHHE]HEHPHuHEH?u1LT"H"HƿaH"HEHHEHUHEHH9uHEUHH H}HEH(HEHEHHEHEH誀HEHEHEHHEHEH(H9EuѐUHH H}HEHHE&HEH@H:t#HEHHEHUHEHH9uǸUHH0H}HEؾH@HEH}tHEH<qHEؾH?HEH}tUHEHHE%HEH@H9Eu HEHHEHHEHUHEHH9uHEHa<HEHHEHEH@H@<HEHHEHUHEHH9uHEHH}HEHHHEؾH?HEؾH>HEHH HEHEHHE}HEtHEHH0H9Et?HEH@ H};HEH@ HEHUHHHH~HEHEHEHHEHUHEHH H9eHEؾH$>HEH}t HEH:HEH Ht*L*HY"Hƿ$EUHH@H}HEHEH8u4L"7H"HƿDHEȺHzE؃}t uEE؉ HEȺHOHEH}u4L'AHv"HƿADHEH@ HEmHEt4LGH&"HƿC>}HEH@H=HEH}t.HEH@HUHHEHx&HttH袄 HxHHxHHEUHcHDՠEHHDŠHtEHx(Hwtt>k HxHHUHcHDՠEHHDŠHtEHUEH։HEH}u,L!H "Hƿ=HE.EHHDŠHPEHHDŠH҃m}yٸHUdH+%(t<UHH@H}ȉudH%(HE1HEHEHEHEu4LH2 "Hƿ<bHEH@HEH}u/L!H"Hƿ<HEȺ.Hr蛃 HEȺ/Hr蟃 HEHHUHHHEH}u,LjHY"Hƿ$<*HEHUHHEgH}u6HEHtHEHPHEHHEHt$HEHPHEHHEHPHEHHEHUdH+%(t:UHH H}HuHEH@pHEsHEH@8HUHH2tGHEH@8HPHEHH2t(HEH@@Ht!HEH@@HUHH2uHE%HEHHEHUHEHpH9xUHH H}HEHwHEH}uGHEHUHpHH1rHEHUHPhHEHP8HEHHEHUHP`UHH H}HEH@pHE[HEHHHHUHEHH(#u1L!?H!"Hƿ9!HEHHEHUHEHpH9uUHH H}HuHEHPHEHP8HEHHHEHEHP(HEH@(HH8ubHEH@HUHR(HPILTH["Hƿ&9HHEH@ HPhHEHҸCHEHHEHUHEHHH9[HEHUHHHHtpUHHĀH}dH%(HE1f)EfEHEHEH^ HEH! HEHHEHHEHN HEHlO HEHEEOEHHTHEHHEH}u "HEH@8HEHUHHHoEEHHDHuHUHEHH u HUHEHHu HUHEHHu HUHEHHu1L+!Hm"Hƿ87AHUHEHHgu#HUHEHHjuHUdH+%(t6UHHHhdH%(HE1HpH-tw@572H¸_t H#Hs"HRH"RPL "L"Hn"Hƿ96H HhHHpHAHH8HhHHhHHu1LnH"Hƿ5zHhHHpH‚HHHhHHhHHu1L!H"HƿK5HUdH+%(tn4UHH H}HEHurLH"Hƿ4HEH "HHZ,HEAH5"H%HEvHjHU艂XHEyHaEHExHaEHEwH\HEH}u4L!H0"Hƿ3$HE苸XMUHuHEAH$u4L/"H!Hƿ3HEtHiHU艂\HEuH[HEH}u1L!H`!Hƿ+3WHE苐\HMHEHH*u1L}"H!Hƿ2UHSHH}HEHGHܕ t !(6+HE艐G!H]UHHH}x UHH H}>.H"H0HEH}u H"HEHEH,HEHha,UHHH}HEHzuFLH!Hƿ1HEHEUHHH}w Dx  x HEUHHH}HEHHEH@HtHEH@HHEHHtHEHHHEHGHtHEHGHHEHt*UHHGHEH}u/L6!-Hx!HƿC01HEHH H !HH3HEHu/L!2H!Hƿ/H"HHUHHEHHu/L!5H!Hƿ/{H"HHUHBHEH@HMH"H}HUHGHEHGHu/L!;H7!Hƿ/HEHHmfHEH(H[fHEHu/L!AH!Hƿ.HEHu/LS!DH!Hƿ`.NHEH HEHHu/L!GHH!Hƿ.HEHtNHEH "HHu/L!KH!Hƿ-HEHru,Lj!NH!Hƿw-hHEH HEHH+HUH HEH Hu,L !QHK!Hƿ-HEH}t HEHUHSH8}HuЉU؉MDEDMľe"H"Hƿ.Hu*Lm!jH!Hƿ,GHEH}u4LqHu!Hƿ@, E܃HU ȈE܃HU  Ȉ}HE ʈHEHEHEǀ8HE@HEH@HbHEHpHbHEHHbHEH(HbHEHHbuZ}%H?$HH9HH$#HHEHGHEHGHu/L/H!Hƿ* 'u) z'E}EH{"HH`'Hu/L!H)!Hƿ)+ HEHGHS`'HHѺHh!tr_(V%H¸t H#H"HRHg!RPL }"L4!H!HƿX)H ^&u' :5&E}E H*"HH_'HM u/L!H!Hƿ(HEHGH4H._'HHѺH '$H¸t Hs#HA"HRH!RPL ,"L!HHEHtNHEH "HHu/L!H!Hƿ$HEHfu/L^!H!Hƿk$HEH HEHHHUH HEH Hu/L!HHEH9u/L!H!Hƿ#HEHu/L|!H!Hƿ#HE!HG_HHEHH"HHHUHHEHHu/L!HF!Hƿ#HHEH&Yh HEHu/L!H!Hƿ"HEHHEH] HEHu/LQ!H!Hƿ^"HEHUu/L!HT!Hƿ"VHEHu/L!H!Hƿ!HEHu/L!H!Hƿ!HEHgu/LU!H!Hƿb!HEHHEH}t?HEHUu/L!H:!Hƿ!<}tDHEHvu/L!H!Hƿ HEHUH0H8HHH@HHHHHPHXHHH`HhHHHpHxHHHHHHHHHHHEHEHGHFWHEuHEH HEHEH]UHH0H}HuHEHHEHEHHEHHH@IL{H]!Hƿ HUdH+%(t UHH H}H}HEH-HEHE&t^HEH@HEH}tKHEH@Ht>HEH@H蕿u*L!H!Hƿ HEHĂUHHHHDH8dH%(HE1HHDHΉHXHXu4Lr!H!Hƿ6 _H`HHHH&uDu HXvHHHt H"H"HHHRH!RPILL!HH!HƿpH HHIL!H !Hƿ3HXHE u6HHIL^!H!Hƿ HXHXHhHUdH+%(tUHH H}uHEH HE4HEHqHEH}tHE9EuHEHEH@HEH}uŸUHH0H}؉uHEHEH HEHEHHEH}tTHE9EuIH}t!HEHPHEHPHEHUH HEHPHEH HEH@HEHEHEH@HEH}vHEUHH H}HuHEH_HEH}u HEH@ HHEtHEH@8HGHUHB HEH@ Hu1LeH!Hƿ-HEH@ HUHPHEH@ HUHHEH@ UHH H}HuHEH H}~HEHEu4L|H2!HƿZZHEHHEH}u4LH!HƿHEtYHUHEH?du@LH!HƿHEH}HEH@(HHEH}u=LH(!HƿPHEHD}GHEHUHEHH|HEH HEHHa}HUH UHH0H}HuHEH HEHEHEH|HEHEu$HEHEHEH@HEHEHx|HEHEu1LcH-!HƿUOH}tHEHP HEHH|HEHP HEH HEH@ HUHH_|UHH0H}HuHEH HEHEHEH{HEHEuHEHEHEH@HEHEuHEHEHEH@HEHEHb{HEHEu1LH!Hƿ?OH}tHEHP HEHHu{HEHP HEH HEH@ HUHHI{UHHH}HuHEH@ HuHHUHEHHfu1Lx!H]!HƿqHE@uHUHEHHkPHE@uHUHEHHA/LH!HƿUHATSHHH HLLHEHdH%(HE1Dž$Dž(Dž,Dž0HDž@HH^yHHHHQuUHHHHa'HILdH!HƿH@PtH}t Dž0HHEHHHFH@H@u4L[He!Hƿ03HDž8 HH+8HH@H8L$HHuHL:44yt t4IHH)t H"H"HHHATH !RSILM!HI!HƿqH W4HH8H8H;mHH@HHHtH}t7H@HH HHUHH6H@HPH@PH@H`HHx$$H`tNH$H`HHH% u$H`<{t $~~$HƄ`H`HlV uVHHHGHSIL7H!HƿHDž(HHEAHPHHHHPHHƿϦщHDHމ9E tQHHHHSILOFH!Hƿ H(}(HHEHHPHHX}0tPHXHPHHHwu|Li!QHN!HƿvcHXHPHHHvu,L!TH!Hƿ&Dž,H@H,HUdH+%(t+He[A\]UHHH8dH%(HE1HDžHH8HsHPH`HHH8HH*u4L>!iH#!HƿKHHHu HPH@HXHXH@HHHHƱHXHBHXH@Hu4L!sHz!HƿHXH@HuVHXH@HHXH@L(!xH !Hƿ5HEHHXHpH8HjjjjjAIйHH0DHX@uPHXH@HUu*L!Hh!HƿHXH@DHUdH+%(tUHH H}HEH3qHEHEHPH@UHH0H}HuUHMDEHE@ EHEЋ@EE;EuHEkEHcHHHHHY'H }؋UHuHEAHuE}t}t H"H"}u}u HEHHH !}t}t H5!H5O"}t H9"H9"}HcLEMI)}LcH}LHRIIHHZ"HLָHE}ynHEHHEHcHHHHHHX'HHQIL Hk!HƿHHEUEUHH H}HuUEHcHHHHH(X'H UHuHEAHUHH H}HuUE t H5t!H5"Et H b!H ֝"Et HO!H"Et L>!L"Et H=-!H="EtEt H!H!H["L]LUHVQRMIHH="HLL׸H UHH H}uUME¾HX+HE¾H'Y+H}tHUHY+PHzX+PILGHa!HƸHUHHpH}HuHUMdH%(HE1HEHEHEHE@ @u6HE@ %tHEHPHEHHEH@HEH}uzHEHJHEH}u?HEH@ILHy!HƿHEUHEЉHHEHEH*HEHEHEH}u4LhH!Hƿ*AHE<#HEHEHEHHE+HEHHHEHHHEHHgHEHEȾ#HaHEH}tHEH<#tH}tHEHEHHEH}uKHEH@ILH!Hƿ:HEHEUHEH螫H}t HEHUHPH}uHEHEHE#SSItIBt FtauOHEHHHE HHHUHB :HE+HEHEHPHEHHfZHE@HEHEHEHPHEH@HH HEHEHuKHEHHEH@IL.Hh!HƿHUHEHPHEHEHEHEHEH}HHEH+HEc HEH@HUHRuPIL,H!HƿHHEHHUdH+%(tUHH H}HuHUHMHEHE@u9HE@HE@HEщH:~HE@ uQHE@tHEIL/>H!HƸHEt tbHE@HE@HE@HE@HEщHJHE@sHE@HE@HEщHCHE@tvHEH蓝HEH@HURtHUHPILUHy!HƸHHE@ u6HE@HE@HEщ H4{HE@ ucHEH@uTHE@tHEILaH!HƸ UHHPH}HuHUHMEHE@ tHE@ u!HE@tHE@ t EHE@ @t EbH}HE@HEHpHEHHUHHEHEHEH}u4L!H!HƿTHEHE9uBHMHUHuHEHu&HEH@HEHEH@HEH}tH}uH}uH}tEHEH@H@HUHHOHEtH}t HEH@HE@tUHE@ @uHE@ fEHE@E0tuHEH@ Ht H!H!HURtHuILH!HƸ HHE@HEH@ Ht}E0urHEH@ Ht H|!HO!HURtHuILH@!HƸmHUHH H}HuHUHMHEPHE@ !ftrHEH@ Ht H!H!HURtHuIL:H!HƸHUHH@H}HuHUHMLELMHEH;EEHEH}t H%"HX"HuH}IHH:!H¸#xCHEH}t H%"H"HuH}IHH!H¸y>HEHILn!H!HƿpHEHH(HUHHHEH}HEH@ Ht\HE@tHEIL)H !HƸ6HE@(EHcHEH#EHHPHEHHEHH(HUHHHEH}u\HE@tHEIL4Hb!HƸHE@(4HEHUHTHEуHUHLHEHEP(HEHP HMHuHEHu HE@tMHMHUHuHEHu1L!HH!HƿxHMHUHuHEHKu1Lk!KHP!Hƿx+HEHUHTHEуHUHLUHATSHPH}HuHUHMLELMEHE@(HcHHHHHA'HHEHE@ %t HEH@HELEH}HMHUHuHEHuMIHHEЃ}tvHEH@ HuiHEHaHEHEH+EHHUHEL$HEH:HUH<HUHuHEHuIMHHHHEЃ}uEHEH@HEH},EHe[A\]UHATSH@HdH%(HE1DžH@t+H@tH@$H@u*HHHtu Dž3HHDHHL~ƅ`ƅHHH(HHH4 H(H(Hu9LHJ!HƿrDžDžHcHHHHH?'HHHHH`AHu=HHH(H HHHǀ(Dž.HHH(HH`HH u9LHA!HƿiDžH@HPHH@HHmHH@ HHHH`H`HHAIHHuDžHHHH+HHHL$H`HSH`H<HH`HHIMHHHHufDžZHHH@tILGH!HƸDžHH@HHtH@HPH@HPHUdH+%(t}He[A\]UHHH}HuH}u=HE@uHEHHHtHUHEHHUHH H}HuHUHE@ %tWHEH HUHHxHt8HEIL*H,!HƿTUHHHXHPLdH%(HE1LHcHHHHH:'HH`H`H`HpAHHpHPHH藈HhHhHUdH+%(tUHHHHDH8dH%(HE1DHcHHHHH:'HH`H8HHHH\H`H`HpAHHHH HpHH谇Hh\t%H8tH8PHHHHEH@ HEH@ HE@ %tHEHPHEHHH HE@HHUHR HBrHEH@ HE@ %tHEHPHEHHH HE@HHUHR HBHE@ %MHEH@ HE@ %tHEHPHEHHf~HE@HUHR BHEH@ HE@ %tHEHPHEHHHEH@HEH}u HP"HEHEH@ HUHP5LԟH.!HƿVHEH@ UHa9HE@tMMHEHMHUHuH|HUHB HEH@H}t'HEHUHPHEH@HuHEHUHP HEHUHPH}t HEHUHPHEUHHH}HuHE@tHUHEHHtUHH H}uUEHcHHHHH 'HHEHE@9EuBHE@tHE@ u!HE@tHE@ t WHE@f#w uHEH@Hu4LH!HƿFHEHPEHHuHE@ t HE@tHEP"HE@f9rHUHEHH/DLHEP"HE@f9uHUHEHH HEP"HE@f9rHUHEHHHE@ t,HEP"HE@f9rHUHEHHot HE@ fEHE@uE0tacHE@uNE0uCEHEP"HE@f9rHUHEHHt UHH`H}HuHUHMDEHEHEEU܋MHEHH}uIEHcHHHHH'H<HMHUHuHEIHHEH}EHcHHHHH'HHEHE@u }HMHUHuHEAH H}HMHUHuHEIHCHEH}t HEHEE}HE0L SHք!HƿUHH@H}HEHEHEHEHEH}u4L˚^He!Hƿ荢EEHcHHHHHH@'uWHE@t} tE}HMHUHuHEAHHEH}tHEHEH}uHEHEE}oHEHUHHEȋ@HEH}u/LtHi!Hƿ葡HEH@HHEH@HHWHUHHEHHu,LڙyH!Hƿ,^HEHHUHuHu,L~H!HƿHEHHE+H}t HEHH}t HEHUHH0H}uHUHEH8H茁HEH}u4LMH!Hƿ?HEHUHHEHUHPHEUPHEPPHEH HE P ʈPHEtHE@HEfPHEHEHEHHUHHyEUHH0H}HuUHMHEHHEHEH@HUHH葞HE@9EuHEHUHEHH'HHE@H H'HHMRPILH!Hƿ谞H)HEHHEHEH9E7HEHUHSH8H}HuЉUdH%(HE1ẺuaEHH&HH&H &RPILH!HƿHH}t HEu4L)!H!Hƿ訝UHEо/H@Ht;HEILMH/!HƿWHEHHHMUHEHu4L[!H~!HƿHEHt HEỦP]HEHH HMUHEH6u4L{[!H`~!Hƿ舜5HEHHE@9EtrHE@HH&HUH H&HHPILH}!HƿHHEHEH(H|HEHEHu1L8!Hw}!Hƿ蟛OHEỦPHEHH]HUHH{HCHEHHEHHHHHEHUdH+%(txH]UHHH}Huz t?HEH@IL[ H|!HƿݚHEH@ Ht sHEHPHEHIHH,~!H¾HP*HǸh:y4L H*|!HƿRHE@HUH*HmHUHB HEH@ Hu HEHP HEHHEHQu}HEH@HURH Ho&HHPILW}! Hn{!Hƿ薙HHEH@ HHEH@ &HEHUHH HH.UHH0H}EHEHHHEHEHHE1HUHEHHuEHEHEHEHHEHUHEHHH9uEUHHH}HuRUHHH}HuHEHHL!HHg!H¾H' +HǸ?8y1LB Hz!Hƿ)HEH@H +HH5xUHH}H]UHH H}HuHEHEHUHEH3HtHUHEH.HEHUHEHHtHUHEHDHEH}u H}HEHuH@?"HUHuH`!H}t H5"?"H5!H}u HMHHH >"HPIIHz!H¾H+HǸ6Hy4Lb H{x!Hƿ裖HEH@HM+HHvHEHHL d>"L!HHz!H¾H +HǸ$6y1LTj Hw!HƿHEH@H+HHvUHSH(H}HEHEغH7HtHEغHzHEH]HuH="HEH{IHH=y!H¾H(*+HǸ@5y1Lp{ Hw!Hƿ*HEH@H)+HH6uH]UHHH}HuHEHHL:"HHȚ!H¾H9+HǸ4uOHEHHHHA:"PILݏ HGv!HƿoHHEH@H9+HHwtUHH}H]UHHH}HuHEHHL!HH!H¾HH+HǸ3uOHEHHHHM!PILm Hwu!Hƿ蟓HHEH@HHH+HHsUHH}H@]UHHH}HuHEHHL~b!HH(!H¾HW+HǸ3uOHEHHHH=b!PIL Ht!HƿϒHHEH@HxW+HHrUHH}HЎ]UHHH}HuHUHEHUHH H}HudH%(HE1HMHUHuHEH> u1LP! Hs!HƿEEHUdH+%(t$UHH}Hu]UHH H}HuHE@BHUHEDHHHEH}u HEHE`HEH9EsV3f+P*f+tHEHuIL Hr!HƸ$HHEUHH H}HEHiHEH}tHEHUHHEH@HEUH}E‹E% ‹E% ‹E ]UHH}uHUHEHJHEHHEHHEH9EtHEH+EHHhHEHHI+uHcHHHΉlEEt4Ldf HI!HƿVeHEH?tUHEHHEHUHEHHEHEt~HEHpUHEHHU؋uHEHHEH}tHEH@ HHEH@ HHEHH衞HEHY6EH4+UHcHHE4+9E|HEUHHH}HE@8t*LKD!HC!Hƿ_HEHt*L@!HC!HƿM_HEHHEHHEHH詝HEH@ HHEH@ HHEHXH3+HXH3+3+UHH}HEH]UHH}HEH@]UHH}HE@]UHH0H}uHUHU؋MHEHHEH}uXHEP@HE@9sFHU؋uHEH[HEH}t#HE苀PHE艐HEH:UHHH}HuHEHpHEHDHEH&UHH0H}uHU؉MLEЋm2+9EMHU؋uHEHHEH}tuHE@8t(HE@H+HHH>;tVy y ;} ;} HHHHx HH"H/H>HHHPHHuHH"H/H7>HHHPHHuNj;} ;} HHHHHHHHuHHHHHHHHHHH8tH/H4=HHt HH/H=HHt HH`HHH>tY=:HPH$!PIL !3H#!Hƿ>HNHHHHk>tYB=9:HPH#!PIL !7HD#!HƿY>Hx%=u%=t x%=t%=uHtHHPH/HtHHPH/HtHHHHH{H" !Hƿ7;UHH@H}HuHUȉMEHEH!HH!HƿS7cHEHnHUHMHEHHIhu8HEIL;H!Hƿ6HEUHHH $HHHH@dH%(HE1H +H@HIHH/!HǸcy>H@IL ;H.!HƿC6H`HHH5y@HILj!H!Hƿ5Hl&6HHHHXHXu4L H}!Hƿ5HHXHH uJH +HXHHL H!Hƿ#5vHHHO +HXH`uJL9H!Hƿ4H +HXHHHXHUdH+%(t3UHHH $HH $H@HdH%(HE1rHHHIHH!HǸ y>HIL'9H!Hƿ3HHHu4L H|!Hƿ3_HHHH51!HǸ10t>HIL8H!Hƿ%3HHcHH ‹HH H%H HHH+H询HHHH+H耢HHu[HHHHHHu1L) H!!Hƿ62HHUdH+%(tW1UHHHXdH%(HE1HXH@(HXH@(H % ЉHXH@(H%HpHu4Lb HZ!Hƿo1{HpHI+HhH i&H9ht+Hh&H;hHh&p<-Hh&HpH r HH')Hh&HpH H+ HHSHXHHXHHtNHfh&HP HpH H+ HHHXHHXHHudL +H!Hƿ*09HXH!HHXHHXHHUdH+%(t/UHATSHH $HH $HpHdH%(HE1HH6HDžH@P%t HH@(HH@(H % AHH@(H%mHHEAHH!HǸy>HIL4DH!Hƿ.HH(HH.$-u>HIL\4JH1!HƿF.z,)Ht H="H !HHRH!RPIL MH!Hƿ-H HHHH!H,9HHHHk!H,HHHH+HIHHB&!HǸ&uMHHHHPIL33XH!Hƿ,HH+HHH]HHumHHHHHuIHHHPIL2fHI!Hƿ^,H+HH@(H%HHHuBHHu/L tH!Hƿ+HH-8cHH@(H%jHHHuBHHhu/L? H7!HƿL+HH-8t/HHHHHHY*HHH+HHHHt1HHH*HHHHu/Le H]!Hƿr*CH*Hq HHt%Hd*HL HHu9HIL0H!Hƿ)HHHPHHPHHPH@P%uHHHHBaHHHH)aH@PHPP HH,HHtDžHH^*tO'$HPH!PIL H !Hƿ(HHUdH+%(t'He[A\]UHHH}H*HUHHgYUHHH}H*HUHH?YUHH H}HuHe*HUHHYHtHJ*HUHHrYHEHHE4HEH@HUHH?'uHEH`HEHHEHEH;EuUHH0H}HuHEЉH*H{HEH*HUHHdXHEHEHEH}H}tHEH;EuuHEHHUHMH  ʉHUHHPuQAL-H !Hƿ&H H}H}HEHUH  ЉHEH%uRALM !H] !Hƿr&HHEЉH*HHEHIL)!NH!Hƿ4 >HHHHHHt1HHHXIL} kH Hƿ.HP@%=@:H`HXHHyY HXPH PILb rH HƿHx%=u>HXILtwH9 HƿNHPHH*H9t;HXIL@|H HƿmLt_HXHuLJHP@%=`t-HPHP(HXHHuHUdH+%(tUHH H}HEHHEHEHHEHEH@HUHR(HUHR(H  ʉHUHR(HPQAL= H HƿHHEHPH*HHAHEH]HHEHEHEHHEHEH;EKUHHH}LH= HƿR*H*HHE@t/UHt*]UHSHHH}HEEEH0*HEHJHEH}tHEH@ u]H}tHEH@ u H H ILHE HƿZ HEH@ HEOHEЋt4LH Hƿ EHEH@HEH}uHL HHEH}u4L H Hƿ SEHHEHH1HEH}u/LPH5 HƿJ HEH@ HEЋEăEsHEHPEHH HEHHEHH/HHHu,L H Hƿ vHEH@HEЃmH}uH*UHMHHH*H*Hu,LHI Hƿ^ EHEHmEH]UHHH}HP*(H HGH-*H&*Hu4L H Hƿ E8H*H*Ht:(8H*H*Ht 8H*H*HuNH*HH|*L" H Hƿ/ ZHA*HyHZ*HS*Hu/LH Hƿ H*HyH*H*Hu/LfHs Hƿ HEHHH*HHH*H*Hu,L H Hƿ) RH*HAHEHu,L H Hƿ  .UHSH8}EH*H@HEH*HUHH(@HEHE@0HEX4HEHHSILRH Hƿ, HE}t:HEH̾u*L H HƿH*HUHH@HEH}%EH]UH]UHH EH*HE}~0EAL6H' Hƿ<H`*H@?HEDHK*HUHH>HEHEHH/H!*HUHH?HEH}uH*HtH*HH*HtH*H5H*HtH*H5H*HtH*Hj5pH*H}UHHHHdH%(HE1H`HHHH tUHHHPIL UH HƿHx%=@t>HHILM [HY HƿnHHHHHPHm*HHWHXHXu1L `H Hƿ;HXHPHHHHHXHHB*Hs=HUdH+%(tUHHH}H*HUHHn6UHH H}HuHEHHE4HEH@HUHHuHEH=HEHHEHEH;EuUHHHHdH%(HE1HHHHPHPHHX(HPH@H`HHuHUHHH@(H9HEHUH  ЉHEH%HPH@HHHR(HHHR(H  HHHR(HWQPVALH HƿH HPHPH*HH?5HPHz<HXHPHPHHXHPH;HHEdH+%(tUHATSHH(H HdH%(HE1Hl*H HH4H8H8tH8@Pt H8^H8tQH8H;t>H ILH HƿHPH HHH8H8H H8HR(H8HR(H  ʉH8HR(HH HPVRILH HƿH H*H HH63H H8HH7H8HH8tQH8H:t>H IL/H< HƿQh%=`t>H IL H HƿTH8HxH8H@(H9HxH *HpH@HxHxH  AHxH%H8HH8HR(H8HR(H  ʉH8HR(HH ATSPQAL* H HƿH0H8HqH@HxHxH  AHxH%H@HH@HR(H@HR(H  ʉH@HR(HH ATSPQALP H HƿH0H@HHxH HH-u4L H HƿH*H HH/H8H8HH IL H? HƿTH8tQH8HG7t>H IL H HƿLH8u=t4L H HƿH8]HxH*HemHHHHtvHxHxH  ЉHxH% RAL #H Hƿ HHHHHxH HHu4L 4H HƿH*H HHw-H8H8uAH ILy :H5 HƿJHu H8HLH8HH(HAЉ44uCH8H4ILg JH HƿH8HUdH+%(tHe[A\]UHH H}HuHUHUHuHEHUHH H}HuHUHUHuHEHUHH H}HuHEHJ*HjHEH}tHEaHEHUH  ЉHEH%HRAL aHw HƿHUHH H}uHEH}u1L jH Hƿ/DHl*HkHUHHEHUHPHEH@HtHEH@P P HEUHHH}HEH@HtHEH@P P HEHUHHH}HEHHjHEHEHHekHUHHEUHH0H}HuzHEHHEEHEH@HEH}t/HE@Pu!HELHUHuHEعHAЉEH}tHE@Pu}tHEHEHHvUHH}HE@0]UHHH}H}t)HEHHtHEH1u HEHH@D UHH H}H*HiHE>HEHiHEHUHEHHtHEHiHEH}uUHH H}HEHHEHEH@8HHEH}u4Lw Ho HƿHEHPHEH@HHHUHB(HEH@(Hu1L H Hƿ AHEHUHHH.HEHHEHUHEHH9UHHH $HHXdH%(HE1HXH,u!HXHXHHHHH HǸyHL H HƿHX|H`HHHtHXAHXHXHH2HHHHUdH+%(tUHHH $HHHdH%(HE1HDžXHHtHHH"<HHHHtbHHHuHHHHHHHHXHHH*uHHHHHHHHXHXH`M u>HXILH HƿHHu HHHHHHH HǸUy4LUH* Hƿ?~H`HHH/HIL H HƿH@H HH;T TyhH`HHHtKHHPIL &H( Hƿ=H{HHHHHHHH2HXIHH HǸّy1L-H HƿHUdH+%(tUHH H}EHEtHHEHzL- >H% Hƿ:HEHu4L CH HƿHEHEH&E}uUHE@uCLOHp HƿHE#HE@HEHHuy}usHEH@H HHTt#HEH@H HH1u-HEHE }u+HEtHES}uiEUHEHu4LH; HƿPHEH薁HE@uHEtEUHEHeu4LqH HƿHEH)u=LUHb HƿwHEHI8}uHEH0HEHHEHq`UHHHHH@dH%(HE1HHtKHHHL H HƿHHH7u4LT HL HƿaHHHHHuFL_H HƿHHHHHMu4LH HƿHHH'uCL:HG Hƿ\HHH+HHHH`H@HH(y>H@IL H Hƿ,x%=`t>H@IL Hx HƿHUH@HHu4L2 H* Hƿ?HY*H@HHHXHXu1Lԩ H Hƿ3HHtHXHHHHR[HUdH+%(tUHHH}HEtNHEHqu4L( H Hƿ5f\HEHu4Lڨ H HƿHEu HEH|uHLHr HƿHEHEHu1L0H Hƿ*^HEH#u=L"H HƿHEHHEHUHHH $HH $HH8H0dH%(HE1HHHH0H%HH0H0H  ЉLH0u H8HHHf&H‹LHHAAHHHǸ蠇y bHHHXHXvH`@<.ueH`HPHHHk HǸ-yYƅL RH Hƿ&HXHRH`H`fHXHtdHLPHPIL YHv HƿHH*HHH!H8H@ 9HT$H‹LHHAAHHO HǸy HpHH讪u HpHHH HǸ臅y1ƅL] nHU HƿjtdHLPHPILsrH HƿHH5*HHH-H6!HH= HHhHhmHpHPH@HDHIIH5 HǸKu}D9Hur@9LugHpHHHS HǸy`ƅL H Hƿ-HhHH7HHhHtaHLPHPIL HW HƿlHH*HHH|HUdH+%(twUHHHHH@dH%(HE1H`H@HHy>H@IL H Hƿx%=`t>H@IL HP HƿeHUH@HH脺u1L H Hƿ`H4*H@HHHXHXu1L H HƿHUdH+%(tUHH H}HuHUHEHHHEH}u1L1 H) Hƿ>HUHEHHUHHHHH@H8dH%(HE1H@H%PH@H@H  ЉTH8H`H8HHH8TPPPILH0 HƿEHH@u4L H Hƿ gH@HHHH'H8H8uvPHTPAL9H HƿHL` HX HƿmH`H8HH]H8TPPPILH HƿHLŝ H Hƿ,H@HHHHH8H8uvPHTPALHK Hƿ`HL% H Hƿ2H`H8HH"yzH8TPPPILH HƿHL H Hƿx%=`thH8ILj H6 HƿKL H Hƿ!{H@t}HEH9@tpHEHUH  ЉHEH%H8TPPPVRILH HƿH HUH8HH蹴u4L? H7 HƿLHf*H8HH HXHXuuP8TPALH HƿHL H HƿHXHUdH+%(tUHHH}HEHƿUHH*]UHH H}HEHHu`H–&HK HHHEH}t?HEHit0L˙ CH HƿUHHH}HEHHH8&H@tF7H&HPILG LH# HƿYH7Hߕ&IL NH HƿUHHHXdH%(HE1HXHHtyHg&H`HHuUUtDIH0&HPILv \H5 HƿkHHUdH+%(tUHHH}HEH@ HHEH@(HHEH@0HHEHUHH H}HEHHEHEHHE+HEHuHEHqHEHEHEHHEHEH9EuːUHHH}HEH@ H_HEHSUHH H}HEHHEHEHHE+HEHHEHHEHEHEHHEHEH9EuːUHATSHH $H`HHHHDdH%(HE1HH@(HHDžHHH  AHH%HHHEAHH@ HǸwHyFHHtIL/H HƿHcHHH蚛HthHHtyqHHиtOHPH PILނ H HƿHDž蔻HHH(H"H蚹HH+HHHPHIH5HǸعHHHt,HHHH ա HHǸ虹PHAAH HǸWy,Lu H Hƿ%HHH ^!HHǸ H\*HHH A*HH'HHHHH@HtHH@H謽 HH@(HHtH蕲ALH HƿóDžϮy*Lqr HH Hƿ~y*L6r H HƿCHIL Hٛ HƿHUdH+%(t8He[A\]UHH H}dH%(HE1EHEt/LP 'HT Hƿ芲HUHEHIu,L6H HƿBvHEHtH HUHP H @P H PPHDžHfDž6H H(HHHEHUH(HHHEH H-HH(HH'HEHEHP HE@H(HxHEH}tcHEH@HլHH HìHHSuHEPIL޹nH Hƿ0H H}tHEL`0HEH@HtHEH@HVHH,j!H H;HATSuHEPILqHt Hƿ誤H H}HELh HE@DHEH@HtHEH@HHHi!H H襫HHAUATSuHEPIL<uH، HƿH0H}tHEL`(HEH@HtHEH@H4HH i!H HHATSuHEPILyHR Hƿ舣H H}HEH@H9 trHEH@HtHEH@H衪HH H H膪HSHEPIL~Hċ HƿHH}HEH@H9 HEH@HuRHEHX H HHSILHJ Hƿ耢HSH(HHXH HH9@HEHHH(HHPHH D@DHXHPH9umHEDhHEH@H-HD8H HHAUSATILHR Hƿ舡H ^HEH@HȨHHEL` H H讨SATIL޷H Hƿ(HH}t=HEHEHEHH HhH HBHp{H}'HEPHE@f9uHEH@ HsH`+HE@H H(HH,H`H`tPHEHP H`HH諟u2HEHEHEHH{ HhHEHpH(HHǸ=EALHg HƿG~HEHO3EALHf Hƿ ~HEdH+%(t5}He[A\]UHATSHH8H0H($dH%(HE1DžHDžLDžPDžTDžXDž\HEHHEH۴H8 H8HH HHs|`H8HHz HHE|dH8HHh5HhH@0HHh@fHhH@HtHhH@@TH8H@@H{]HxHx`u lHE@P%HH8HLH8HHUH8H fG HAЅ H8HLH8HHUH8H  HAЅH8HLH8HHUH8H e HAЅH8HLH8HHUH8H He HAЅt\H8H@HZHpHpt6HpHUHPHpHEHH HUH8HHHEH}oHEHLHEHvAL;YHa HƿxHEHpdHpH@HEdt&HUH8HH't LHDHEHH=u TDu TH8HLH8HHUH8H = HAЅH8HLH8HHUH8H k HAЅHH8HLH8HHUH8H ; HAЅ H8HLH8HHUH8H c HAЅHEHxHxHHEHEHHxH HH>wEHxH@HHEHY~HHxH@HC~HxHSPIL)H}_ HƿvHL3HO_ HƿvHxHIL;H_ HƿMvHxHeHEH}HxHHPILH^ HƿuHHxHUHPPHEHxHxHHEHxHEH9Y HEHHpHHpHpHEH9PLPTPALzH] Hƿ,uHHEHxHxH@HtHxH@H t \XHxH@HEHEH |HEXHxHPH8HHHhHhHh@fHEH/sHEHEHsHEHEHsHE(踘HEH}tH}tH}tH}u_HEHmHEHmHEHmHEHmL2 H\ Hƿs2$uBHEHHuILHB\ HƿxsHHhH@ HDmHhH@(H1mHEHHњHhHUHP HhHUHP(HEf@HEHUHP HEHUHPHhHUHPHEHUHP HE@P HEPPHEHUHHHcHhHPHEHH|DžHHxHHxHxHEH9PHEHx2HxH@H HxH@HEH8HL@H8HHUH8HAH8HLH8HHUH8HAЅHEHHHxL`HEHxSATIL* H6Z HƿlqHHhtHhH@HE@P%HEPPHxHHxHxHEH9Ht5$t,L̎ HY HƿpnHt;L HkY HƿpH8H覽*L H0Y HƿfpHEHxHxH@HtbHxH@HEH8H@H7QHpHpt-HpHUHPHpH0HH蒧HxHHxHxHEH9e\t!XuH8HDHEdH+%(tnHe[A\]UHHH $HHHdH%(HE1HHHHHHHV HǸy4L|; HW Hƿn H`HHHht>HIL@ HSW HƿnHHHH2@HǸj\\yRlHHHH2HPILU F HV HƿnH@\dt*L, J HV HƿmHUdH+%(tlUHHHXdH%(HE1HXH2u0HXHH2H`HHYgtHUdH+%(telUHH@H}؉uԉUHMȋEԉEHEtHEt L[B*YB*9EuH}t HE3B*t:EAL H2U HƿhlHEغHؔHEH}u4L+ HT HƿlHEHHuHEغHsHEH}u4L* HxT HƿkHUHEIHHW H¾H#A*HǸ[ y4L8* HT HƿEk}tM%t=%ALɉ HS HƿjcBH{@*HǸ~fE}yl`iAL HXS HƿjHEuHE t UE։eE}uE %Eԉ?*hAL HR HƿiEw`t*L( HR HƿiHEuHE tUHHH}uuHEH8UHH H}uHUHUuHEHѺHUHH H}HERHE<s>*.i>*uHE%u/Lч HMQ Hƿh>*u*L HQ HƿJh%cE}t4fAL HP Hƿg=*Ÿ%w^t*L& HP Hƿg%UHHH}HEHHUHHH}HEt+HEHHN%tHEHUHH}HEH@xHEHp]UHH}HEH@x]UHH H}HEH@xHt HEHp HEH}u4Lz% :H-R HƿfHEHP(HEbHeHEH}u1L"% =HQ Hƿ/fdHEH^u@HEHbmILBHQ HƿeHEHUHPxHEHpUHHH}HEH@xHu!HEH@xHbHEH@xUHH}HE@tHHHHHH &H]UHATSH H}HEH@xHEHE؋@tHHHHHH &HHEHHEH}uSHEHkHHEH-lHSILoHKP HƿdHeHEH@xH9EtWHEL`xHEHHHEHkATSILlrHO Hƿ>dHHEHe[A\]UHATSH H}HE؋@pt HEH@xHu HEH@xHEHE؋@tHHHHHH&HHEH҉E}uYHEL`xHEH'HHEHjATSILH O HƿccHPHEHHHEHjuSILHN HƿcHEHe[A\]UHSHH}uHE@pHE@t9EtwHEHugUHHHHHHK&HHEHiHSILH N HƿfbHHEUPtHE@pH]UHSHH}HE@pu HEHuXHEH~HHEH@iHSILH^M HƿaHHE@pHE@tH]UHHHHH@dH%(HE1HHHhHXHHHQt4L >HL Hƿ aHHPXΘ%9ugHHH@`HXHPILAHbL Hƿ`HHHHP`H@H9H`HXHHZt _\HHXt HiI!H7!HXHRHDE RPIL, HHK Hƿ_H HEHH@HH@HH HH@HH@HHHHP`%HHPXH@HHXHPIL0K QHK HƿX_HHUdH+%(t~^UHH H}HuHEHofHEHE@DEEHEHt4L ]HJ Hƿ^8HEPX%9u[HEH@`HUHPIL`H(J Hƿq^HHEHP`HEH}ZHEHu4L hHI Hƿ^HEH?eEEHUErHΉǸ|To\fYHUHPIL~nHDI Hƿ]H}t:HEH1u*L< pHI HƿI]HEHH HHEHHEHHEHP`%HEPXHEHHUHPILH xHH Hƿ\H}t:HEHuu*L {HDH Hƿ\UHSH(H}HudH%(HE1HEHE؋@@tHE؋@@HEЉHEHu]ZWHHEH^cHSIL4}HG Hƿ[H[HE؋@0HUcǸORBZ9WHHEHbHSIL|H G HƿU[HHEHu*L  HF Hƿ[HEHEЉHEHE؉P@HEЋHEH8bHSILF HgF HƿZHHEHZu*Le H)F HƿrZHUdH+%(tYH]UHSHHH}HuHUdH%(HE1HEH8 u4L HE HƿY}HEHEHEHEG t HE H!HEHaHUHSPuIL&{H/E HƿxYH HEȋ@0HUоwǸOWTHHEH|`HSuuILzHD HƿXH HEHu*L HgD HƿX?HEHWu*Lb H&D HƿoXHUdH+%(tWH]UHH@H}HuHUdH%(HE1HE؋@DEEEEHE؋@8u HE؋@ Hƿ*SHH@4PHHP4HHHu4L MH> HƿR+ t4HXILuTHF> HƿR@tEHH@P@uHH@P HHPPHH@P t D@HH@PuHH@P%u DDHXHǸMHHB0HH@0$tPD%DHH@PHHPPDHXHǸ"MHHB0HH@0x9HXILJ= lH< Hƿ#Qm@HH@P@DDHXHǸLHHB0HH@0xRHH@P߉HHPPHXIL< wH#< HƿlP<tFNHXHPILr}H; HƿPHDNHXHPILrH; HƿOHHH@P HHPP@tHH@P@HHPPHH@4PHHP4TtHH@PHHPPHH@PHHPPPtHH@PHHPPHH@PHHPPHH@PHH@0H`H։1KxHUHHH@(H9t{HXIL`qH9: HƿNHHH-u*L8 H9 HƿEND@t8D%u)HH@0NHHHHPh<HH@P t H 9 H HH@Pt H9 H HH@Pt H9 H9 HXHQRPIL9 H9 HƿKMH HH@P$HHPPHUdH+%(tYLUHHH}HEHUHHH}HEHUHHH}HEHUHHH}HEHgUHHH}HEH:UHSHH}HE@0BtWJGHHEHISSH !RIL} Ht7 HƿKHHE@0HEHRIL7 H,7 HƿuKHE@Pt HEHH]UHHH}uHE@0yCHEHRIL nH6 HƿJHE@4~HE@4PHEP4}tDHE@4t9HEHRILmHD6 HƿJ}u HE@4 HEH=UHHH}HEHUHHH}HEHUH}E]UHH H}HudH%(HE1HUHuHEHѺH+t1L ,H6 HƿIE=N+uHUdH+%(tHUHH@H}HudH%(HE1EEHUHMHEHHu4L @Hj5 HƿHE=uHEH H- HEHEH H-HEHUHuHEHѺHt1Lh HH4 HƿuH+HEH 4 HHfHuHUdH+%(trGUHSHXHHHdH%(HE1HH HHw HH HH HHHHHѺHt4LS gH3 Hƿ`Gs#9t=DžHHƿ_ 9t;uHHHHHNHHPPPILitH2 HƿhFH wHH H-H HHHHHѺHnt4L ~HV2 HƿE9t=DžHHƿ] T9t;uHHHfHHLHHPPPILihHa1 HƿDH HUdH+%(tDH]UHH H}HEHdHEH}u1Lk H0 HƿxDJHEH@H0 HH*;HEH}uHEH0 HHCUHH@H}HuЉUdH%(HE1HEHUHEHHu4L H$0 HƿCHEH=w HEؾHptEHEHJILfH/ HƿHCEGHEؾHtEHEHqJILfH\/ HƿBE}u EHEHHH HEHUHEHHtRHEHIHUHPILqfH. HƿcBHE^HEHH H%HEHUHEHHtRHEHpIHUHPILeHR. HƿAHEHUHEHHOtWHEHIHUHPILeH- Hƿ{AHHEEqHMHUHEHH"tOHEHHHUHPILeHw- Hƿ AHEE}tH}t HUHEHEHUdH+%(t @UHH H}HuHUMUHMHEHHnt"n uHEHt HE@P HEPPUHHH8H0H(H LdH%(HE1|~HXH H@(HPDžLHXtHXu LHPH%HH(@HH9u/HPH H(HHeRu LHHPH%HH(HH9t LHPHPH  ЉHPH%HXH0H8HAAHH+ HǸHLLy?HILi+ HH* Hƿ>L[H`H8HHz83<<9HH8t HL'!H H8HRH'# RPIL NHK* Hƿ=H LHPHPH  ЉHHXH0H8IAHHW* HǸ^LLy* UH) Hƿ3=LLHUdH+%(tT<UHHH $HHHHHLxdH%(HE1DžHHHHIH@y HH HH>HHu?HIL`lH( Hƿ<lHH@H\5Hu9HIL`qH.( Hƿ;HxHHHHǸi8tSHHBHHPIL@`vH' Hƿ:;HHH;tr96Ht H!$!H HHRH RPIL }H ' Hƿ:H HUdH+%(t9UHSH8H}HudH%(HE1HZg HEHEHMHUHuHEIH H*tMH]HEHsASuIL' HZ& Hƿ9HHEH HUdH+%(t9H]UHHpH}HudH%(HE1H HEEHMHUHuHEIH  H`tvHEH@HHEPuILb& H% Hƿ9HHUHEH @& HHǸ5tEHUdH+%(t8UHSH8H}HudH%(HE1H% HEEHMHUHuHEIH K8 HptG]HEH?SuIL% H$ Hƿ38HEHUdH+%(t[7H]UHSH8H}HuHEHEHUHEHHHHEH}u NHUHEHHE؃}y (HUHEHHE܃}u } wKEHH"!HH "!H>E܉EnEeE܃EZE܃EOHEHr>HHEPIL\HR# Hƿ6HbEHHUHHEHEH HHEH>HSIL[H" Hƿ6HHEH]UHHpH}HudH%(HE1H# HEHEH@(H%HHEHH9t HMHUHuHEIH ) Ht HEH1=HHEPuIL" H" Hƿ5HHEH" HH4tHEH" HH4uHUdH+%(t4UHHPHdH%(HE1DžDžHH HH6HHHDžDž|H< txHtd.HHHHH% uHHHHtHH<#H{H1HtfHH b! HH,uDžH H F! HH+_DžPH}H:1HtDžDž(u  HHh" HH.HHHHH)DžDžDžBH< @H(u5,HHHHH% ,HHHHH% H<"uu DžoH<"u unH<3uu Dž)HH;t H H HPIL H Hƿ)1HtiH'*HHH0HH'*H '*HHLHu Hƿ0rHO'*HHHHH3'*H L'*HH荤u9LCH HƿP0 HHH)H@HHq0t-LH Hƿ/HEdH+%(t /UHHH $H@dH%(HE1HHHDžH9 H'H> H)HHOH@<.t?HHPHHH  HǸp%HHHH?2HHuHH0H%*HHHH]HH@HHi%*HetHH@HH8%*ḤHHHHHHH%*H9uH$*HJHH@H (HHHH$*HHj^HHHHH$*H9ut3AL SHR Hƿ-HEdH+%(t,UHH@HdH%(HE1DžHHIL H HƿHHH0H0HH%IL7 H HƿWQH8HHs HHH8HH HH^[H8HH@HHHH@HIHH# HǸ螽y/LDHH HƿHPHHH}tXHH$HSHPILDH HƿHgHxH%HxHxH  ЉH@ 9tbHH$HHSPHPILHDH* HƿjH H*HH*HHHKHHHHHH~ H H[ DHHD#HSATP@ILC*Hn HƿH HHH@H HHHHH"HHSP@ILC:H HƿH H*Ht H*HHJDžTHz*Ht#Hn*HHPJH0HH8H86H0Ht*L8LH HƿEt:HHcHH ‹HH H%H HHHUdH+%(t+He[A\]UHHH $H0HHdH%(HE1HHHH?*Hu HHHAHHt HDAu u H.HHHu HHHH*HHH!HHHtQHH HIL3ApH5 HƿuHHUdH+%(tUHH H}HuHUHUHMHEHHt9HUHEHH)u%b uHEHt UHATSHH $HH $HH $HHHdH%(HE1HHHHDž0HH@(HH@(H % AHH@(H%UHHEAHH HǸٶy4L?H HƿHPHHHt h%=@t>HIL H  HƿLxHHVH8H8HHeIL H HƿH@HH HHzH@HH HHUH@HHHSHHHHIHHi HǸ/y9HHIL5>H HƿHHHHH HHHtTDž,+,H< u,HƄ_,,HcHHaH9rHH@HHHyH0H0u,H8HyH@H@9H8HBt*LH HƿH0HUdH+%(tH0[A\]UHHH}HE H  HHtHE H  HHsu HE H  HHJt]HE H v HH+t>HE H a HH tHEH L HHuUHHPH}HuHUMdH%(HE1EHUHEHH'u4LI.H HƿVE}}tpE HEH9rrE؃ HUHEHѺ H^t ECHEHCt H}tE؃ HEHEe؁}vEHUdH+%(tUHHH}HEHƿUHH}HuHE@P]UHATSHH $HpHdH%(HE1DžHH@(HH@(H % AHH@(H%XOHHEAHH HǸ螰yFHHIL:@H HƿvHHa HHHHu HH@H Hu6HIL} HHZ Hƿ,HH BHHu DžHH tOA8 HPHLPILMH HƿXHHUdH+%(t}He[A\]UHATSHH $HH $HHXHPHHH@L8L0dH%(HE1HDžHDžDDžlHDžxHDžHDžHPH@(HPH@(H % AHPH@(H%LHHEAHHHǸyFHPHbILkHUHƿ HHHHHHHH H HHHHR H HHHHXHHHHIHH HǸ6HPHHHHxH%pHxHxH  ЉtHXH@ 9pƅtpHHHH HHwulH@t.Hxu$HXH@HHH5HxH8uH0#HHHHH;t0HH9HHH<-HHH HHH8t>Hu4HHH HXH@ HHHH0tTHuJHHP HH HXH@ HHnH HH HHHH tO, #HPH PILHHƿC HHHtHHlH@tH@HxHH8tH8HHH0tH0HHltHUdH+%(tHe[A\]UHHH $HHXHPdH%(HE1HDžxDždDžhDžlHDž$HHu4LP3HhHƿ HXuqL>3H&HƿDž`#H`HcHD``~H] HXHHHHǸ'y/L2HHƿ HHY HH HxHx |sHt H H HHRHyRPILLHHƿpH G Dž```H< t勅`HHHH hhxhH HHHt Hh%HHPIL1H HƿHhhu#`HHupH`HcHJHHHHH% t5HhHcHDHhHcHLDžddHcHHHHHb$HHH`HHHHH;`HHH4dHcHHHHH$H HHHuMhAdHcHHHHHHŸ$HhHcHT3ddHcHHHHHHk$HPHPH@ HpHpL*KHHƿHxH]"HPH-PILNHHƿ9H HpH@HHHpH@HHpH@HpHptHpHIL *UHHƿHxHh*!HPH5PILYHHƿAHHpH@HHIL)]HfHƿHxHDwnHPHPILNaHHƿHd`HHHH^H;rc`HHH HHHHiu3h'HpH@HhHcHL&HpH@HpHpHxHPH!HNHxH tr@7Ht H Hq HHRH)RPILnHHƿ4H HHHHUdH+%(t;UHH H}HudH%(HE1HEH@(H%HHE@ HH9u >HEH@(H%HHEHH9u HEH@(H%HHE@HH9u HEH@(H%HHE@HH9u HEH@(H%HHE@HH9u HEH@(H%HHE@HH9ufHEH@(H%HHE@HH9u?HUHMHEHH t$HEH%HHEHH9uHUdH+%(tUHH}HuHE@P%t HHEH@(H%HHE@ HH9u HmHEH@(H%HHEHH9u H@HEH@(H%HHE@HH9u HnHEH@(H%HHE@HH9u HEHEH@(H%HHE@HH9u HHEH@(H%HHE@HH9u HHEH@(H%HHE@HH9u H]HEH@(H%HHE@HH9u H2HEH@(H%HHE@ HH9u HH ]UHH}u}~HEUHcHD]UHH}u}~HEUHcHD]UHATSHH $HpHdH%(HE1DžHH@(HH@(H % AHH@(H%6HHEAHH]#HǸ`y4L`#HHƿJjHHH HHHHu 6HH@HTHu6HILQH.HƿxHHH eHHǸdtNHHHPILfHHƿLHDžHHtOHPHPILHVHƿHHUdH+%(tHe[A\]UHATSHH $HH8H0dH%(HE1HDžHH8H@(H@H8@LtH8PLH0H@H@H  AH@H%t3HHEAHHHǸ躔yFH8HILHHƿ(HPHHHt%H8@LH0HHHHuCH8HiIL$ H\HƿHuCH8HILHHƿ1HHHeH8BLH8PLH0HUdH+%(tH[A\]UHHH $HHHdH%(HE1HHH@(H%XHHH@(HHH@(H % Љ\<1H‹\XHAAHHHǸvyFHHHIL)HHƿNH`HHH>ubtOHPHPIL/HEHƿHHUdH+%(tUHH H}HuHEH@(H%HEHEHEH@(H%HHE@ HH9u HEH@(H%HHEHH9u HEH@(H%HHE@ HH9uHEHtHUHEHHPtHEH~tQJ}~8HEH@(HEH@(H %H ЋUHcʺHHHHtUHH0HdH%(HE1DžHHHѺHct4LЮ]HSHƿEf=UutDž_HHHH-t Dž8HHHH-@t DžvHUdH+%(t~UHH0H}HuHEHЉHEH}u4L׭~HZHƿHEH@HEHEH HHHEH}u HEH@(H%HHE؋@ HH9upHEHHH7HEH}u1L"HHƿ/HEHHHeUHH H}HuHEH@(H%HHE@HH9uHEHTtHEHOEEUHH H}HuHEHHEHUHEHHuMHUHEHHKu.'8 uHUHEHHuUHATSHH $HH $HHxHpHhdH%(HE1HpH@(H%HpH@(HpH@(H % ЉHDžDžHpHxHHHxHcHDtU+HHcHH ‹+HH H%H HhHDžHpHP(HhHDžHpHHEHIL HHƿXbHEH5HEHDHEHHEHBDMDEMHUHuHEH}WH9HE}uNHEPHEHEH.t/Lc HHƿ}tEHEH`}uEHEU)‰U}u EO}~ H_H% UHPAL HkHƿHH}t HEHQEHUdH+%(t UHH`H}HuHUHMDEDMHEHEHE HEdH%(HE1HEHUHuHELEHAЉE}uFHEHuILd HHƿH=}u -}ud}u^HUHEHH5 HǸy5HPH¹PILHHƿUHzHpHH / HHǸtFHHHPILH[HƿH DžHH)tW`WHPHkPIL7HHƿwHHUdH+%(tUHATSH@H}HuHUHMdH%(HE1HEHEHEHMHUHuHEH=H}t Hz HU LeHEHHSATuILnHHƿH HEH HEH}uVHEHtMH]HEHSuILHHƿ1HHEHEHUdH+%(tPHe[A\]UHHH}HuHUHEH5HUHHH}HuHUHEH5HTUHHH}HuHUHEH5pH"UHHH}HuHUHEH5THUHHH}HuHUHEH5:HUHH H}HudH%(HE1HMHUHEH5HtHEHUdH+%(tUHH H}HudH%(HE1HMHUHEH5HtHEHUdH+%(tUHH@H}HuHUȉMdH%(HE1EH}t HEHHUHEHѺH9ft,LH Hƿ&HEH HHEEHUdH+%(tUHATSHH(dH%(HE1Dž<H@4HHH(H`u4LߍWHrHƿ H(@0H@DHΉǸ`SJIH(Ht H Hyv H(HHATHRSILZHHƿ3H Eu Dž<H(H蠃u*LΌcHaHƿHILHHHƿHHΉ^tOe\HPH˗ PIL<NH9Hƿ|Ht y>HILPHHƿ2HƄHHHH5xHǸt>HILVHsHƿH4HHqHHHHuCHILT\H HƿLHHHAHѺHHHu@HILbHHƿHbHH uNHHILhH7HƿzHHHCHHBHHHuCHIL&qHƺHƿ HHHAHѺHHɺHCu@HILwHQHƿHqHH ̓HH蝽tNHHIL}HHƿ(HHHUdH+%(tAUHH H}HEHHEHEHHE+HEHtHEH蟾HEHEHEHHEHEH9EuːUHSHH $HHHHdH%(HE1DžDžHRHbHHgH@<.gHHHH MHHHHPHIHƸHHHǸDžDžH`H赹HH蜹HH`HHHIHsHt!HH`HHS[HFHH?HHHHH HHu t;HHcHH ‹HH H%H HHP`t"HHHAH`HHt%HHHHHzHHPIL{HHƿHHHHHT HHHHUHHtLPHPL OLڋH׵HƿHHHuHD HHHHSALHHƿHHUdH+%(tH]UHHH $H HdH%(HE1HHIHHHCHǸ%`yDHL bL HHƿHHIL2H~HƿHHUt[LtO@7HPHPILHHƿWHHEdH+%(t肾UHHH $H0HHdH%(HE1HHIH*HHHǸ^HtAHL LH9Hƿ|HD贷HRAL HHƿ6HHILHHƿHHǸ艹yKeHHPIL)HDHƿ臽HetO HPHo PILHݱHƿ HHUdH+%(tFUHAVAUATSHH $HHHHdH%(HE1H@HHDž(Dž$Dž8Dž0Dž4HH@(H%H H*H藩LLHPHHHH8tCZHPL LNH<HƿHI谞SHsRAL=HHƿ7HHEdH+%(t_H]UH}ENEHcHHHHHH 9Eu$EHcHHHHHHӏ E9E|-]UH}ENEHcHHHHHHt 9Eu$EHcHHHHHQ HHE9E|]UHH H}HEHHH]u E\EHcHHHHHێ HHPHEHHu#EHcHHHHHH eE9E|HEHHHʢu6HEILiQHHƿ;UH}EwYHH HH H>H{g 4H +H"H H H HEg ]UHHH}H}u HEH, HHءu HEHHH贡uhHEHi HH蓡uGHEH1 HHru&HEH: HHQuUH}EHH]%H]UHHH}HEH@XH tHEH H@HHEH@HUHH0H}HEHHEHEH@PHG=vHEH@PHǀGHEH@PHHBHEH@PHGHHEHEH@PHHMHEIHHަHǸ@E}yNHEH@PHHuILH>Hƿ茠H.HEH@PHGEHEH@PHGHEUHH H}uHE苀G=vHEǀGHEHBHE苀GHHEE޶fZfH~HEfHnHHǸ?E}y7EALjH9Hƿ臟 HE苐GEЍPHE艐GHEUHH H}HuUHEDHELHEHE HEH@HuH}WH KHUHHH}HuHMHEHHdUHHH}HuHMHEHH6UHHH}HuHMHEHHUHAWAVAUATSHxHxdH%(HE1HxkHxHM@HHy u/L\HHƿEtH]Hd HxtHxHx)‰pHxDHx艅lHxHH`HxLHxLHxH[IHxH\HStSpRAWlV`AVAUATILDHxHƿƜHPHEdH+%(tHe[A\A]A^A_]UHH H}HE苀t*LSHHƿTHEHHEhHEPHE@ЍPHE@HRAL HHƿHHEH@ HHEH@ H@HPHHEH@ H@H@PHHMHI HIHIPH HHRPILH!HƿoHHEH@ P HEH@ @$ЍPHEH@ @ HRAL_HőHƿH*LJHHƿHEHHEHUHEHH9LB HIHƿ藚UHSHHhH`HXdH%(HE1H`!H`HM@HH| u/LXHHƿ H`t HA H.IL)HhHƿ趙H`HXILH,HƿzH`HHt HHOA H`Hi[u H`H@pH(A HSILHHƿHH`H`HHEH`HH`HHUHH9s H`HHEHEH+EHE2H`HHEHHEH`HHUH)HUHUHhHHHEH}tRHUHhHHHUHPIL'HHƿH1HEIL*HeHƿ賗H`H`)‰|H`toH`HHtY|uH`t H H;? IL2HōHƿ*L5HHƿHhtPH`HhHHIL<H6Hƿ脖HHƿFH`ALe@HHƿ |ALKAHHƿٕH`AL*BHQHƿ蟕EtHEH& ILCHHƿ]LM= DHHƿ3HEdH+%(t_H]UHHpH}HuHUHMdH%(HE1H}u4LSOHlHƿ躔HEHM@HHw u4L]SRHHƿjPHEHJSILTHيHƿ'EtHEH ILVHHƿHEHHt H; HzILkWHGHƿ蕓HEHE)HEHRAL#YHHƿCHL/; \HljHƿHUdH+%(t?UHAVAUATSHPH}dH%(HE1HEH@PHHUHuAAHѺHYtEtE}tM}tUHEXpHE@`uAAHEDHEL}tE}@DHuHvXHH}tuątH IHuHvPLHuH~HHuHvPHLeMd$PM$$IHQRSAVASARPAQAUAPWVMLlgH HƿnH`HEdH+%(t蘐He[A\A]A^]UHHpH}HudH%(HE1HEH?EHEHH@HEHEHH HE@HHFs u4LO}HaHƿ诐LH-Hƿ{}t^HEHPHHEH@PHHMHIPH HHRPILsHφHƿHBHEH@HHPL zC L׈HHƿُHHEH@PHILHKHƿ虏HEILHHƿhHEH@HMHHfILmHхHƿHEH@HMHHgIL>HHƿ֎L6 H^Hƿ謎HUdH+%(t֍UHSHHHHdH%(HE1DžDž DžHDžXHDž`HDžhDžDžDžDž Dž$HDžHHDž@HDž8HDž0HHtHHHHLHHH HE@HHo u4L5LHHƿB`HpHHAAHѺH軤tpt(HH@X%Ht (tEtHHP3HH@X%HtHHPHHPLHHƿUHHl,,tjHHPHHH@PHHHIPH HHRPIL"H~Hƿ̋H HH HH@XH H!HueHHPHHH@PHHHIPH HHRPILHHƿ.HHH@HILHHƿ8HH@HILHjHƿ踊HH@PHILH+HƿyHEIL|HHƿHHPILHƀHƿHH@HHHaHHH@HHH9bHSILHRHƿ蠉HHHg LH Hƿ[HHHxHXT(tAHXH@pHHHtu Dž,t HjJHĂHXHRpHJHHHRPHHHvPH6HHHPQRILIHHƿcH ^t HIH;HXHRpHRHHPILH~HƿHHXH@xHxHXHXHPxHHH9HDžXyHH bHH HXHX>(tAHXH@pHHH8tu Dž,HXH@XHHHHH@PHHH@PHHHt HtHH΀HQRVILѾHU}Hƿ裆H ^HXH@XHPHt HHHlHRILH|HƿCHHH@XH$HH-HhHhHH@HILH|HƿЅHhH@XHt IL{&H:vHƿH0H@@= ILz(HuHƿFH0H@@-= ILz*HuHƿH0H@H@HHHHIILvz,H`uHƿ~H0HHVoHH@XHtYHHHhHhHH@H@HIL z2HtHƿ+~HH@XHt Dž HH@XH tHHa (t6tt,L6<HRtHƿ}z誊tq t H^yHw% (tt H^% HvHPIL>HsHƿ(}H(t3xALxGHsHƿ|HXtHXH@XHHHHHHILxIH/sHƿ}|H8H H8PHHIL`xNHrHƿ%|H8PHHIL4xPHrHƿ{H8PHHqILxRHGrHƿ{H8H@H@@H8HRHR8HPIL+THqHƿE{HH8H@H@PH8HRHRHHPILWHqHƿzHH8H@H@XIL@wZHcqHƿzH8H@H@`ILw\H'qHƿuzH8HHRHHILvcHpHƿzHHILveHpHƿy tD$HH]IL~vjH3pHƿyHXtHXH@X HALCvmHoHƿ*yHXHHHHHjILvqHoHƿxHALusHGoHƿxtDHH$ILuvHnHƿHxHX@THHHILuyHnHƿwHH@XHHHH`H`@LAL3uHHnHƿwHH@XHt*LHnHƿVwHHH蕱ALtHmHƿwH@``ILtHmHƿvH@pu,LtHOmHƿvqH@pu,LjtHmHƿcv7H@pALJtHlHƿ*v(tAHPpE9t0EALtHlHƿuHH@X%Ht|H@tx7H@tALsH8lHƿuH@xALsHlHƿOu(t?E|HPALsHkHƿ uHL HkHƿtHUdH+%(ttH]UHH H}uHUHEHUHHHHHȋwHEHUHHHHHH@H@Ht0HEHUHHHHHH@H@H3HrHUHPILyrH~jHƿsHHEHUHHHHHH@H@HHEHUHHHHHH@PHE@PЍHHEHUHHHHHH@@HUQPILqHiHƿsHuHEHUHHHHHH@Ht(HEHUHHHHHH@H@HH3qHUHPILYqH-iHƿ{rHHEHUHHHHHH@HHEHUHHHHHȋPHE@PЍHHEHUHHHHH@HUQPILpH}hHƿqH6HEILpHFhHƿqUHH H}LppHhHƿQqHEHHEBHEP HE@$ЍHHEP HEH@XHt HpHpQRILpHgHƿpHHEHKILoHFgHƿpHEH@H@ H@pHtKHEH@PHH@HUHH ILoHfHƿ4pHEH@H@ H@HtHEH@H@ HPHEHHEHHEHUHEHH9L HlfHƿoUHH}]UHSHxH}dH%(HE1HEHEHF‰)ЉELnHeHƿ;oHEHILnHeHƿoHEHHtHEHt HEHH IL?nHReHƿnHEH@H@H@8ILnHeHƿcnHEHAR ALmHdHƿ*nHE@(ALmHdHƿmHEH@`%E}u H H  }u HH }u HPH }u H5fH5 HQRPILHdHƿQmH HEH_O Ht H- HeHEH;O Ht HlH HSILYHcHƿlHHEHN %HtyLlHAcHƿlHEH@`%Ht HvlHxbILglHbHƿ@lHEALIlHbHƿ lHEHO AL)lHbHƿkHEHRAL lHIbHƿkHEALkHbHƿ`kHEALkHaHƿ)kEALk HaHƿjHEHEHHEHHH9ILtk HPaHƿjHEHEHHHILzbHaHƿSjHEALubH`HƿjHEHE)‰HEHHEHHHPHUHU)HPALjHL`HƿiHHEHK HHEHHHHUHPALFjH_Hƿ9iHHEHHhHE@HHK u,L'H_Hƿh[HEILi"Hj_HƿhL #H@_HƿhHEdH+%(tgH]UHAWAVAUATSHHhdH%(HE1HhHhH?‰)ЉtHhH@`%H=tH=wBH=tH=t"0HiHx.HoHxHhHxH HxHhHHhHE@HHI u/LT&=H^HƿagdEtH]HHhdHhHh)‰`Hh\Hh艅XHhHhILHhDHhDHhH&AHhH J HhHhHR`HhHSDdAR`S\SXVAWtVAVAUATPQRxILAH\HƿeHpHEdH+%(t'eHe[A\A]A^A_]UHATSHH}HEHH HHEHHHIHE苀HE苀H)HE苀HHEHHHHHE苀HE苀HHEHHHHUHHATSPIL֞XH[HƿdH He[A\]UHH H}HEH@pHE@HEH@8IL.gHA[HƿdHEHHEHUHEHpH9uUHH H}HEHHE@HEH@(ILg.pHZHƿdHEHHEHUHEHH9uUHH H}HEH(HE@HEH@IL-yHUZHƿcHEHHEHUHEH(H9uUHH}EHHN HHN H>L^dHYHƿcLHYHƿbLޜHjYHƿbLH;YHƿbeALH YHƿWb3EALHXHƿ%bUHHHHXH`HhLpLxt )E)M)U)])e)m)u)}dH%(HH1HDžn tDž DžDž Dž0Dž40HEH8HPH@H$HH0HHHZH$HHdDž HDž# ^u  wDZHHcHH%@t P H$_~,Ht"H9u H  He$HH"`tHg$HHƿ Y vYDž PHcƄ$. Hc$HcЈ$ JH$Hc$ HƄ$H$ILi`HUHƿ _Džu/J 9uDžyHJ Hu/hJ 9uDžnHMJ Hu2XHHcHH% t ~JHt@XHHcHH% tHHu Dž; u + t6LHZTHƿ]Džnnu2H$HHH^H0_Džn3AL^HSHƿ.]HHdH+%(tT\UHHH}HEHƿ]UHH}HuHEP$HE@$HEP$HEPPHE@PHEPP]UHH0H}HuHUHMLELMHUHEHHUHH H}HuHUfiuj'S)uZS)HEH <HHquHEH x]HHptR)R)UHH H}HuHUHMHEH͛HHu1LGH]Hƿ~[UHHH}HEH7UUHH H}H(HEH}u1LcH\Hƿ[cHEH%HP HEHHP(HEH@aHEH@(IL"iH$\HƿZHEUHHH}HEHƿZUHH@H}HuHUHEHEL[H[Hƿ%ZHEHEHEHHzHHRYHEHH[HH1YHEHHHHYHEHHtHHXHEH@H@PH@HMHHHEH}u1L."HZHƿ;YXH}t HEHUHPH}uHEHEHEHEHEH@HEH}HEHUHUHH H}HuHEHHEHUHEHHtUHHH}HEH@(HeRHEHYRUHH H}HuHHEH}u4LfDHYHƿ XHEH%HP HEHVHHEHP(HEH@(Hu=LYJHjYHƿWHEHQKHEH`HHHEH@(ILQHYHƿ_WHEUHHH}HEHƿ_WUHH0H}HuHUHME HE؉HHEH@HE`H}tHEHH@(HUHH&Vu5HEHLHEH0HMHUHEHAЉE}u EHEHEHHuHEHAEUHH H}HE@ t4HE@ AL1HXHƿ(VHEH@HEHEHHPHEHHHEHEHHuHEH@HOHEHOUHH0H}HuHUHMHEH@HEaH}tHEHH@(HUHHTu6HEHH@Ht'HEHL@HEH0HMHUHEHAHEHEHHuUHH }HuH}u4LKHVHƿTcEHHHMHEH}u4L_NHVHƿTEHHHMHEHHZWEHHHEHH0HEH}u@LۏVHVHƿTHEHMHEHHHEHwHPHEH HPHE@ HEHUHPHEHUHP(LUbHtUHƿSHEUHHH}HEHƿSUHHH}HEHHtHEHH5HUHHEHHu1L>H UHƿRUHH0H}HuHUHMHEH@HEH}uHEHH趈x_H`HHH?t6LQMH@CHƿ @6) 6)HEdH+%(t!?UHHA~HEHEu4L[HBHƿ?0HEH}u1L7cHyBHƿD?eHEHHHEHHPHE@ HEH HP(LNBjHBHƿ>HEUHHH}HEHƿ>UHATSH0H}HuHUHMHEt HEȋ@THEȉPT u HEHuHE؉ѺHgE}u x}HEHXEHHEHRAL_}jH4AHƿ=HHEȋ@tu;HEHDILG}lH@Hƿq=WHEL`xHEHHHEHDATSIL}nH@Hƿ=HHEȋ@THEȉPT^}ySHEHBDIL|uH:@Hƿ<HEȋ@THEȉPTHe[A\]UHHH}HE@ t4HE@ AL|H?HƿH<HEH6UHH H}Hu0EHEH}u1L?Ha?Hƿ;qHEHHHEH/HPHE@ HEHUHPHEHHP(L.?H>Hƿr;HEUHHH}HEHƿr;UHH H}HEH@xH'HH1HEH}tHƿ:UHHH}HE@tuHEHXHE@tuHEH>HEHIL{<H=Hƿ :UHATSH0H}HuHUHMHEt THEȋ@THEȉPTd u .HEHE}HEȋ@tu;HEH@ILzUH=HƿD9WHEL`xHEHHHEHu@ATSILzWH<Hƿ8HHEȋ@THEȉPT^}ySHEH@IL`z^HT<Hƿ8HEȋ@THEȉPTHe[A\]UHHH}HE@ t4HE@ AL)zjH;Hƿ8HEH1UHH H}0HEH}u1LztH;Hƿ7qHEHHHEH3HPHE@ HEH@HEH"HP(Ly~H ;HƿI7HEUHHH}HEHƿI7UHAUATSHHH}HuHUHMdH%(HE1HEHE@THEPTHUHMHEHHsHEH>IL'y!H[:Hƿ6HE@THEPTHE@P%+HEHHUHEHH\HHUHEHH:HEHEHd=HHEHUH  AHEH%AH}tHEH$=H HSAUATIL]x+Hi9Hƿ5H |,)uRi HHQ9HH4t4LWx/H9Hƿ95&,)HUdH+%(tR4He[A\A]]UHHH}HE@ t4HE@ AL x>H8Hƿ4HEH.UHH H}sHEHEu4LwIH28HƿX40HEH}u1LwNH7Hƿ4eHEHHHEHHPHE@ HEHTHP(L7WH7Hƿ3HEUHHH}HEHƿ3UHATSH0H}HuHUHMHEt HEȋ@THEȉPTHUHEHHzEE}HEȋ@tu;HEHS:ILv#H6Hƿ2WHEL`xHEH?HHEH:ATSILv%H6Hƿ{2HHEȋ@THEȉPTHe[A\]UHHH}HE@ t4HE@ ALVv1H6Hƿ2HEH+UHH H}06HEH}u1L@v;H5Hƿ1eHEHHHEH3HPHE@ HEHHP(LvDHP5Hƿ:1HEUHHH}HEHƿ:1UHH0H}HuHUHMHEH@HEHEH78HEHE؋@THE؉PTHEH@(H%HHEHDueHEH@(H%HUHPILEuH4Hƿ_0HHE؋@THE؉PTUHHH}HE@ t4HE@ ALu)H4Hƿ/HEH)UHH H}0HEH}u1Lt3H3Hƿ/qHEHfHHEH3HPHE@ HEHUHPHEHPHP(Ls3=HL3Hƿ/HEUHHH}HEHƿ/UHSH8H}dH%(HE1EHUHEHH]u;HEH6ILt"H2Hƿ}.`z HUH9sKH$HEH5HSIL2'H2Hƿ(.HEEHUdH+%(tG-H]UHHPH}HuHUHMdH%(HE1HEH@HEHEEHE@EEEEHE@THEPTHE@THEPTHEH@(H%'}}%}t }tjEEEEPx E ЈEEEEEEE ЈEEEEEEEEEEEEE ЈEaEEEEw E ЈEEEEEEE ЈEHM܋UHuHEH6 E}uhE܅tHE@T HEPTHE@THEPTHEH3ILO0_H0Hƿ+}t(HEHE}uHE@THEPTEHUdH+%(t*UHHH}HE@ t4HE@ ALpoH/Hƿ+HEH@H$HEH$UHH0H}HuUܿ0HEH}u4Lp{H /Hƿ*HEHzHHEHHPHE@ HEHHP(/HEH}u=L+pH.Hƿ *HEH#zHEU܉HE#H `HEPHEHUHPHE@ALoH.Hƿ)HEUHHH}HEHƿ)UHHH $H@HHHHdH%(HE1DžHt H@T࿉HPTHHHHHѺHtdHH/ILn'H-Hƿ[(DžH@T@HPTHHHH|ZtdHHX/IL,/H,Hƿ'DžH@T@HPTHHHHK\taHH.ILX,6H,HƿO'DžH@T@HPT DžHUdH+%(tI&UHHH}HE@ t4HE@ ALcmDHy+Hƿ&HEH UHH H}0HEH}u1L)NH+HƿW&qHEHHHEH3HPHE@ HEHUHPHEHHP(L +XH*Hƿ%HEUHHH}HEHƿ%UHH H}HuHUHMHE@THEPTHE@THEPTHEuHEu HEt HE@P%t HEtHE@THEPT%HEtHE@THEPTHEH,IL)(H)Hƿ$UHHH}HE@ t4HE@ AL3k/H)Hƿ=$HEHUHH H}07HEH}u1Lk9H*)Hƿ#eHEHHHEH3HPHE@ HEH(HP(L(BH(Hƿw#HEUHH@H}HuHUHMHEH<HEH}w HEHPHEHHEHEHH(H^"t HEؾ_HHEH}usHEHHHEHHHHϸtAHEH+EHEHEHH9Es HEHPHMHEHHUHH H}HuHEHEHS[tHEHPHEHHYyHEHHHE?HE@HUR9sHEHPHEHHHY9HEH@HHEHEHH9EuHEHPHEHHHYUHHHxHpHhdH%(HE1HEHxHHEH}u4LyH&Hƿ!!uHEHXHuHhHW$HѺH<E}y>HhILhH7&Hƿ EHEUHcHHHHHHHiHEUHcHHHHH*HH7HEUHcHHHHxHUHEHѺ@HHUHpHH7HEUHcHHHHPHxHHHEH}u/LpH%Hƿ}Hx HHEH}u4LfH$Hƿ/HEBUHEPHEHUHHUHEHHEE;ENE HEUHcHHHHEE;E|HEHHEHUdH+%(tUHSHH $HH(H HDD dH%(HE1HDž@9 v!HiҀHHHHH@HH8H8HH(HIHH#HǸ落@HPHHHtT!HPHPILH"Hƿ8HHH@HH9HHIL"Hd"HƿHHmtOd[HPH PIL;H"Hƿ{H9 s6H8H@HH8H8HH9OH@HH@H@w  v\H@g tH PSILdcH1!HƸHHEdH+%(tH]UHHH $HH $H`HHHDdH%(HE1DžDžHDžHHHGHHHIHѺHC u4LbH: HƿcHH։AHHLbHHƿOtrHt H? H HHRH RPILH[HƿH HHHHHmxHHtr%Ht H HVHHRHRPILHHƿH LHvHƿHHHHVO t4LH%HƿNHHHHH@HHHHHu4L HHƿ'HH$Qt Dž-HHkQHHH@HHHGHLDžHHHHHQAIHH HǸ=Hy4LHHƿ#HHHHC u 2u4HIL$H!HƿHHP HHDHHEAHHUdH+%(tqUHHH $HHHHxdH%(HE1HDžf)fօHxHHHIHHHǸ耵yLHxHHHPIL]7HHƿQHML8;HHƿHxHHHPIL<HfHƿHHHDžHHHH@hH@HH`HH@hHHHHHu/L\BHHƿIIHHHHH HHuNLLHpHƿHH@H@HPhHHHHILQHHƿHHuHILRHHƿFHHILuSHHƿ HHHEdH+%(t*UHH0H}HuHUHEH@HUHMHH HEH}u4Lp^HHƿ}HEH}Kt1HEILaHHƿ2HEH@HHE'HUHMHEHHHEH@HHEHEHH9EuHEH@HUHH6UHHH $HPHHdH%(HE1f))HH? u>HILrHHƿ? H/H HHHuHHƅHH+HHv;HILlY}H)HƿkHHHHHZHHHHHHHHHHHHUdH+%(t[UHHH $HPHHHdH%(HE1f))HHHHHIHHHǸny1LKHHƿX8HH= t HHHHHHUdH+%(tHUHSH(H}HuU܉MDEHEH HEHHHUHHEHHu4L.1H9HƿHEu HEHHEH HCHCHu1LW9HHƿ8HEHU܉PHEHU؉PUHEHdH]UHHH}HEHHt6HEHH@HyHEHHUHH}uHEHU]UHH0H}HuUHEH"H HEHUHEHHHEH}u1LWHHƿ u}t HHHUHuH}IHHH¸脬y1L]H(Hƿn HEUHH H}uHEH@`Ht HEHHt HEHHtHEHHH@Hu!HEH@`HHHEHP`}4V tKHEH@`HHHEHP`LTvH4Hƿz )HEHHH@HӸuD}t4L|HHƿ" HEHHH@Hb u^ uR}tBHEHILSHZHƿ OEHE@(HUHHPILSHHƿH HHEHHHHEHH@HHHEH}u4LHHƿ HEHHxHEHHHHEHHHpHUHEAHu1L]H$Hƿj HEH@`HHHEHP`UHH H}V HEHEnZ EUHH H}HuHEHHHHUHEHHEHEHHHHUHEHHE}t }tUHH H}HuHUHEHHEEUHSH(H}HuUHEHHEHHKHUHHEHHu1L*HHƿ}HEukHEHHEHHCHCHu1LeQHAHƿUHEHdH]UHHH}HEHHt6HEHH@HHEHHSUHH}uHEHU]UHHH $H0HdH%(HE1HHHHHHH@HH=HHu4LGH HƿTHHHHHHPHIHH HǸy1LOH Hƿ6uS HHHHHV HUdH+%(tUHHH}HEHHtHEHHH@HuVHEHHBHJtL:OH HƸ_O t4L2OHv HƿHEHHH@Hu HEHHH@Hu=u1LNH Hƿ0THEH4u?HEHILN H HƿUHHH}HEHHn HEHHgt HEH UHHH $H HHdH%(HE1HHHPHHIHH HǸy1LM(H HƿgHHstOjaHPHPILA0H; HƿHHUdH+%(tUHHĀH}HuHUdH%(HE1HEHEHEHEHEH@HEEHEHEHEH@hH@HH`HEH@hHUHHHEH}u4LLCHiHƿHEH@ HEHUHEH H9tdHEH@LPHMHUHuHEAAHAHEH}u*LIHHƿ%H}tHUHEHHH}uHEH@H@HPhHEHHEHUdH+%(tUHH H}u}t HEH@`@p%u HEH@@Hu4LaHHƿXHEH@@HUHR@HHH辞HEH}u@HEHILYKfHHƿHEHuUHSHHhH`\HPdH%(HE1H`HHE\hHEH6H`HHE#HEH@HEHPHuHHVHA4HQHHIȹHY@u1LМrHHƿ_HHH HHǸu1LvsH*HƿHUdH+%(tUHH@H}dH%(HE1EHEHEHHE*HEH@H HUHHHEHEHHEHEH9EuHEHHEHEHHEHEHEH}u4L,HDHƿHMHEHDŽHHǸ2 u/L9HHƿF4HEHHE}uRHMHEHHHǸX2 u6LњHHƿEHEHPHuHEHH;HǸ1 u,LpH$Hƿ}nHEHHEHEH9E1HMHEHHHǸ1 u,LHHƿHE;HEHLʙH~HƿHUdH+%(tUHH0H}HuHUHEHHEH#HEH}u1LBHHƿOrHMHUHEH5wHǸJu=HEHLHHƿHEHUHHH $H0HHdH%(HE1HDžHH@`HHHHhHHHɻ u4L%HHƿ2HHH |HHǸ%u4LȗH|HƿtHP(HH HHǸu4LhHHƿuHH@HtHH@H&HH@HtHH@H@HHthHHP8HHHPH5WHǸu4LH`HƿXH%Ht/HHtHH H HHHH$u4LHHƿ#HHHH&HH6u4LHkHƿcHHHtyHHtdHHHH HHǸu4L+HHƿ8HHHHHHH HHǸ u4LHdHƿ\HHHtdHHHH HHǸu4L9HHƿFHHHHHǸu4LȓH|HƿtHHH gHHǸu4LeHHƿrHHH HHǸ_u4LHHƿH@PH@PHHu4LHIHƿAH@P.HHH EHHǸu4L+HHƿ8HH@XHtbHH@XHPHH HHǸu1LHjHƿeHLHH HHǸu1LVH HƿcHUdH+%(tUHH H}HuHEH@HUHHHEH}u1HEILp"HHƿHEUHH`H}HudH%(HE1H}tHEHM@HH u1LWH HƿdHUHEHH HUdH+%(tyUHHH $HH $HPHHdH%(HE1HHHHǸu4LHNHƿQHH^HHHHH@HHH HH譲 u4L HHƿHHHHHHu4LH_HƿbHHu4Ld!HHƿqHHH qHHǸdu4L"HHƿHHHHH OHHǸu4L%HOHƿRHH腍HzH=v4LC(HHƿUHH2HHHHgxHHH :HHǸ:u4Lˌ,HHƿHHu4L.H8Hƿ;HHP@HHHHHHHP@HHHH_HHHHHH :HHǸu4L3HqHƿtHHH HHǸu4L`4HHƿmHHHHHu4L8HHƿHHHHHH#u4L;HXHƿ[HHHHHHHHǸu4L2=HHƿ?HHHH HHǸ+u4LΉ?HHƿHHHHHHHXHǸu4LG@HHƿTHHHHHHHHHH wHHǸu4LDHiHƿlHHHHHHHHǸu4LCEHHƿPHH>HHHHǸ;u4LއIHHƿHHHHHHH9?HHHHHHǸu1LKMHHƿXHUdH+%(t{UHH0HHHdH%(HE1HH@HPXHH1u4LWHSHƿHH "HHǸu4LCYHHƿPoHHHP HH HHǸ1u4Lԅ\HHƿHP$H@$HHHHHMHǸu4LS]HHƿ`HH8u4L _HHƿ8H@(HP(H@(HHHHHHǸu4LyaH-HƿHH@HP(HHH5/HǸmu4LdHHƿ<HHHHHH0u4LgHeHƿHH@H@ H@Ht^HH@H@ HHHHHHхu1L8kHHƿEgHH6HHHHǸ3u1LւnHHƿHUdH+%(tUHH@H}HuHUHEHu4LbzHHƿoHUHEH ;HHǸhu4L |HHƿ@HEHEHEHUHHHHHȋ#pHEHUHHHHHH@H@HEH}uRHEH@H UPuALTHHƿ>HbHUHEHHIHEH}u4LۀHHƿHEЋ@L9Eu HiHGHEHMHHHHHH@HHuHEIHH5rHǸ&L9HHƿFnHEH@H@%HHEЋ@L9Eu HiHHEHMHHHHHxHEHMHHHHHH@HpHHEIЉHH5HǸML]HHƿjHEHUHHHHHH@H@XHH!HtsHEHHHEHUHHHHHH@HtlHEHUHHHHHH@H@XHH!Hu4LH2Hƿ苿HEHH3HEHUHHHHHH@HHEЋ@L9Eu H'gHHEHMHHHHHH@HpHHEHHtOHEHMHHHHHH@Ht(HEHMHHHHHH@H@HHfH}IHHH{HƸL7}HHƿDlHEЋ@L9Eu HfHHEHMHHHHHH@HpHHEHHH5HǸL|HLHƿ襽UHEH@HUPuALHHƿUH|EHEЋ@L9E9HEH*HEHpeHHǸ*u1L{HHƿڼUHH@H}HuHUHMLEHEHHUHEH HHHEHܾHEH}t+HEHpHEHxHEHHHHuHEHEHHUHuHEIHH!HǸ:u1LzHHƿUHHH $H@HHdH%(HE1HH@XHHHnu4LBzHHƿOHHPHHH KHHǸ>u4LyHHƿHHHHH HHH u4LxyH,Hƿ腺6HHH υHHǸxu4LyHHƿ(H%Ht3HH@PH臣tHH H HHHHu4LxH5Hƿ莹?HHHHO HHu4L"xHHƿ/HHHHHHHHAHHH5Hu4LwHMHƿ覸WHHHH HHǸu4L5wHHƿBHHHtdHHHH HHǸu4LvHrHƿ˷|H@`tjH@`HHH _HHǸu4LEvHHƿRHH@hHteHH@hHPHH HHǸ-u4LuHHƿݶH@pt aHHH HHǸLVuH HƿcHPpHH HHǸSu8LtHHƿH@tx`HPtHH 'HHǸu4LtH8Hƿ葵BH@xx`HPxHH ĿHHǸsu4LtHʼHƿ#HHHXHH bHHǸu4LsH]Hƿ趴gHHu4Lbs HHƿo DžHHH{PHHrPHHHщu4LrHHƿHHHHHHH9hHHHHHHǸu1LDrHHƿQHUdH+%(ttUHH H}HuHEHHt HEHHHǸu4Lq!HYHƿ貲HEHlHEHHEoHEH@HV3tOHEHPHEHHu5L%q+HٹHƿ2HEHHEHUHEHH9zHEHHEoHEH@H2uOHEHPHEHHu5Lp2HBHƿ蛱HEHHEHUHEHH9zHEHiHEH؇HHǸiu1L p6HHƿUHH@H}HudH%(HE1HEEHEHHEHHECHEH@u)HEH@H@H@HH莪HUHHHEHEHHEHEH9EuHEHu :HEHHEHEH茨HHEHHEHHu4LRHHƿ HEHHEHMHEH(XHHǸ! u/LnXHNHƿ觯PHEHHEHEH@}uRHMHEHHHǸ u6L n_HԶHƿ-EHEH@H@HPHHuHEHHyHǸ> u-LmdHkHƿĮpHEHHEHEH9EHMHEHVHHǸ u,LNmhHHƿ[+HEHHtHEHHHEHHUdH+%(tVUHHPH}HuHUdH%(HE1HEHH HEк(HH7 u4LlyHGHƿ蠭zHEH{u4LOl{HHƿ\6HEHPHHEH ^HHǸQu4Lk|HHƿHEH軾HUHEH ExHHǸu4LkHEHƿ螬xHEH@XHHUHEA(HHH5|Hu4L+kH߳Hƿ8HEH@`HHUHEA(HHH5H4u4LjHyHƿҫHEH@hHHEH@htnHEH@hH@HPHHEHH_H5HǸL8jHHƿEHEH@hH@HPHHEH HHǸ2u4LiHHƿH}tTHUHEH `HHǸu1LwiH+Hƿ脪aHEHxHEHHHǸxu1LiHϱHƿ(HUdH+%(tKUHH0H}HudH%(HE1HEEHEHPpHEHHtHUHMHEHHEHEHvEHUdH+%(t迨UHH H}HuHEHHjt ?HEHHHǸMu4LgHHƿHEH跺HEHHE[HEH@HPHEHHu1LgH4Hƿ荨HEHHEHUHEHH9uHEHcHEH~HHǸcu1LgHHƿUHHHhH`dH%(HE1DžtHH~HhHHhHHu4LkfHHƿxsHhHBHhH@Hu4LfHƮHƿH`HHxHxH@HEtPtH}HH¾ Fy4LeH7Hƿ萦.HhHHUHH蚆HEH}u4L+eH߭Hƿ8HEHM@HH u4LdHHƿHhH@HUHMHHu1LdH9Hƿ蒥3HxHHxHxH`HH9bHUdH+%(t臤UHH0H}HuHUEHUHEHH u/LcHHƿTHE@8tMHEHHUHMHHHEHuIL:HHƿ$HHEHEHUHH0H}HuHUH:#HEHEEUHHHHHHEHЋ@tnUHHHHHHEHHH#EHtHUHHHHHHEHHPHuHEHHHǸu/EUHHHHHHEHHHDUHH}HEH@HEHEH@HHEH}tHEPP]UHH H}HEH@HEHEH@HHEH}t@HEPPHEHHfHEHHE@HE@ UHH}HE@]UHH}u}tHE@HEPHE@HEP]UHHH}HuHEHEH@H@Hzu1LRbHxHƿ裓UHH}HEH@HEHEH@]UHH}HEH@HEHEH@H ]UHH}HuHUHEH@HEHEHHE*HEH@HP@HEHH9u#HEHHEHUHEHH9uø]UHH}HuHEH@HEHEH@HEHEHHEHH9u1HEHPHEH@H9uHEHPHEH@H9u]UHH}HEH@HEHEH]UHHH}HuHEusHEH@PHPhHEHH1p uTHEH@HHUHRPHHPIL HHƿ轑HUHH}HEPHEPHEHPHEHPHEHP HEHP HEH(HE1HEPHEPHEHHEHHEHPHEHPHEHEHHuÐ]UHSH(H}HuU܉MLEHEHXHEHHBHSIL0 HHƿ躐HHEHpHEHHUHѺH&thHEHXHEHH˗HSILHHƿCHHEЋHEЉ HEHEHHƿϦ9taHEHXHEHH?HUSPALHHƿ贏HHEЋHEЉHEHHEHH \HH臏t^HEHXHEHH诖HSIL=HHƿ'HHEЋ HEЉHE@tbHEHXHEHHEHURSPALHHƿ蹎HHEЋ@HEЉHEHPHEH@H9tbHEHXHEHHΕHUHRSPILHHƿAHHEЋ HEЉHEЋU!HEЉHEЋtH]UHH0H}HuU܉MLEHEH@H@HyfHEH}uBLXHgHƿ蒍HEЋHEЉGH}ЋM؋UHuHEIH;u"HEH@H@HUHHgHEUHH0H}HuUHMLEHEHH ۙHH֏HE@HEHUHPHEH%HEHHƿϦ̤HU؉HEHHEHHu*HUHuHEHѺH8$t@HEH轓IL(HHƿ:HEH+UHH}HuHU؉MLELMHEH(HEHEHHEHEt*HEH@HtHEHHEHH9t HEHE HEHEHHuHEH@HuHE]UHHPH}HuHUHMLELMHEH}t1HEIL4THHƿH}u tHEH@ H+EH;Es`HEHHHE؋@(HUHHhQPIL cH~Hƿ詊H HEHHEHEHuHHtHEHuHEH)HEHUHEHHEHE؋@(HUHuuuPIL tHߖHƿ H HEH@ H+EH;EsWHE؋@(HUHHhuPIL H}Hƿ訉H HEUHSHxH}HuHUHMLELMdH%(HE1HEEEHEH@HMUHuIȹH,HEH}uNHEHHfHUHPILHHƿڈHWH}MHUHuHELMIHHEH}uNHEHHHUHPIL H4Hƿ_HHEHHEH@HHEH@ H9s$HEHHEH@HEH@ )ȉEHExHEH@HHHEH@+EHEHPHEHHIHELDMHMHUHELEAPLEAPWH=ğW}WSVASMоHWfH@HEH}u{HEuqHEHHÎHUHJHUHHuH~HuH6HPuQRILHHƿH HEHHRHUHJHUHHuH~HuH6HPuQRIL H}Hƿ訆H H}t"EtHEH@`H HHEHP`HEHUdH+%(t襅H]UHSHXH}HuHUHMLELMHEH@HEHE@ HMLMLEHUHuHEWjHbHHEH}[H}PHEBHEHHEHEHHEHH:$HEHE@ tHEȞHSILHHƿDHHEH芌ILHܑHƿH}tHEHHHƿ0n HhH(HƿϦ$HPHHP HHHpHHP H@(HHHVRPILR HQHƿ|~H0HH@ H-HH-HHhH9saH@(HHhPILHĊHƿ}H ) HH(H0H0HhtHDž0H0HHu H0H@HuHDž0H0HH@H0H@HPH0HH0H@HHH@ H9sfHƿiYH}t-HEH@ H-HH-HEHEH HHEHHEH(HEHEHHupHEHPHEHHHEHHG`HSILŶ HeHƿXHHEPdPd HEHHEHP0HE؋PHEP8HEHHEH@HHEH@ H9s$HEHHEH@HEH@ )ȉEHE؋PHEPTHEHPHEHPXHEH@HjHEH;gtAHEHHL_IL HdHƿWcHEHHHEH@HIHEH@+ẺHEHHHEHHH}tAAHEH0HEuRHmoRURMADHX3H ubHEHPHEHHHEHHm^HSILkHcHƿVH=HEHH)ubHEHPHEHHHEHH]HSIL6 HEcHƿpVHHEL HEHXHEHPHEHL,HEHH]HATSAUIL &HbHƿUH H}tPHEH@ H-HH-HEHEH@H;Er HEHHEH@HUH)H HEHHe[A\A]]UHH@HHdH%(HE1HHH@HHHHHH@HHHPHHP HHOHH(HHHPH@ HH0HHHIHщHiu1L_PHAaHƿlTHUdH+%(tSUHH H}HuHEHcEHEH?teMHEHbUHEHbUHATSHHHH@H8dH%(HE1HEHEHEHEEHEHEHEHEEH8H@hHXH8H@pH<t!H8HHpHE HHV9H8HHt&H8HHHhHE HHUH8HE HHUEtH}H8LHpH8LH8HH@H@Hp0HUHHHjjWHJH H`H`u4L}H_Hƿ+RH`H;`HhH@H8H`HHZH`HXH8@ t!H8HH HE HHTH8HE HHtTDžT:THuHXѺ HHHpHpHpH@HxHxH@H IHxH@H HHxHH[XATSIL H]HƿPHHpHKHxHHHxHPHxH0H`AAHZXu5LMH/]HƿZPTTH8H`HH Zu4LH\HƿOaH8H`HHXu4LHx\HƿOH8HEH@HEHUH`H HH[u4L+H \Hƿ8OH`H8HHu1L H[HƿNWH8H@@HhHH蚞u1L Hj[HƿNHUdH+%(tMHe[A\]UHH0H}HuHUHEHEu BHEH@@Hu +HEHH@HEHHHEH}uCHEH IL-HZHƿMHEHG\E}wGHEH@@HTIL٬H0ZHƿ[MHEHEH\EEuGHEH@@H~TILHYHƿLHEUHH H}HuHEHEHE8Ho%HEH}u1LZH]YHƿLHMHE8HHLOHEUHH H}HEHEHEHHSUHH}HEHEHEH@]UHATSH@H}HuHUHEH@HEHEH@HEHEHEHuIL#H~XHƿKHH}u^HEH@`H@,HxHHEH}t1HEILv)HXHƿ@KHUHEHHaHUHEHHPHEHHEHH9s`HELHEHHEH ATSIL4HWHƿJH}HEHHEHHHEHEHHEHHMRPIL;HWHƿ9JHHEHH;EsCHEH ILAHVHƿIHEHHEHHhHEHH9sCHEHILGH^VHƿI]HEH@pHHEH@hHKHEHUHHEHPhHEHHEH@hHUHHHUH}t(HEHHEHH+EHHEHHEHHEHHEHHH9s$HEHHEHH)HEHHEHHEHHHEHHEHeHUHHUHHuHHPQRIL^HTHƿHH HEHUHHEHHUHHPILeHTHƿGH:HEHPpHEHHEHHUHHPILJrH)THƿTGHHEH@hHHEH@`Ht HEHP`HEH@hHHEH@pH9r*HEH@pH9EsHEH@pH+EHHEH@hH9sCHEHILݨyHSHƿFHEH@`HuHEHUHHEHPhHEHHE@|tHEP|HEHE@xtHEPxHEHEHHEHEHHHPHEHH9HEHIHEHHEH@`H@HH9HHEHHEHEHHHPHEH@`H@HHATSILH(RHƿSEH&HEH@HtHEHPHEHHe[A\]UHHH}HEPHEHEw-HEH@@HtHEH@@HrHEH@HUHHH}HEH@hHtHEH@hH"HEHHb>HEHV>UHSHHxHpHhdH%(HE1HpH@hHEHEEHp@ t!HpHH HE HHFHpHE HHFHpHPhHhH@H9EUHuHEѺ H:HEH}HhH@UHuѺ H:HHhH@H@HUHHr<HEH}u4LHOHƿC5HhH@MHUHuAȹ H7E}'HpH@@Ht8HpH@@HpHR@HHHHEH}uFHpH^ILPHOHƿ;BkHxHEHHyHu4LHNHƿAHUHEHHqDu4LHwNHƿAHuHE H8HEH}t#HEH@HEH}tHEH@H HEHhHPHpHH4HpHHuYHptHHpHhHHpHHHEHHpHHpHhHpHHpHH)HH+EHhӺHHEH;EssHhHhHHH蛡HHpHHSILHLHƿ?HHEHpHUdH+%(t>H]UHH0H}HuH}u HEHHEHEHMHH);HEH}tXHEHB9HPHEHH9Eu;HEILˡ(HKHƿ ?\HEؾHHEH}u4L.HKHƿ> HUHEHHHUHHEHHu/LV1H8KHƿc>uHEH@HHEH48HPHEHHHEH}u/L6HJHƿ= HUHEH nLHHǸh8HEHUHP[HEHPHEHHHUHBHEH@Hu/Ld;HFJHƿq=HEH@HtHEHPHEHHuHEH6HH]HUHBHEH@Hu,L?HIHƿ<HEBHUHEHH8LFHIHƿ<UHH@H}HuHEEHEH@HHEH}u4L\UHIHƿ><HEHUHPHEԃHEH@HHHEH}u4L]HHHƿ;HEH#HPHEHPHEH@HHHUHBHE@ HEH@@HuHEAHk0 HEH@HEHEH@HEtgHUHB@HEH@@Hu;HEIL6hHGHƿ:EԃHUHEHHHEH}u>HEHuILoHWGHƿ:HDHUHEHHD=u,L.sHGHƿ;:UHSHxH}uHUHMDEdH%(HE1HEH@`HHE}vRHEH@`HX8HEH@@H#AUSPALIHpFHƿ9HHEH@hH@HHHEH}u4LgHFHƿI9-HEH@hH@8H>HEH}u@L7HEHƿ8HEH2HEHPHEHPHEHUHPHE@ HEHP@HEHHEHUHPHEHUHPHEH@HEH H.UHEHm3EHMHE HH;HEH@hMHUHuAȹ H%-HUdH+%(tA7H]UHSHH(H LD dH%(HE1HEHEHEHEEH H@hHPHDžX蕚HH`Dž4H @ t!H HH HE HH :H HE HH9v]H(HX8H HSPAL#HCHƿ6H H HH HhH HH HpH HH HxH HH HEH HH HEH HuHPѺ HT-HtxH H(HHm uUH HHPALHnBHƿ5HtHhH@HCHHsHuHP H,HEH}t2HEH@HEH}tHEH@H@HCHHHEH@HCHHHptHpH)@HnHHH@H9EHDž8H@H+8H趗H9r0H8H`HUH}tH`H+EH8HxtcH8HHкHxHUH}t;HHxHH+EHEH8HEHH9@r HEHHxt`H}tYH8HHкHxHHu4HHEHHEH8HEHH9@r HEHH8HHH9@HxH@H+8HxHH9s{H@H+8HxHH)HH8HHкHxHUH}tHxH+EHH8HHH9@sH@H+8HDž4HptXH8HHH HH HH HH HHH HuH8HHH HH HJH t9H HH H HHH HEHhu t>H}tHEHhH@H}t H@H?HHHuHP H|(HEH}t=HEH@HEH}t*HEHPHEH@HH@H?HHHDž@H?HHHptHpH@H~?HHH@H;EHH9EsHEH+@HDž4HEH+H8HEH+H;@s0HEH+@HHEH+H8Dž4rHxthH8HxHUH}tJHHEHHEHEH;Es.HEH+EH;@rHEHHEH+H84tVH HH@HIL H!<HƿL/H HR_H9sJLHHPIL H;Hƿ.HHHXH9HFHEH H@@HUH8HH~tSH Hu8IL= H,;HƿW.H HH8H AHu1L H:Hƿ-[TH HHPAL Hk:Hƿ-HHUdH+%(t,H]UHSHHH}udH%(HE1HEHEHEHEE}vYHEH@`HX8HEH@@H`4USPAL> H9Hƿ,HpHUHB0HEH@0Hu/L@ HK4Hƿv'xHEH@0HruKLE H4Hƿ3'HEH@0HHP(HEH@0HHEHPHHEHH5HHUHBhHEH@hHu/LK H3Hƿ&EHEHHHEHEHUHEHHHEH}u,L@Q H"3HƿM&RHEH@hHUHHHEH@8IL5U H2Hƿ%HEHEH.HUdH+%(t%UHH`H}HuHUdH%(HE1HEH@HEHEH@HEEHE@ HuHEH@`HMIȹH_HEH}uCHEH,ILi H1Hƿ%HEH(HEHEH@HEHEHHEH@HE@HEHHEH@HE@HE@ HEH@`HMHUHuIHщHOu@HEH+IL x H1HƿC$HUdH+%(tf#UH(u#NH(H((]UHSHXH}HuUHMDELMEHEH}u4Lc6H2Hƿp#"H}H]HEH*HHEPEPSIL 9H42Hƿ#H HE(D@T}DUL]HMUHuHEHjDM AQAPuWMMH!H0H]HEH*HSILAH1Hƿz"HHEH'u/LGH]1Hƿ7"} tEHEHv)IL NH1Hƿ!EHs(HEvHEHHHEH҅tYHEHL@HU(HMHEHHAЅu,Lh[H0Hƿu! EHEHEHHzHEHEH]UHSHXH}HuHUHMLEDMHEH}thHEHHu\HEH@HHUHHEHHu4LZH/Hƿ |HEHHHE@HHEHƿHEH}u4L/Hb/Hƿ< H}t/HEH9E8u!HEHH@MU(ʉH9uEH}H]HEH/'HHE(PEPSILz H.HƿH M(DE}tAALM HUHuHEHj}W}8Wu0QHDHBH0u}HEH&ILH2.Hƿ HEH$u/LH-Hƿ}tOH}t HEHEH%IL H-HƿxAH(HEHEHHHEH҅HEHL@HEHpHEH@H@HMHUHAHEH}u/LH -HƿHEHL@HEH@HMHHU@HuHAHEHUHP8UE(HE؉P4HEHEHEHHH}t4H}t-HEHHt!UE(HEHHPHEHU8H}t HEH}t HEHHEH]UHH H}HuHUHMHuHEuujjjjjjAAHH@UHH@H}HuHUHEuH"(HEHEHHHEH҅HEHL@HEHpHMHUHEHAHEH}u/LH7+HƿHUHEHHHEHrE}t0EAL2H*HƿHEHHEHEHHHEUHH H}HuHUHUHMHEHHUHHH}HuH(H(H(L@HEHp`HUHEHѺHAUHHH}HEILg7H)HƿUHH H}HEHH)HH#HEH}uH)HyHEH@ HEH}t)HEuHEH@H)HHtH)H$HEHHHHHEH}uH)HFHEH@ HEH}tHEuHEH@HtH_)HUHH H}HEH@XHtSHEH肙HEHEHu1HEHH@H@HH)HHHtUHH0H}HuHUdH%(HE1HUHMHEHH<u1L(wH'HƿMHUHEHH1 u1Lv(|H'HƿiHUdH+%(tUHH0H}HuUdH%(HE1HEHHUHEH cHHu4L'H 'HƿHUuHEHѺH}u1L'H&Hƿ{sHUHEH xHH1tPHUuHEHѺH|u1Lb'HH&Hƿ HUdH+%(t0UHH H}HuHUHEHEt1LSH%Hƿ~HEHPHEHHHHMHEHH`u1LH^%Hƿ#HEH@HEH}KUHATSHH}HuHUHMLELMHEHxHEHpHE HhHE(H`dH%(HE1HE(HHEH}t&HEHHUHBHEH@Hu4L Hh$Hƿ-JHEH@HEHxHHUHhHHFu4LH$HƿHxH@HxHxu4L$H#HƿyHEHxH)@HH5u4L~H_#Hƿ$AHEHEHHEHHHUHBpHEH@pHu4LH"HƿHEHHhHEHx HHfHEHHxHHu4LQ}Hn"Hƿ3PHxHu#HHt\HEHHxH M#HHu4L}H!HƿHUHxH }HHtRHUHEHHHUHBHHEH@HHu*L|Hx!Hƿ=HUHxH =HH}tRHUHEHH6HUHBPHEH@PHu*L|H!HƿHUHxH _HH tRHUHEHHHUHBXHEH@XHu*LE|H HƿWHEHHxH HHu4L3|H@ Hƿ"HEHHxH F^HH>u4L|HHƿHEHEHEHUHxH &^HHSHUHxH ^HH6HEHtqHEHthLeH]HEH%ATSIL{ H:HƿHHUHEHHUHEHgHEHu HEHuHEHtLHEHuCHEHIL{HHƿ~HEHHFHEHHFHUHxH %_HH tyHUHEHHEHH&uWHEHHEHHSIL{HHƿHHEHEHEǀHEHǀHEHUHP`HUHEHHu1L+*HsHƿ8XHEHEHEHEHEHEHUHEHH'GHUdH+%(t He[A\]UHHpH}HuHUHMLELMHEHEHEHEHE HEHE(HEdH%(HE1HE(HpHEH}t&HEHTHUHBHEH@Hu4LDH8Hƿ pHEH@HEHEH@HEH}u4LIHHƿ HEHMH]8HHiu*LNvNHHƿX HEHHHtOHEHHEH HHu*L=vRH*Hƿ HUHEH HH2tRHUHEHHHUHBHHEH@HHu*L xVHHƿ HUHEH D7HH½tRHUHEHH{HUHBPHEH@PHu*Lw[HJHƿ HUHEH XHHRtRHUHEHH HUHBXHEH@XHu*Lw`HHƿ HEHUHhHH4BHUdH+%(t UHH H}HuHEHHE2HE@ HUR 9sHUHEHHAUHEHHEHUHEHH9uHE苐HE@$HE艐HEHUH°HHxAUHHH}HuHUHMLELMHEHxdH%(HE1EHEH@HEH}u4LHHƿE HUHEH HH舺uOHEH@HHUHHPIL"vHHƿHsHUHEH WHHuOHEH@HHUHHPILuHHƿoHHUHEH HH讹uEHUHEH \HH艹uEHHEHUHEH (HHOu4LuHHƿ_HUHEHHHEH}u4LhuHHƿr HEHPXHEHHouCHEHeIL2uHOHƿHUHEHH>HEH}u4LHHƿ]HUHEHHHEH@ H@ HtTHEH@ HH HUHEHHхu4L=HHƿJHE@t&UMHE@)NjuHEщH=EEDE}DUMUHuHEHjjjjAPDEAPWjjAEHaHPHEH}u4L8HHƿ(HEH@H@ H@(Ht`HEH@H@ L@(HxHMHEHHAЅu4L HSHƿHUHEH THH˷tyHUHEHHEHHuWHEH@HHUHRPHHPILrHHƿHHUHEHHHEH@H@HtHEH@XHH HEHPXHEH@H@HtHEH@X̀HHEHPXHEH@H@H tHEH@XHH HEHPXHEH@H@HtHEH@XH HHEHPXHEH@H@%Hu)HEHtHEH@XH @HHEHPXHUdH+%(tUHHPH}HuHUHMLEHEHUHEHE؋@Lu;HEILWqHHƿEbHEȋt;HEIL-qHHƿHEH@Hu;HEILqHzHƿ?;HEH@t;HEILpH1HƿHEHPHEHH2HEH}t]HEH@H@HUuHEH $Lj HHƿwsHEHPHEH@H@PHH~HEH}tfHEH@H@HMHUuHEIȉH0!LڿH"HƿHEH@Ht HEH@H9HuILoHHƿHHEH@HEȃEHEH@HEH}tHE؋@L9EH}u HE؋@L9Es8HEILloHAHƿUHH`H}HuHUHMLELMHEHEdH%(HE1EHEHEHEH@ HumLEH}HMHUHuHEHuMIHHu4L07HxHƿ=EHEH@XH t:}~4Ln=H'HƿGHEH@HEH}"HUHEH ^HHu?HEH@HILFnCH HƿxE9Et?HEH@HIL7nIHl Hƿ1HEH u1LۼRH# HƿFHEHu1LXH HƿHUdH+%(tUHHH}HuHUHMLELMHEHEHEHEHE HxHE(HpdH%(HE1HEHEHKHEH}u4LӻoH Hƿ8HUHEHHu4LrH HƿHEHHEHHHUHBHHEH@HHu4L)uHq Hƿ6HEHZIL  wH. HƿHEH@HEH}uCHEHJZILkzH HƿHMHEHH>uCHEHYILkH HƿHHEH H!Ht HEȀHEHEHH!HEHUHEHPXHEHHH臮HUHEH HH襬uCHEH*YIL=kH HƿHUHEH ; HHHEHXILkH] Hƿ"zHEH HH裭tCHEHhXILjH HƿHUHEH ]HHHtbHUHEHHHUHHEHHu4L8HHƿEHUHEH GHH~tqHEHTHUB`HE@`u^HEHiWHUHPIL jHHƿHHE@` HE@`HUHEH HHHEHVHUHPILi HxHƿ=HHMHEHHYHUHBhHEH@hHuPHEHvVHUHPILiHHƿHHEHPpHEH ;BHHuHE`HEPp+HE@pttHE@p HE@pHUHEH 2GHHteHUHEHHEHH3uCHEHUILhHHƿ9HEHHHHUHpHH'u4L~HHƿHEHtOHUHMHEHHKu4L&HnHƿ3HEHvHEH@HH(HHHHEHXHtCHEHLTILgHHƿHEH TILg HHƿfHEH@XHH HEHPXHEHUHXHEH vHEH@HH[HH_ueHEHrSILeg H HƿHEH@XHH HEHPXHEHUH`HUdH+%(tUHSHH}HuHUHMLELMHEHEHEHEHE HxHE(HpdH%(HE1HEH2HEH}tBHEHHUHBHEH@HtHEHHEH}u/LafHHƿ HEHEH@HUHPPHEH@HpH*HEHHEHXHEHHHCHHCHHu/LHVHƿHEH@HEH}u/LeHHƿCHEH@HH HEHHHuWHEHHUHRHRHHPILe HHƿeHHEH@H@PHhHUHRHѺ HHHUHEH ^HHotWHUHEHXHEHH HCHHCHHu/L(HHƿ&HEHHHBtdHUHEH HHdu6HEILd-HHƿNHEH@HUHPXHEHHHĤtaHUHEH HHu3HEILfd5H Hƿ=HEH@HUHP`HEHUHPHEHUHHHD(H}tHUHEHHHUdH+%(tH]UHHH}HuHUHMLELMHEHxHEHpHE HhHE(H`dH%(HE1HEHEHEHxHHEHxH@HxHuHEH~mHEH}uLHEHuHPIL$cZHHƿVHHxHHHբtmHUHxH HHpuLHEHuHqPILbaHHƿH>HxH7HHKHUHxH 7HH\uLHEHuHPIL|biHyHƿ>HHEuLHEHuHPILmbnH"HƿHYHEHuHEHu \HEHHEHHEH}uLHEHuHPIL$bzHHƿVHHEHUHPHE)…HEHpHEHjHEH}HEHHMHuHPRPILaHHƿH HUHEHH%jHEH}uUHEHHMHuHݟRPILMaHrHƿ7H HMHEHHHEH}{HEH@HUHPhHEȋtHEHUHRHpHH~#HEHUHRHHH^#HEHHEtLHEHuHPIL`HHƿWHHEHPHEHHhHEH}uBHEH@HuIL`H+HƿHeHMHEHHHEH}t>HUHMHEHHLt&HEH@HEHEH&H}tHUHEHHHUdH+%(tUHH@H}HuHUHMLELMHEHHE(HHHEH}u>HEHIL_HHƿHEH@HEH}u4LHHƿHEHH HEH?HHKuCHEHGIL!_HfHƿ+[HEH@PHHhHE HHLEH}HMHUHuHEHu MIHHu4LHHƿHEHEȋHHEHHE@xHE@tHEH@X%HzHEHPxHEH :HH莙uCHEHFIL^H%HƿHEHGnHHkuHEHP HEPtpHEHPtHEH nHHuNHEHEIL]HHƿTHEHP HEPtHEHxHEPtHuHEHAuRHEHEIL]HHƿHE@xHEPxHEPtUHHpH}HuHUHMLELMHEHEHEHEHE HEHE(HEHE0HEdH%(HE1HUHMHEHH萙uK}8u;HEIL3HRHƿHEH@HEuH}LMLEHMHUHuHEuuuWLUHAH u1LHHƿHEH@HEHEHuHUdH+%(tUHHĀH}HuHUHMdH%(HE1HEHEHEHHE HEH@HEH}t HEH@ HuH}u4L[)HHƿd HEHHEHHH{HEH}u4LZ.HHƿg HEH@HE;HEH}u/L [7HMHƿ HEH}u/LZ@H Hƿ= HEH@HEHUHEH HHtrHUHEHHHUHBHEH@HuJHEHHUHPILZIHqHƿ6HHUHEH 1HHpt2HUHEHH)HUHHEHHMHUHEH 1HH t2HUHEHHHUHHEHHHEHHhHEHFHHRu=HEHILYmHnHƿ3HEHP(HEH .1HHwu=HEHILzYrHHƿCHMHEкHHpu=HEHILQYxHHƿ{HUHEH HH蹓t]HUHEHHrHUHHEHHu/LXH;HƿoHEH H!Ht HEHEHEHH!HEHUHEHP`HEHHEH a/HHu=HEHILXHHƿ\HEHHEH ^HH蝑u=HEHIL`XH5HƿiHEHHEH HH;u=HEHIL.XHHƿHUHEH -HH֑tnHEH9;HUBPHE@PuPHEHHUHPILWHQHƿHHE@PHUHEH 8HHJHEHHUHPILW HHƿHHMHEHH@HUHBXHEH@XHuJHEHHUHPILhWHmHƿ2HHEHLHEH >HHouHEǀLHMHUHuHEjuuujuL LHH0u=HEHILVHHƿHUHEH S-HH8t_HUHEHHEHHTu=HEHILVH>HƿrHMHUHuHEjuuujuL RL'HH0u=HEHILVVHHƿHMHUHuHEjuuujuL LHH0u=HEHILVHHHƿ |HMHUHuHEjuuujuL L1HH0u=HEHILUHHƿHMHUHuHEjuuujuL LHH0u=HEHILUHRHƿHEHCu:HEHILUHHƿHUHB8HEH@8Hu4Lŗ H HƿwHEHHE HEH@HEH}t HEH@ HuH}u4LPO&HHƿjHEHHEHHwHUHHEHHu4L+HHHƿ HEH@HEHMHEHHHu>HEHIL#O0HHƿJHEHHHEHUHHQHEHUHAHQHEHH0HEHHu>HEHILFR7H[Hƿ HUHEH HHYt\HUHEHHHUHB@HEH@@Hu4L>HHƿKHUHEH 1%HH߈t\HUHEHH蘶HUHBHHEH@HHu4LBHgHƿ,HEHPPHEH "%HHku;HEHIL"QEHHƿtHEH@HUjjjuujL LHѺHH0u*LLHHƿVHUdH+%(tUHH/#]UHHH}HEHƿ0UHH0H}HuHUHEHEHEHH eHHuUHH}HuHEHEHEHHUHHHEHHUHRHPHEHHPHEH]UHHH}HuHUHEHHUHH}HuHEHEHEH@HEHEHHEH@H9tHEH褱IL7+.H~Hƿ!F}8H΢'HEHEH@HLHUHEHHEH@HMHHAЅHEHHMHUHHPIL*7HHƿ胩H}tPHUHEHHEH跰HSIL):HHƿ/H.HEH@HEEH}t8HUHEHHEH$HEHHEHUH'H9HEHEHH9E1HEHe[A\]UHSHxH}HuHUHMDELMHEHEdH%(HE1HEEEHE@P%HEPPH}HELHUHuHEHAЅHEtaHEHRIL=)wH,HƿϧHEH HEH!HHELff}HйHƿsLEH}HMЋUHuHEMIHyHEH}HEH脮ILԹH^HƿHEtaHEHDžHXHHHHHHH@PPHH@PPHH@HHHH@HHH@HcHHRHR(HHRHR(H  ʉHHRHR(HPQALͮHHƿ薛HHH/HH@PPHH@ PPZHH@HHH'H<HHHHHHHHHHHHH9XJALHHƿ蜚HHHHHHDžDž|HH@pHH!'HIйHh<HH@HjILXHDHƿHH@PPHH@ PPHH@HqHHHHF=HHPHHֺHHHHH=HH@XHHH@H@(HH@H@(H % AHH@H@(H%AHH@H9HSAUATIL{H Hƿ識H HHPHH`HhH|WjAAHHuX|tNHH@H葟ILHkHƿ|u;Tu2HH@PHH'HHH@HyHHXHHHH?HHHHHHHH9HXHduwPPALHaHƿHHHtHHHHXHH`HUdH+%(tHe[A\A]]UHH HE EEE}E}E }~EEHH'tD&HEH}u4LLHkHƿH}uA$HEH}u1LfH HƿÕbEHUƿ2Hu'Hn'Hu7EAL$HçHƿfUHHPH}udH%(HE1HEHEE EHEHẼ}yE藓UHPAL[?HHƿ轔HXHEHHEUHQPEPAL=CH̦HƿoH HEUH9HUHEH9HEHEHEHEHEHHEH‹EQRALRHWHƿHHUHEHH¾ܖẼ}ytnu2EALXHHƿ蔓6EALZHHƿbHEdH+%(t苒UHHpHHHdH%(HE1DžHH|HHJu4LzwHHƿ轒$HHHHHu4L3HHƿ]LHHƿ)IHHt-HHHPHHHHHHHH_HHuHH×Hq'Hu8u/LYPHãHƿf[L(HHƿ7HHHH@HHHHUHxHHHUHxHHHEHoHUdH+%(t蕂He[A\]UHHHXdH%(HE1DžpDžlLHCHƿHEH\HEHPHEHDHEH8H{'Hu=u4LjAHԔHƿwHXH轐u4LHHƿ0HXHXuHXHHHH+u[HXHH[tAL> HHƿ萁HXHEH}LHHƿ1HxHxt3HxHUHPHxHEHH蓸HEH6 HUHXHH\HEH}uHEHɆLO-HޒHƿ聀HXHEHxHxHHEHxH@HEHXHLHXHHUHXHAЅHxH蝸HxHEHH臷HEtaHEHIL7HHƿHEHWHEH!HuHEHxHxHHEHxHEH9L >HqHƿHXHEHxNHXHL@HxHPHXHHXHAHxHHxHxHEH9uHEHxNHXHL@HxHPHXHHXHAHxHHxHxHEH9uH}HMHlHuHXIHKu+HUHEHH}HEHaDžt DžtHEHHXHRHXHHUHXAH(HEHEHHv'H9HEH HHEHE%HEH}tHEH+EHHEALHNHƿ|HEIL&HHƿ|tHUHXHH(HEHݶALHHƿ\|HXHHUHXAHHUHEHH诶DžtDžlHXH*HEH%HpHuHXHHEHxHxHHE7HxHQHxHyuHEHxHxHHEHxHEH9uHEHxHxHHE7HxHHxHuHEHxHxHHEHxHEH9uHEHxHxHHE7HxH荳HxHtHEHxHxHHEHxHEH9uHXH9Glt!pulHXH:HUdH+%(tyUHHH $H0HHdH%(HE1HHIpHHH u4L8H&HƿydHHHѺHtCHHLO8HHƿ\yHt HHHHHH HHytHHQHHH cHHxtHHUHt HHH HHHH HHC{HUdH+%(twUHH H}HuHUHp'Hu$HUHuHEAHdUHH0H}HuHUHp'Hu!uvHEHHE;HEH@HtHEH@PHH`p'HHEHHEHEH9EuHUHuHEAHUHH0H}HuHUHo'Huuu HEHHETHEH@HtHEH@PHHo'HHEH@PPHEH@΀PPHEHHEHEH9EuHUHuHEAHUHH@H}HuHUdH%(HE1EHEHHEMHEH@HHEH@PPHEH@PPHEH@PPHEH@΀PPHEHHEHEH9EuHMHUHuHEIȹH7EtHUdH+%(ttUHHH}HEHt$HEPHHJn'HHEHUHHPH}HudH%(HE1HUHuHEAAHѺHnjt\EЅtUEHUHcHH ‹EHH H%H HEHUHEHHyHEH}t HEHHEdH+%(tsUHHPH}HudH%(HE1EHELHHƿ2tHUHEHƿj!ẼHEHHEHEH@(HHEH@(H E?HHku`HE؋@HHE؋@HHH HE؋@HH H%H HEHUHEHHZxHEH}t HEHHEHHEHUHEH9PHEH@HbHHrt)HEHH3HUHEHHEHEHẼu{HƿhHHEpHHa'H}HMHUIHtZHE؉HEHoSuILZtHzHƿdhHHEHH]UHSH(H}HuHUHM蕲t H`'HuCHEHPoILH*zHƿg5HEH蹻HE@P%u|HEHnIL |HyHƿfgHEPHH+`'HxHEHHE@P̀HEPPHEHtHE@HytHE@P̀HEPPHEHJuQHE؉HEH9nSuILHyHƿfHHEpHHi_'H}HMHUIH tiHE؉HEHmSuILHxHƿ5fHHEHHEHtH^'H tfHE؉HEH=mSuIL4HxHƿeHHEHkHEHH]UHH H}HuHUHEpHH5^'HMHUHUHHH}HEPHH^'Hw UHH H}HuHUHUHuHEHUHSH8H}HuHUȉȈEDt H]'HuCHEHkIL*HvHƿ|dKHEHhtmHE؋@P%u]HEHkILxHvvHƿdHE؋PHH\'H+HEHHE؋@HutHE؋@P̀HE؉PPHEHuQHEȉHEH kSuILHuHƿcHNHUHEHHEHH:}u#HE؋pHH\'HMHUH}E(}HE؋pHH['HMHUAH}EEtIHEȉHEHCjSuILHuHƿbHrH['HtIHEȉHEHiSuILHtHƿ]bHHEHHEHHEHH]UHH0H}HudH%(HE1EEHUHMHEHH u/L HtHƿaUE=uE=u EE=uE=u EE=t E=uHEUHPAL(HwsHƿaHEE=t E=uEEUHPAL HsHƿ`HECEUHPALHrHƿy`HEMHE؋pHH0Y'HUH HEdH+%(t_UHHH}HEPHHX'H UHHH}HEHƿ`UHSHdH%(HE1H #HPHHYuUL^tDH #9^HSALftHEtHƿb_HHUdH+%(t^H]UHSHdH%(HE1H #HPHHYuU]tDH#]HSALsHsHƿ^HHUdH+%(t]H]UHSHdH%(HE1Hb#HPHHhXuU\tDH2#\HSALsHrHƿ]HHUdH+%(t$]H]UHHH#H^HHi_HEH}u1LtHdrHƿ]iHEH]t*L3H#rHƿ@]LMrHqHƿ]UHHH#H^HH^HEH}u1LHqHƿ\?HEH]t*LgHWqHƿt\UHSHHD#Hu]HH]HEH}uKH #ZHSALDqHpHƿ[HYHEHH\tDH#xZHSALqHpHƿ[HH]UHSHHq#HTtDH^# ZHSALpHpHƿ2[HH]UHSHH#HStDH#YHSAL`pHoHƿZHH]UHSHH#HCStDH#3YHSALpH?oHƿ\ZHH]UHSH8H}dH%(HE1H#HF[HH[HEH}uCXALo%HnHƿYS]HEHEHOHRHEHPHEIH5 HǸ[HEH]tDHW# XHSALo0HnHƿ3YHHEHYtDH#WHSALn3HmHƿXHHUdH+%(tXH]UHSH(H}؉uԉUЋEԉEHEt >}tMR"t=G"AL_nEHmHƿ;XH#HǸSE}yKH#VHSAL nKHlHƿWHUE։8SE}uE"WE%NtDHr#%VHSALmWH1lHƿNWHH]UHH H}HE"u/L[mdHkHƿV"PRE}t4bUAL#mjHskHƿVi"Mt*LHmH8kHƿUV*"UHHH}"tHEHUHH H}HEHHEHEHHE+HEH蒎HEHOHEHEHEHHEHEH9EuːUHH H}HuHEHHE,HEHPHEHHTuHEHEHHEHEH9EuʸUHH H}HudH%(HE1HEHEH:t HEHLHEHHUHEH ;HAЅu HEHLHEHHUHEH ~uHAЅuqHEu3HEH@(H%=tHEHCt,HUHEHHt HEHuHUdH+%(t_SUHAVAUATSH@H}HuEHE@u HEuHEu Vt6L9H^hHƿ{SEt6L"HhHƿZHHEHHHEH}JHE7HEЋ@P% tqHEHYIHEH@HJHEH@HSSATSALNH#gHƿ@RHEHEHHEHHHcQHELHELHEHdHƿ[OEHe[A\A]A^]UHH`H}HuHUHMLEHEHHEHEHHEHEH@H|HEH}HEHEHEHPHEHHHEH}t{H}t'H=HH>'H<HHHHHDyHƸFBL$H#ZHƿ@EHXDžHHH[HH='H3=HHH='HHHHHH HH(HHtPHH ][HHUHAVAUATSHH $HpHxtdH%(HE1HDžHDžDžϦDžDžHx@u HxuHxu b u Uttu =tALUHpSHƿ>Hq"H?HH'@HHuDžAHgu HH3HY7HxHPHIH5sHǸ.@t#HHH$UH?8?HHH UHR?HH2H6HxHPHIH5THǸ?HH5THǸf?HHxHHHuHlHHHTHHϸ?HH6HHxHHHuHHHHLTHHϸ>HHJ6HxHH THHǸv>HxHdHHxtDHxHHu1Ht'HHH SHHǸ=#HHHSHZ=AHHDžHxt"HHxHHÌHMHHxHHuXH@P%HH@BIL{HOHƿ:HHAHHHH HHs4HHΉ}RH@P%iH@P%tAHHwAILHNHƿ9HHHHHaHHtHHH HDžHtHHC"t HDžHHuHHH@(H1AHH@(H:AHLHHh@HHHSEELH5HǸ);HHHxHHZ?HHGHH5PHǸ:HH>HHLI8H}FHƿ1HEHEu &t4LIFHFHƿ71rt~LIPHEHƿ0uu #HEH u HEuuLI_HVEHƿs0u HEHu HEmHEHVu4LHpHDHƿ/HUHMHEHHuLLiHxHxDHƿ/HEHoHEH>HEH(EątzLHHDHƿ6/HEHHEHNTHEHLu ?HE+HEHgtbLGHCHƿ.HEHu HEHUHMHEHHHUH}HMHuHEIHH]HuH)HEHvhAHEHghSATALiHBHƿ-HHUHEHH^hHEH'HUdH+%(t,He[A\]UH{i]UHfi]UHHH $H0HHHdH%(HE1HHFHHl,HHPHIH6'HHEHǸHHHPL }6'LF2HEHƿ,HHHIH-6'HH|EHǸ6yFHL 5'L7H&EHƿ,HQHHmu1L<HDHƿ+HUdH+%(t*UHH0H}HuUHEHpHEHHPHEHHPHEHHP HEHEHSHEHEHH4'Hu8HEIL߻QHCHƿ*s@H4'HCHz4'H,E~C}u1HG4'H+u)uUH:D'u]UHHD'EC't;D'C'HC'Ht HC'Ѓ}t>UHHH}uHEHBHH)tXEuC'C'C'yC'Eu hC'\C'u RC'UHH0H}uUME}uH<H'HtEHEH7_B'EB'EB'E܉B'5B'HEȋB'B'=B'VQRPAL߹HAHƿ(H UHEHH7B'Hu[}tLHbAHƸ1(*B'}u}t UHHH}A't3HEHEHA'UHH0H}HuUEE܉^{LRA'UHuHEHAЉE}tUHEHq*LHa@Hƿ+'EUHH@HHHdH%(HE1HH?HH&HHit @'uHHHHu>HIL,Hd?Hƿ.&`?'@'tL@'u ?'t8H h?'tF?'u<CLH>Hƿu%wa?'W?'H t/LfH>>Hƿ%LH>Hƿ$Ht8u/LH=Hƿ$HHHHtj t t HHuHH9t%uHHHUdH+%(t"UHH0H}HuUHEHHEHEHPHEHHHEH@H΁IL<8Ha<Hƿ+#HEH@HEYHEHEHEHPHEHH谰u*L=H<Hƿ"HEH@HEHEH;EuHEHHEHEH9EUHt<']UHHH}HEHH}HEH UHH0H}HuU܉ME}tM }tMHEHo;HHQ!MHEt4L%;gH:Hƿ!)UHEH5:HpE}HEHEHOHH uCHEt MUHEH5:HEHEHrHHK u6HEH59HEHE8HEIL[{H9Hƿ EUHHH}HuHuHEH UHHH}HuHEt!HEH9HHhuHuHEHUHHH}HuHuHEHwUHHH}HuHUHEHHu9HUHEHH譁 uHEHqHHUHHH}HuHUHEHHu#HUHEHH@ uUHH H}uHEE}]EǸuS EǸE}~FEuHdt HHxHRHKRPL ;LH0Hƿ>H HMHUHEH5HǸ8t6L LH0HƿHUuHMHEHRAIHHW/H¾H/'HǸ肵Hy3LnH0Hƿh/'H{/'HEEH}t\HEHtLPHPL L H/HƿHH.H>HEH}tpHEH>'H =pHHǸt'H>'}t HHiHUHHH;.'H4.'HuqHHEt H%HHMHRHRPILHg.HƿH ='HEdH+%(tUHH }-'H4-HHEH}HE<>uHEHH9EHEH9EH>-'H toH-'t HH޺HRH:RPL ,'L4HR-HƿH ,'UH}E<']UHH}u}u <':H3,HHu%E¾HH G<'UH}Q<'EEE<'E]UH<'H+'Hyt}rt@g^ HH<'Hu H8H"HH +HHǸ2HU<'Hu H H"HHHp+Ht;']UH_;'t L;']UHHH}H}tHEHHH"HoUH}E;']UH}E ;']UHH} ;'H;'Ht3H;'Hr H:'H:'H:'H:'E:'UH:']UHH:'HuH/]UHHHHEHHEUHH:'HtH:'H=H:']UH}u}u}u HEHHH"H]UH}EHH"H]UH}EHH"H]UH}E9']UH}Eu9']UH}Eb9']UHHpH}udH%(HE1HEHƿHUHEHHHEHcHUHEHH(H8E}t`HMHS㥛 HHHHH?H)‹E+EHMHcHMH<HH~(HƸ%E}yHEHEdH+%(tP UHAWAVAUATSHH $HH LLdH%(HE1HDžHDžHDžHDžHDž@%0%4%8Dž H1HHDž$E"yUHI'Hh HPHPt+D"HPH HH$ 7' D"D"t 7'uD"uJ6't@HH &HHuDž 6'Dž VHHX t6'u q6'Hb6'HuGc6't ~4Hk6'Ht8u0u~ 4HHHHVHHQHFHAHHXHH <<y7H26'Hu HA"HH4HH t5'`SH5'H=@HHH`H_5'H`HHPHB5'H9rgH>5'H`HHHH5'H5'H5'HH HhHhtHhH4'H4'H4'H4'HH4'H`HHPH4'H9sqH4'HtH 4'H4'HPH4'H H`HPH `4'Hi4'HHHH HM4'H`HH<4'4tqH4'Huu'6H4'H4'HtHH{4'HHH^:Ht DžHQ4'HHHg:H3'H/8"0u  H3'HpH~3'D-W3'L%3'H3'Hz3'HH=d3'HS3'IINj?3'IƋ0։HHpHjAUHRATSLLLLHiH0u4H 3'Hu H>"HHH"H Dž$HpH2'H\2'Ht@L P2'HHIȹAу o2'*Dž(1't Dž(1't Dž((w_HHHHH>Dž,:Dž,.Dž,"Dž,Dž, Dž,HHHHVHHQHFHAHHX,IIH~HH!H5!$R9u0'gR?HHsy0't o0't(uH Hƅ:0't 00'tPH@ HDž@ 0't 0't^H@HuHHHHHQIIHH H¾=HH@HuH4HHIHHH¾DHH4OHHHHHǸ认.'tVt=Et t1HPHH!H>HHH,HHHHHHVHHQHFHAuQO3 O!O9u!HHHHB0u tH.'Hu$HU:"HHy.'Hu HM:"HHxHi.'Hu H:"HH;xuH:.'Hu H:"HHHHHHxIH $;"H5HǸpHHXHxHHHxHƿ N9~# PNu j,','u ,'t ,'t(uH HPƅ,'t ,'ttLH@ HDž@h,'t ^,'t^H@HuHH='DHHHH 9"QEIHHrHƸH?H@HuHH='HLi9"HH:HƸHHHHVHHQHFHAHO'HHXHHHO+'HthHK+'HH@+'H9+'H*+'H9rCH5+'H'HIL8"H5aHǸDž H'Hƿ vH'H7*'tU*'u }uBHHHHVHHQHFHAHHXHΉ t HEdH+%(tRHe[A\A]A^A_]UHH,H (LLxt )E)M)U)])e)m)u)}dH%(HH1Dž0(Dž40HEH8HPH@L0H(H ,MI(HHdH+%(t^UHHH LLxt )E)M)U)])e)m)u)}dH%(HH1Hi)'Hu H=5"HH(%uu HE)'Hu H4"HH)'Dž0(Dž40HEH8HPH@L0H HMIH(H('HHdH+%(tUHSH}HEH .('H/('HHXH )('H*('HHHXH #('H$('HH HX(HEH]UHHEHUH''H''HE HU(H''H''HE0HU8H''H'']UHH}HEH'']UH}Ew'']UH}Ed'']UHH}HuHEHZ''HEHW'']UHH}HuHEH!''HEH'']UHH H}HuHU&'tjHUHjjH3PuH4PuH7PL IHHH HHHHHǸH@UHHH}HEHHH[uqHEHDHH:uPHEHKHHu/LHHƿQUH}}t&}w)}t}t HHH]UHH H}HE苀LHEH}uHHEH@H=YIL4HHƿHoHEHEUHH H}HEHEH@H@H t$HEHH@XH4t HEHEOHEH@H@Ht HEHE.HEH@H@H tHEHHzHEH}tHELu HơHELnUHHH}HuHEHsHHuHEHEH?HHu HE^HEH HHu HE8HEILmWHEHƿUHH@H}HuHUdH%(HE1E?HEH UHEHH]Hu+HEH HEغ=HH9HtE=HUЋMHE؉H HEH}u1LoHrHƿ)!HUHEHHYuEHUdH+%(t0UHH H}uHEH@H@PHHEHEH@H@Ht}u 4HEH@H@H t'HEHH@XH4t HEHEHEH@H@Ht HEHEtHEH@H@H tHEHH,wHEDHEH@HuUILȍHHƿa}tHEU䉐LGHELt2HEHPHEH@HHhHEHHHULUHH H}HEHH@HEHEH@XH tHHEHH6vLu*L H3HƿUHH}؉uHE,HE@MHEغHHEHEHEHHEHHH HEHE]UHATSHĀH}HuUHMDEDMHEHEHEHEHE HEHE(HxdH%(HE1HE‹EHHEUEHHEHUHEHH:cHEHUHEHHHuH?HHEHxaHUHECH"HxHxuEHUHEHHbHxHEȃ¸ )кHHHEHxH;EHxHEHHUHHUHEHH~UI?tuSMLUHHƸHHEȉHxHxHEHHUILHHƿmHxH;EHUHEHHTIHUHEHHTHHxHEHH{THuATSILHHƿH LH HƿHxHEHu4LLH HƿYHxUEHH9sbHxHEHHSHUHR(HPILH* HƿHHxMEHHHEUHEHH]HH‹EHHEHEHuHEHEH}HMHUuHEHuIIȹHuHu1L Hd HƿPHE‹EHHEHHdRILH HƿHUdH+%(tHe[A\]UHATSH@H}uHEH@PHEHEHPhHEHHH^HEHEHUHhHEHEHMHHEEHEH5pHHH;EHEHpHHHEHHHHQIHEHANHËUHEHHH!QATSIL"H HƿHHEHHUHHPIċUHEHHHPHHEHMATSIL`&H[ HƿHEHEH9E3HEHHEH@PHHHFPIHEH?MHËUHEHHHPATSIL.H HƿHHEIL22H HƿLHEHHuHHEHHHOHËEHEHHEHHHqOHSIL4H HƿHEEHe[A\]UHSH(H}HEH@XHtCHEHLILGHHƿ]HEHHW&u|HEHHEH}tHEH@HKHHHEHtKHSILNHHƿHH]UHSHH}HEH@XHtCHEHJILOZHHƿYHEHmujHEH@XH@H!HuPHEH@XHxCHEHJILcH(Hƿ/HEH@XHH!HHEH@XHH!HHEH@XH$u{HEH@XH'uhHEH@XHtHEHHuEHEH>hu5HEHmu%HEH@XHtrHEH@X% Hu`HEHuIHHEHkHrHSILԅrHHƿHH]UHATSH H}؉uE@E EE;ErE9EswUHEHHKIċUHEHHKHËUHEHHKATSILgHBHƿHEE#EԅtdUHEHH=KHËUHEHH(KHSIL.HHƿHEEHe[A\]UHHHHH@dH%(HE1HHH@PHHXH@HPHHHYtHPHJu4LŧHHƿHPH@XH%uHPH@XHt!HPHhHH@HPHXHHHcH`H`u4LHpHƿ'HPHXHHHHIHu4LH HƿHPHgHhHhH`HPHHHhAHru4L1HHƿ>%HHH@XH-HHHPHHpHHHǸԆyFHHHOEILHHƿHpHHHXH9u1LEHHƿRUHSHHH}HudH%(HE1HEHHEHEHeHEEHE} ;HEHCIL$HHƿOHE؋`tHHEǀ`HEH4u*LHBHƿNHUHEHHru4LHHƿHEH@tRHEHH裼HEHBILLHHƿFHEH@HHHHnEHEH@H@(HEHEH@H@hEHEHHH}u}n}dHEH.BH~/tHEHSILHHƸoH}HEH@X%Hu9HEHAILtH_HƿHEǀ`HEH2u4LHHƿ#HEH@PHH.HEHAIL HHƿp}HEHKu1LHeHƿtHEH@PHHu@HEHh@IL~HHƿHEǀ`HEHUdH+%(tH]UHH`H}dH%(HE1HEHsaHEHEH@XHH!HuCHEH?IL#~;HNHƿHEH@XH2t>HEHR?IL}AHHƿ<HEH@PHHuAAH11HEHku4L.JHHƿ;JHEHH@XH-tHEHH`L HELE}t }HEHH@HEHEHVtu4LTHHƿHUHEHH;u4L:VHHƿGVHEHu4LXHLHƿHEH@XHH HEHPXHEH@PHHUHHgktHEH uCHEH=IL{_HHƿkzHEH@XHH!HEHPXHUHEHH8u4LvHLHƿHEHHEHEHtru4LzHHƿHEHH@HEHEHHUHEHH9u4L9HHƿFUHEH@HEHEH0HEHEH8HEHEH HEHEH ]HEHEH@PHH HHXHUHBHEH@Hu4LHHƿHEHu4L>HHƿKZHUHEAH8u4LH<HƿHEHEȉHEHHEHHEH@XHH HEHPXHEHUH0HEH0HtqHEHUH HEHUH@HEHUH8HEH@XHH HEHPXHEǀLHE@T HEǀHHuHEAH"fu4LH HƿHEH_*u4LsHHƿHEHEHEHnu1L'H}Hƿ4FHEHu1LH<HƿHUdH+%(tUHH H}HEHHuHEHHvmHEH-HEH}tQHEH@H@XH0t:HEH@H@XHH!HuHEHH@H9EuUHH0H}dH%(HE1HEHHH0THEEHEH}t3HEH@ H@XHt"HEH@ HHXHUHEؾHхu6L vHHƿrHEt HHEHEt HԣHE1LuHWHƿ5HEILu HHƿHEHUdH+%(tUHH0H}dH%(HE1HEHHHRHEEH}t3HEH@ H@XHt"HEH@ HHXHUHEؾHхu9EEALIuHTHƿ IEtEEALFu H HƿEHUdH+%(tUHH`H}HuHUHEHEHEEHEH@H@hHEHEH@H@HtH}uH}u HEH@H@H t'HEHH@XH4t HEHEHEH@H@Ht HEHEwHEH@H@H tHEHHUHEGHEH@H4ILtHHƿe?H}trHEH@H@PH@HUHHbHUHPHEHPH-Ls H5HƿHEHPHHEH@H@PHHU@H>HUHPHEHPHufHEH@H@PHH^HUHPHEHPHu4L*'HHƿ7HEHPHu4L!s)H<HƿH}HEHXHKHEH}u/L1HHƿ3KHEH}u/LD3HHƿQHEHHEHHEHXHEHHEHUHPHEH趏HEH}u/Lґ8H(HƿH}t HEHHEHHHH?HEH}HEH@H@PH@HMкHH赈HUHXHEHXHtL(=H~Hƿ5HEHXHHEH@H@PHHUAHwHEH}HEH@HEHEH@HHEH@ HHEHPHEHHHHEH@H@PH@HMкHH訇HUHXHEHXHu4LLHuHƿ,HEHXHVH HEH@HEH}HEHXHtHEHXH@HEYHEH@ u>HEH@ H@H,HHuHEHXHUHHHEH@HEH}uEH}t HEHEIH}t HEH2IH}t HEHIEUHH H}uHEH@H@hHEHEH@H@H tHEHHOHEnHEH@H@Ht}uQHEH@H.ILnHHƿcHEHPHu}uHEHHP}u;HE苀Ht OHEH@H@PHHU>H^E}tjHEH@H@PHHE}uEEBE;Et:EALmHHƿ}t-}uNHEH@HPXHEH@HH HPXwHEH@HPXHEH@HH!HPXPHEH@H,UHPALmH*HƿHHEU䉐HUHSHHxHpHhH`D\DXHpH@PH@HEHpH@hHEHpHnMHEHEHH@HEHEHEHEHEXu DžXXu4LH#Hƿ= }u HpHMHxHHEHEUL\u'HpHPhHxCH\\uHUHxHHo:\\HxHu4LHLHƿfHhH@PE}u4Lk HHƿEEEHhHU҉H9sPEHxHH,IL\kHHƿ>H`iH`HEEH;Es]EHEHUHxHHc,HtILkHHƸEH9Es]EHEHUHxHH+HUtILj"HHƸO]HEHHHHtxM]HEHHHHH)HEHUHxHHk+HtILnj(HHƸH}HhH\HHEHhHHH;EsHhHHHEEH9EsEHE]HEHHHHt"M]HEHHHHH)HEHhHH+EHEHUHxHH$7HE\HEغHH9EssHUu\PILi@HHƿHLiBHHƿgH}uHUHx@HHEH}uHxHHEH}u4LmiSH8HƿRHUHEHHHEH}u4LXHHƿH} HE HHHHuHEH}VHMHEHH}HEH}/LeHXHƿrHUHxAHhHEH}HEH@HEHEH@HHEH@ HHEHHUHHumHMHEHH|HEH}u4L7sHHƿDHEHuH HEH@HEH}?H}t HEH@HERHEH@ u7HEH@ H@H[HHuHUHEHHHEH@HEH}uHhH#HHpH#uuuSILfHHƿ=H HpH#HH\PuЋXPILfH.HƿH HEH@XH t0}u*L[HHƿHpH@XH&tTLfHHƿ^LfH}Hƿ4HE\PTHEHǀHEHUH HEHUH(HEHUH0HEXHHEHUHPHEHUHXHEHǀ8HEH8HEH@H]UHATSH@H}؉uԉUЉMLELMHEH@H@PHHEUHE؉HZu4L H`HƿHUHMHEHHOu4LHHƿUHE؉Hu4LrHHƿaHEH@H@H tHEHHbBHEHE}tsHEH@H@H tMHEH@UԉHhu4LԀH*HƿHEUԉPTHEH@H@H HEH@HPhHECHEԃ}EHEH@UԉHu4L1HHƿ> HE@T9EttUHEHH"IHEH@HyHHE@THEHHV"ATSILcHHƿHHEUԉPTlHEH@H@HtUHE@TuJHEH@Hy`u1L6HHƿC(HEH@H@H t HEHHe[A\]UHH@H}HEH@XH-tHEHHtHEH@XH4tCHEH)ILbHHƿ膿HEH@XHH HEHPXHEH@PHHUHHKuCHEHILnbHQHƿ HEH@XHH!HEHPXf)E)EEHuH HHEHUHHQHEHUHAHQH3H E܃}u9HEHILaHHƿVHEH@PHHUHHKu@HEHILaHHHƿEEUHH H}HEH@X%Ht HEHHuHEHHvmHEH3HEH}tQHEH@H@XHt:HEH@H@XHH!HuHEHH@H9EuUHH}HEHHEuHEH@Ht\HEH@H@HtKHEH@HhHt7HEH@H@H@XHtHEH@HhH9Eu(HEHHEHUHEHH9t]UHHHhH`HXdH%(HE1HpHkEH`H)<HEHH0HEHEHu4L_JHHƿûH`H;HHpHhAHuAH`HIL\_OHQHƿFEuAH`HILD_TH HƿEtJH`HXUHPAL_YHHƿ譺H]HEHHXHHEHPHXHPHEHPHXHPHEHPHXHPHEHuHEHbHUdH+%(thUHHPH}HuHUdH%(HE1f)E)EHUHMHEHHeu1LxrHHƿ諹HEЉHEHUdH+%(t¸UHHPH}HuHUdH%(HE1f)E)EHUHMHEHHu2H}tHUHEH)HEHHUHEH9uHUdH+%(t%UHHHHH@dH%(HE1H@H@PHXH@HHHHpHHct*HpHeHH&H`H`uAH@HIL\H!HƿH`HpHXHH6taHpHXH5HxHu:H@H@HIL\\HHƿ膷lHXH@HpHH蔗HhHhu,LvH7Hƿ,H@HhHPHHEdH+%(tGUHHPH}udH%(HE1HEH@PHHEHEH@PHEHEH6HEEHEH@H@HH!HuCHEHILe[HbHƿWHEHhHEH}uCHEHIL4[H HƿHEHH@HEH}uCHEHDIL[HHƿ衵8}HEH@XHH HEHPXHUHEHH BuCHEHILZH+Hƿ HEH臒LZHHƿشHUHEHHwBu9HEH+ILHHƿ舴HEHAHHHEHIL-ZH2Hƿ'HUHEHHAu9HEHzILHHƿ׳nHUHMHEHHHEHILYHHƿuHUHEHHAu9HEHILdH0Hƿ%E̅HEHzUHPAL-YHHƿϲHHUHEHHj@u9HEHILHHƿ{HUHEHH@uCHEHILXH,Hƿ!HEH@XHH!HEHPXHUHEHH7u4LpHHƿ趱MHEH@XHH!HEHPXHEHǀhHUHEHH u4L2pHJHƿ?HEHu4LoHHƿHEHHEH@XHH!HEHPXHUHEHHHEHrtHEHu1L^o HvHƿkHUdH+%(t莯UHHPH}udH%(HE1HEH@PHHEHEH@PHEHEH0HEEHEH@H@HH!HuCHEHAILTHHƿ螯HEHhHEH}uCHEH IL{THPHƿEiHEHH@HEH}uCHEH ILNT#HHƿ }u]HEHHHGuFHEH( ILKU+HHƿ腮HUHEHH跷u4L4U1HAHƿ6ZHEH@XHH!HEHPXHEHǀhHUHEHH u4LT9HHƿ迭HEHou4LTEHHƿ{HEHHEH}u4LTOH;Hƿ0THEH ILTXHHƿHUHEHH:u@LT[HHƿ謬HEH]~LT`HwHƿlHUHMHEHH2uCHEH ILFRcH#Hƿ<EątOHEHq UHPAL$RhHHƿƫHHEH |u4LSmHHƿ~HEH ILSvHFHƿ;HUHEHH9u4LSyHHƿHEHZ ILS}HHƿ跪HUHEHHV8u*LlSHHƿvHEH@XH HHEHPXHEHILZSH/Hƿ$HUHEȾHru*L7SHHƿHEHKILHHƿ訩HEHu4LSHyHƿnHEH`HEH@XHH!HEHPXHUHEHHHHEHmktHEHkyu1LRHHƿިHUdH+%(tUHHH}uHEHtUHEH?UHEHsUHH H}HEHn(HEHEǀHEʀHEHTHEH@PH^jtHEH@PHXxu4LPHHƿ˧HEHGHH0HEH ILxQHuHƿj^HEH@PHitHEH@PHwu1LHHƿUHHHXHPHHH@L8dH%(HE1HHtpHHHXHpIHH HǸlFLEeH]HƿR]HPHXHpIHHHǸEy4LdHHƿHpHddHcH8HHHhHhu1LadHyHƿn|dHcHpHhHH(HhH@H8HHu1LcHHƿHUdH+%(tUHH0H}HuHUEHE@Ht4HEHHMHUIHѺHHkHxuEHE@Ht5HEH@HMHUIHѺHHjH4uEHE@Ht5HEH@HMHUIHѺHHjHuEHE@Ht5HEH@HMHUIHѺHHjHuEHE@Ht5HEH@ HMHUIHѺHHMjHhuEHE@H t3HE@(HUHEIHHH&uEHE@H@t3HE@,HUHEIHHyHuEHE@Ht>HE@0t3HE@0HUHEIHH3HuEHE@It3HE@4HUHEIHHJiHUuEHEH@8Ht=HEH@@Ht0HEHP@HEH@8HuHMIH uE}t*LLHHƿ֡UHH}HEHHEoHEH@HtVHEH@H@HtEHEH@H@XHt4HEH@H@H@XHtHEH@H@XH9Eu(HEHHEHUHEHH9z]UHH}HEHH5^I HHHHHEH} w HE@FH}@w HE2HH;Er HEHH;EsHEHUHEH]UHSHHxHpHhH`dH%(HE1HDžHDžHDžHDžHDžHDžHDžHDžHDžHDžHDžHDžHDžHDžHDžHDžH 8HHDž0Dž4DžTddHpHHhDžHpHHHDžDž(HhH@PHtfHhHPPHHHoHǸ>y4LImHJHƿ語9HHpHhHHHhHpHH HHHHHH HHpHHHHxHHYHtHHSIL0HyH:HƸ蟝HH HHHpHHT4HHHHHu4L \H͹Hƿ-H HpHH^HHu1LGHoHƿϜaHHHv1LrGH$Hƿ脜H`HHHUdH+%(t薛H]UHHHXHPdH%(HE1HXH@PHHxHXH@PHEHXH@XHH!Hu4LZHVHƿ趛[HXHHEHxHj2HHHEH}u4L>ZHHƿKHE@LlDžhHEHhHHHHHH@HEHEHHEHEHHEH}uFHXH=ILEH:Hƿ蚚?HEHH@HEH}uFHXHILEHڶHƿ:HEHH HEHEHHEHEH HEHEHEȺHpHEHHEHEHEкHtp9tr:HEH@HILDHHƿsHEHHxH@HUHMHHjuCHEHILDHHƿHEHEHEH`p+tHuHEjQuRAAHJH u>HHƿUHHH $HPHHHDDdH%(HE1Džt8t/L=MHHƿVH@ tsH@ =tbH@ =tQH@ =t@H@ =t/Ls=THuHƿՏt[H@ tMH@ =wHHƿHPH@HIL 1HzHƿ~HPH(HHѺHIHhHhu/Lm=HHƿz~PHPH@XH HHPHPXHPH^HXHXH`HPHHpHpH@XH HHpHPXHpH|HPHHXHHXHpHHXǀHXHH@HHgHXHH8H8u H8JH8@uH8@H8@ uH8@ H8H@HuH8HHP;1HH@HIL /H=Hƿ|HH?u/LEHHƿ`|6DžHH@HIL.HHƿ|H0HV>tH0HQLu/L:HdHƿ{DžHH@HILK.HHƿ}{HH(HHu/L<.H֗Hƿ6{ HH@HIL/.HHƿzDž]HHHHHHHHH@HPHPHHXHXǀ;rH0H<tH0HJu,L%9HҖHƿ2z LHHƿytvDžaHHtFHHu-L,H/Hƿy?vH0H;tH0HIu*L, H̕Hƿ,yHUdH+%(tVxUHH@H}HEH@PHEHEH@XHH!HuAHEH@X%Hu/L=, H?HƿxHEHHEHEH@H@H t_EHHEHUHHHHHH@HEHEHOHEHEǀEHE@L9Er%HEH@H@H%tHEǀHEH4:tHEH2Hu9HEH9IL\+1H6HƿwUHH0H}EHEH@XHH!HuHEH@X%Hu HEHRHEHEH@H@H EpHEHUHHHHHH@HEHEHHEHEH@H@H H!HtHEt EEHE@L9Er$HEH@H@H%t HE苀EEUHH0H}HEH@XHH!Hu HEHCHEEXHEHUHHHHHH@HEHEHHEHEH@H@H%tEHE@L9ErUHH0H}HuHEH@XHH!Hu4LO4pHHƿ\uHEH]HEEjHEHUHHHHHH@HEHEHHEHEH@H@H%tHEHHEHEHE@L9ErUHH`H}HuHUdH%(HE1HEEHEH@XHH!Hu HEHmHEEHEHUHHHHHH@HEHEH+HEHEH@H@H H!Ht1HEHUHMHEHHZuEHEHEEHE@L9EfHEHUH}tHUdH+%(trUHHHhH`HXdH%(HE1H`H@XH t8H`Ht%HXH`HhHHAH`H@X%Hu4L1HYHƿrHpHhEH`HHEH[HIHEHEHu4LHюHƿ1rH`H/HHpHhAHpu>H`HWILHTHƿq~EtvEtJH`H UHPALHHƿ_qH%HEHHXHHEH`IHEHLIHUdH+%(tRpUH}}t }t]UHH}HEHHtHEHt]UHHH}Hu|xDtdH%(HE1HEEEEHEHEHHEH}u/L$4HHƿpxtHEH@H@%HHEH@H@HHEHHHEH@H@XH!HEH@H@XH"Emxt"HEHUHHHHHȋ HEHUHHHHHȋt xt$HEHUHHHHHH@"HEHUHHHHHH@HExt*HEHUHHHHHH@(HEHUHHHHHH@EHEH(EHEH@HHExt#HEHUHHHHHȋ@ExHEHUHHHHHH@H@H@@HuHEHEHUHHHHHH@@EHE@PEJHHEEE/Lw!RHRHƿImQHEH+gHE}uttHE|tgUEЍHUHEAȉH  HǸ L !_HHƿlUHEЉH HǸv y/L eHiHƿ`lhHEHBfHEHEHUHEHHKMHEH}u/L nHHƿk}utt H;H}utt HHLEHuH}HHMQIHHLH¸t Hy,LP xHcHƿZkeHUHMHEHHu-L9 }HHƿkEHE@L9EHEHUHEHHBEHUdH+%(t jUHHH}HuHuHEAHUHH H}HuHUHEHHHEH}u1L&)H<Hƿ3jHMHEHHHHJUHHH}HuHuHEAH+UHH H}HuHUHEHHHEH}u1Lq(HHƿ~iHMHEHGHHUHHH}HuHuHEAHvUHH H}HuHUHEHHHEH}u1L'H҅HƿhHMHEHHHUHHH}HuHEH@H@PHHuHEAйHUHH H}HuHUHEHHHEH}u1L&HHƿg)HEH@H@PHHGHMHEHHUHHH}HuHEH@H@PHHuHEAйHUHH H}HuHUHEHHHEH}u1L &H!Hƿg)HEH@H@PHHGHMHEHH UHHH}HEHHEH@H@PH@HHeUHHH}HuHEHHHEHHFUHHH}HuHEH@H@XH%t%HEHHEHHYFBHEH@HILCHHƿeUHH0H}HuH HEHEЋ@HHEH@P@4t"w&tt ETEKEBHEH@P@4ALHMHƿDeEHE+HEЋ@HuHEH@PH@hHt HHEHUHEHHEHEH}u1LHHƿdHEUHHHXHPdH%(HE1HDžhHpHHHPH@H@XH H!Hu .HHS;HEHEHu4L"HHƿcHPH@H@PHHpHPAH%|ppu,Lb"HxHƿocWHpHXHHnHhHhu,L "H"HƿcHEH.;HhHUdH+%(t2bUHH H}HuHEHgHEH}u1L!$HHƿbHUHEHHBUHH`H}HudH%(HE1HM HEEEHEHEHEH@H"tiHEH@Ht6HEHpHEH@H@PHH@HHѺH}tHEH@HH@HHE۬%HEH@H@ HHEH@H@ H@pHHEH@HHEH@H@%HtHEH@0% HtH_~HEHEHpHEH@H@PHHUAAHѺHxtlEЅteHEH@H@ L@pHUHMHEHHAЅt1Et H!HE(Et H}H}HE H}HEHUHEHH@HUdH+%(t_UHH H}HEH@H9tHEH@HW@THEHEH@H@H t)HEHH@XH4tHE@THEaHEH@H@%HHtHE@THE}t EHEH@H@Hu EuHEH@HPHEH@H@H9u ELHEH@HPHEH@H@HHuE!HEH@uHEH@t E}tF}uhHEH@H@ Ht%HEH@HP HEH@H@(HH2uESHEH@HPHEH@H@HHuE+HEH@HP0HEH@H@ HHtEJE}t E3HEH@HPHEH@H@H)HUHEH@HPHEHHtE}u,HEH@HPHEH@H@HHQtE̐EHEH@@t EHEH@@t EuHEH@@t(HEH@HHEH@H@H9u E:HEH@HPHEH@HHHsEHEH@@8uHEH@@8t E}u+HEH@HPHEH@H@HH>sEHEH@HP HEH@H@HHsEHEH@@u}t E]HEH@@HEHEHH@THEHEH@HHEHHHuHHEHHEHEH@HH9Er"HEH@HHUHHarEHEH@H@PHHUHHIHEH@HHEH@H@PHHH躻HHEH@H诸ATSIL'HwHƿ ZHE:HEH@@H@H@H*t HEЋ@8EHEЋ@@EEEHe[A\]UHH@H}dH%(HE1HEH@PHHUHuAAHѺHqtEЅuEHUdH+%(tXUHH@H}HuHEH@HEHEHHEH}tHEHHu4LHuHƿX6HEt "HEHHEEHEHUHHHHHȋHEHUHHHHHH@H@HEHUHEHH_:tHEHEH@@HtUHH@H}dH%(HE1HEHEH]u )HEH@XHH!Hu?HEH@HIL\H[Hƿ>HEHҾHEH}tHEH@HLIHEH}u?HEH@HILdHi[Hƿ`>_HEH@H@%HuTHEH@HHUHRHRHHPILXiH[Hƿ=HE,HEHUHHHHHH@H9EtEHE@L9ErHE@L9EuUHH H}HEHtHEH(HTHEH@XH%uHE苀HEHeHEHHEmHEH@H@HetJHEHށILeAjHD@Hƿ;#HEH@H@HEHHEHUHEHH9uHEHEH@XH"uHEH@XH!tHEH謣t HEBHEH@XH t HE&HEHHEHEH@XH$tFHEH@H@H@XH$t+HEHqHHEH@HH9HEH@H@H@XH2utHEH@H@H@XH-t@HEH@H@H@XH H!Ht:HEH@H@HHZuHEH@H@H-HEHHEHUHEHH9HEUHH}HEH@hHt HEH@h HEH@PH@X]UHH}EHEHHEIHEH@H@HuF}tHE@L9Et-HE@LEHEHHEHUHEHH9u]UH}}t }t]UHH@H}HuHUHMLEEHEH@XHtoHA!HMHEHHt"H!HMHEHHޓLH?Hƿ HEH@XHH!HMHEHHvtH-!HMHEHHXu/LtH>HƿRHEH@XHH9!HMHEHHL H->HƿHEH@XH thHU!HMHEHH萒tH!HMHEHHru3LH=HƿoE}uHEVHO!HMHEHH u,L&HG=Hƿ3UHH@H}HuHUHMLEEHEH@XH"toH!HMHEHHxt"H'!HMHEHHZ6LrH<HƿHEH@XH!toHC!HMHEHHt"H!HMHEHHؐLH<HƿHEH@XH tkH9!HMHEHHttH!HMHEHHVu6Lr H;HƿE}uHEH5!HMHEHHu/LH%;Hƿ/HEHH@HEHEH@HtQH!HMHEHHtLH:HƿHEH@HtQH-!HMHEHH{L(HI:Hƿ5SHEH@HtQH!HMHEHH謎L"H9HƿHEH@HtQHu!HMHEHHHL`%H9HƿmHEH@%HH!HMHEHHu/L(H9Hƿ (HEH@HtQH!HMHEHH聍L,H8HƿHEH@HtQHj!HMHEHHL5/HV8HƿB`HEH@HtQH!HMHEHH蹌$L2H7HƿHEH@HH!HMHEHHQLi5H7HƿvHEH@HH!HoHG!HMHEHHu/L9H7Hƿ )HEH@HtQH!HMHEHH肋L=H6HƿHEH@HtNH!HMHEHHL6@HW6HƿCdHEH@HtJH:!HMHEHH轊u,LCH5HƿUHH@H}HuHUHMLEdH%(HE1EHEH@XH'Hm!HMHEHHt@H!HMHEHHt"H!HMHEHH܉LZH5HƿHEH@XH&H!HMHEHHttH$HƿUHH@H}HuHUHMdH%(HE1EHEHHEHHEHHEHwHUHHEHHu4LOH2$HƿHEH^wHUHHEHHu/LqTH#HƿHEHΓtqHZ!HEHHEHHBxt!HQ!HEHHEHH!xu/L=[H^#HƿJ+HEH@XHH!HuHEH@XH tXHEHHEHH}HuHEIHLu/LaH"HƿHEH@XHH!HtXHEHHEHH}HuHEIH^u/LFfHg"HƿS4HEH@XHH!HuHEЋtXHEHHEHH}HuHEIH+u/LkH!HƿHEH@XHH!Hu3HEH(u#HEH@XHuHEHDtXHEHHEHH}HuHEIH~u/L!pHB!Hƿ.HEH@XHu#HEH;`uHEH@XHtXHEHHEHH}HuHEIHPu/LuH HƿHEH@XH`H!HtXHEHHEHH}HuHEIHu/L!zHB Hƿ.HEH@XH(txH!HEHHEHHtt!Hy!HEHHEHHtu/LHHƿEHEHHEHH}HuHEIHu/L>H_HƿK,HEH@XH7txHG!HEHHEHHst!H.!HEHHEHHsu/LHHƿEHEHH8EEEHEHHEHEH@H@HtHE@Lu ElHEH@H@Ht EMHEH@HHUHRPHHPILHHƿHHEHHEHUHEHH9G}tPH!HEHHEHHPru/LlHHƿyZ}tPH:!HEHHEHHqu/LH7Hƿ#}uV}uPH!HEHHEHHqu/LHHƿEtMHg!HEHHEHHzquyLcHHƿpTH"!HEHHEHH-qu,LH7Hƿ#HEHHEHHfHUdH+%(t.UHH@H}HuHEHHEHEH@HEHEHHEEEHEHUHHHHHȋSHEHHEEHEHHHEHUHHHHHH@H@H9uEHEHHEHEH9Eu}HE(HHEH}u4LHHƿHEHUHHHHHH@HPHEHPHEH@HpHUHRHHMHIPHPRIL HHHƿ4HHUHEHH2EHE@L9EeHEHHEHUHEHH97UHH@H}HuHUdH%(HE1HEHEHEHEHEH@HHUHRPHHPILx HnHƿZHHUHEHHZu1LH)HƿHUHEH HHzHUdH+%(t#UHH H}HEH#'EHEH'E}u }uZ}uEO}uEDE;Et9EALt1HBHƿ.EUH}E EE EE EE EE EE#E]UHH H}[EHEHE}t E#EtFEyEEAL LHzHƿfE ƋEщȅt@EEALRH$HƿEUHATSH H}HuHEHHE4HEH@H9EuHE@PHEPHEHHEHUHEHH9uHEHVHHED` HEH@HUSATIL[eHYHƿEHHEH@PH@ H@HEH}u1L)iHHƿ6HE@HEHUHPHEHUHHHg.He[A\]UHATSH H}HuHEHHEHEH@H9EHE@vHE@PHEPgHEHTHHED` HEH@HTSATILXHHƿHHEH.HEHHEHUHEHH9;HEH'THHED` HEH@H TSATILHzHƿfHHe[A\]UHAUATSH(H}H}u4L̯H"Hƿ2HEHHEHUHEHH9HEHUHHH.HE؋@txHEDhHEH@D` HEH@H@HRHHEHRHAUATSILIHWHƿCH fHEH@\HEHHo.HEHRHSIL1HHƿHHe[A\A]]UHH}uHEHHE2HE@ 9ErHEP HE@$9EsHEHEHHEHEH9Euĸ]UHH0HdH%(HE1HHHDžHH@PHHIHH@H,HDŽHHHHHH@PHH9uu苅HUdH+%(tUHH H}EEHEHHE~HE@PEHEH@H@H tHEH@H@% HtHEH@H@HtHE@LvHEE HE@PEHEHHEHUHEHH9k}tUEHHW UHAUATSH8H}ȉuĉUMEĉE؃}uEEĺuU܃}}tE+EEE؋EHUȋHHEHHHpRIċE;Es HuH0EHUȋHHEHHH0RI<tEPATSEPMLHHƸwH EHe[A\A]]UHHPH}HuЉỦMDELMHEH@PH@HEU EH}u4L HHƿHEhHHEH}u4L%HHƿUHEHHHUHHEHHuGHUHEHHL")HCHƿ/2HEH@H HEH@%HutUHEHHHUHHEHHuGHUHEHHL/H HƿHEHUHPHEHUHPHEỦP HEUȉP$HEUĉP(HEHUHP0HEUP8HEU PLHEU(PPE0uU HE؉Hf&HUHEU8PTHEU@HEUHHEHUPHHEHHC%HEHxH3%HEHH!%H}tHHUHEHH_du1LJEHk HƿW]HEH@HtHEH@XHH HEHPXHEH@HtHEH@X̀HHEHPXHEUHH}HEH@H@Ht.HEH@H@Ht HE@LHEH@@]UHSHH}HEH@H@Ht"HEXLHEHkغHEPLHEH@@)‰H]UHAUATSHhH}uUMHEHUHHHHHH@HEHEHUHHHHHȋu iHEHUHHHHHȋ}tgHEHUHHHHHH@UHu4L&{HG Hƿ3HEHUHHHHHH@UHu4L~H HƿlHE@P9Eu$HEHUHHHHH2HEH@XHu9HEH@XH&u&HEH@XH?uHEH@XH.tSUHEH u4LH HƿHEH@H@HHEH@HH"HEH@HLHEH}u4L^HHƿk HEH@Hu4LH7Hƿ#HEH@XH"HEH iHEHEH@H@HtHEHHEH@H@% HuHEH HEH@uHE}u HEHH$HEH@PHEHEHUHHHHHȋu-HEHUHHHHHH@HEH}u HEЋHEHE+EHEHEHAHEHE؋;ErHE9Eu HE؋E}tIUHE؉Hu4L8HYHƿEUHEHu4LHHƿHE@P9E@HEHUHHHHHDhHEH EHHED` HEH@HEHAUSEPATIL|HjHƿVH HUHEHHu4LH%HƿHEHUHHHHHH@HEHUHHHHH@HEHUHHHHHHEH@XH&HEHH HEH@PHEHEH u4LH5Hƿ!HEHHEHHEHH HEHPHHEHHuHjL 6IH.[ Hu*LHHƿHEHHEHH HEHPHHEHHuIH{ He[A\A]]UHHH}uUUuHEHUHHH}uUUuHEHUHH@H}؉uHUȉMHEHUHHHHHȋ^HEHUHHHHHH@H@HEHEHUHHHHHH@@EHEȋPPMHEȉH u4LH Hƿ7HE؋PPMHE؉Hu4LHHƿMHUuHEHLIHjHƿVHEHUHHHHHH@HEHEHUHHHHHȋ@EHEȋPPMHEȉHu4LHHƿHE؋PPMHE؉H~u4L_ HHƿlMHUuHEAH]LH(HƿVHE؋PPMHE؉Hu5LHHƿ UHSH(H}uHU؉MHEHUHHHHHHExPHEHUHHHHHMHUuHEAHщHHCHCHu1L$HHƿH]UHATSH H}uHU؉MLEHEH2>HHED` HEH@H>H‹EPSEPATIL0HzHƿfH HE@L9ErWHEH@H=HURLMPRAL5H!Hƿ HHEH@XH EHHEHPXHEH@XH!HEHUHHHHHHEHUHHHHHHEHB}t4L>HjHƿVHEHUHHHHH@pHEHUHHHHHHEHUHHHHHHEHBHEHUHHHHHEBHUHEHHu1LgIHHƿtHe[A\]UHH H}uUEUHEH@H@PH@HH7HEH}uDHEH@Hz;ILWHHƿ\HE@Lt3HE@LHHHHHHEHHEHHuHEHUHHEUPLUHH}uU}u HEH@HtEtHEH@H t,HE@t!HE@;ErCHEPE)5HEH@Ht}uEE}tE]UHH H}uHEHLHEH@H@Ht HE苰ȺHEH@@)‰UHEH@H@Hu1HEH@H@H HEH@H@%HukEuЅtJHE@LUHPALȗHHƿHEuEEEEMUMHEHFu1LVHwHƿcbEHE@L9ErHE@$+EHEP$HEH@H@H tHEP$HEPPHE@P+EHEPPUHHH}HEHYHH@HEHEH@XH0uHEH@XHuHEH@XH%uHEH@XHuHEH@XHuHEUHHH}HEHyuFHEHk7u6HEH@XH&u#HEH@XH?uHEHtUHH H}cHEHHEH}u@HEH37ILƕHHƿ HEH@HEHEH uHEUHH H}uHEU䉐EHUHRPHHEHHEHHEH}u4LҖHHƿHE苐HEPPHEPPHEP$HEH@HUR$HEH@HUHHHEH@HEHEHHtHEH7UHSHXH}uUHEEEHEEEHEH@XH H!HEHEHHueHEHVHEHEH@H@HuHEH@H@HtHEЋ@(tEHEЋEHEH@XHtnHEHHt^HEHXHHEHnXH@H@HHSIL~ HHƿHHEHJZHEHHEb}qHEHHtHEHHEHEЋ@$9EHEH@hHt^HEH@hH@HHUHRHRHHPIL HhHƿTHHEH@hHYHEHHtKHEHH}u4L"HHƿ2HEHHtKHEHH"u4L%HHƿ}mHEH@H@H RHEH@H@XH2HEHH@HUHHu4L,HHƿAHEHH@HEH@HEHHEHHHEH4hL_1HHƿlHEHH@Hu4L3H1Hƿ`}HEH@H@H%HEHH@H7u4L9HHƿHEHHtKHEHH u4LA<HbHƿNHEHHEH}HEHfu4LAHHƿ3HEH@H@H tDHEH# u4LDHHƿHEH@H@H tyHEЋP$HEHH@9tYHEHH@HEЉP$HEH@H/ILQHHƿHEH HEЋ@$EEEUHEЉH u4L\HHƿE)EHEH@HEHUHEHH9HE}tEE)HEHu4LaH Hƿ OHEH PHEH}t6}tHEHEЉPPHEЋPPHEЉP$HEЋP$HEЉ}u HEH@PHXH9Eu0HEH@XHH!HEHPXHEH@PHǀXHEuDHEHGu4L tH,Hƿ[HEH@PH@H@H@H@HHthHEH@PH@H@H@HHHHEH@PH@HUHHхu4LwHHƿH}tbHE؋uTHEHtDHEH u4L}H>Hƿ*m}^HEH@PHXHFHEH@PHHEPHEH@H@XHH!HuHEH@H@XHH!Ht E"HEHHEHUHEH@PHH9u}HEH@PHXHEH@PHHH[uKHEH@PHXH+IL)HHƿ QHEH@PHXHMu1LHHƿH]UHHH}HEHEH0UHH H}HE苀EHEH@PHHe HHGHEH}u4LH#Hƿ}tAHEHFu1LHHƿ|}uEHEH@XHH!HEHPXHMUHEHNu1LAHbHƿNUHH H}HEH@PHHEEHE@uVHEH@XHtCHEH_)IL HHƿHUHEHHXu@HEH)ILHvHƿbEHUHEHHYu@HEH(ILHHƿ EEUHHH}HEHuhHEH@XH tPHEHOu@HEH(ILJHHƿ|UHH H}uHEHfIHEHEH@XH tVHE苀9EtGHEH@H@HtHEHhHEH@PuH^EHE苀9EHEHu:HEH u*HEH&uHEH@XHH!HtPHEH t@HEH&ILچHPHƿ<MHEHUHH@H}dH%(HE1H}t HEȋu4L HHƿHEH@HEHEHpHHEH@PHUHѺHcEHEH}HEHpHHEH@PH2EHuWHEH@HHUHRPHHPIL؅HHƿ HFHEH@HHUHRPHHPILɅHHƿHHEH@hHEH}tKHUHEHH=u4LDHeHƿQHEH@pHEFEH}tlHEubHEH@uTHEH@H@H@HHUHRHRHHPIL HHƿH{HEH@PHtbHEHPHEH@PH@HMHHu4LE$HfHƿRE}u@HEH@tHEH@H@H@hHEH@H@HEH@`HEHHEHUHEHpH9HEHHEH@PH(HHHUdH+%(tUHHH}HEHStHEHHPRHEHEHu1LHH9Hƿ%UHH0}܉u؉UԋUԋEHHEUHEHHMܺHHEHEHHHEHmHEHH%HEHm UHEHHuغHHEH;EsFHUHEPILƂH\HƿHHHEHEUHH@H}HuЉỦMDEċE+ẺHE؋@HU؋J$EE+ẺHE؋@ HU؋r$EHE؋@Du HE؋P,}t HE؋@0ЉEUEH‹EHHEHEHEEH;EsDHUHEPILHOHƿ;HUHH H}HEH@H@Ht]HE@LtRHEHu@HEHH@HHtHEHEH@H@Ht HE@LUHH}HuUHMDEDMHEUHEHUHPHE@HEUPHEH@HHEPHE@ HE@L9HE@ HEPHEu(HE@HEPHE@@HEP|HEt HEufHE@HEPHE@@HEP>HEt HEu)HE@HEPHE@@HEPHEuHE@HEPHE@u*HEuHEH@PHtHE@ HEPHE@KHE<@t@}9HEILtJ HHƿHEHEu9}L(tS HHƿ誱}HEHoHHذ\H}HEHHE}uSHEH ЏHHsu4Ls` H#HƿTEHEHHHEHHu4Lse HHƿ贰HEHHEHUHEHH9*H}t&HEHHUHEHH'tH}} thH}tHEH(oHHcLeHEH oSATILrq HHƿHH}tHEHnHH5cHEHnHUSPILrt HHƿHNH]HEH_nMHSURPALrw HCHƿ/H pHEHHEHH% H}tHUHEHH%H}}uSHEH DHHu4LQq HHƿ胮EHMHEHH萊vLp H<Hƿ(mH}} teHEHlHH}tHEHlHYaSuILp HHƿ豭HH}tHEHlHHaHEHslHUSPILp H^HƿJHLHEH.lMHuURPALp HHƿH @ HEH@HEH}H}tHUdH+%(tHe[A\]UHHH}HEHjjjAAHH UHH H}HuHUHuHEHjujAAHH u=HEHLj HHƿƫUHH H}HuUMLEH}MUHuHEHjjjIAHH UHH H}HuHUMHMHuHEHURjjAIȹHH UHH H}HuHUHEHHHEHpHEH@ HmUHSHHH}HuHUH}u HEHHEiEHEȾH軅u4L HfHƿR,HEH@HE#}u_HEȺH RHHLu@L HHƿHEHӇHEH@HhH譣HHEH@HhHHEHHHȅu@LM HxHƿdHEHO2H}HEȺH %QHH^u@L HHƿHEHHEHHHUHEHH|u@HEH谆Lg HHƿ菨iHEȺH HH蠄u@L% HPHƿPIHEHHEHUEHHHHEHH9EHE@9EUHH0H}HuHUHEHHEHEH@H9EuDHEH@H\IL0b HHƿrMH}t(HEHpHUHEعHtHEHHEHEH9EfUHH@H}HuUHMDEDMHEHHEHE@u D}t>E)HEH@UHHHH9Eu EHEЋ@9Er˃}}~HE@lHE@uHE@HEH@HtHEH@P HEH@@$ HE@HU؋r$ȉEHEH@XHHEHEP HE@$9EHEPEЉEHE؋@DtHE؋@Hu HE؋@0)EHEP HE@$HE؋@$;EsMHEP HE@$HE؋@$HE@)‰UHE؋@DtHE؋@Hu HE؋@0EHEHHE!HEHHEHUHEH@XH9HE@E}HMHUHuHEAHu4L_F HHƿl"HE@9EHE؋@HEP@HEH@HtdHEP4HEP0HEU P,HE@4HE<HHEP@HE@@ucHE@DHE@0ELHEU P(} t0UE HEx$ȺHE@4M(Ή4HUB0}u}tAU؋EЋUPEPAL?HHƿuHHE@0tUHE@4HEHH;HUR0PE(PAL?HHƿuH}u}tEEHEU؉PE!EHHHHEHHЬEE;ErHEHU8HPXHE6HHUHBPHEH@PHtHEH@PHgHE7HHEPHVHƿBtH} u4L>HHƿtHEH@H@H@H@XHHEH@H@H@HHXHEH@HUHHхHEH@(HUHRHRHR8HPIL\>HzHƿfsHLv>HLHƿ8s}(v HE@PE(HE苸H}t HEDAHEHDMM0U(Huu8DEAPW}W}W}WEHH0HEH}u1L~1HHƿreHM HUHuHEIȹH&u=HEHL1H>Hƿ*rHEUHH0H}uUHMLEDMH}u4LH=HސHƿqHEH@Ht4L)=HHƿqHE%HtJHEHHou4L=H?Hƿ+qOEHHHHEH4LMDEHMUHEH}WH Hu4L/HʏHƿpHEH@tDHEHZ8u4Li<HwHƿcpHEH@PH@H@H@H@HHteHEH@PH@H@H@HHHHEH@PH@HUHHхu1L.HHƿoUHAWAVAUATSHHH}uHUHEH@H@Hu4L;+HHƿroHE@Lv4L;0HFHƿ2oHEEHEXT]HEHPMHEDxLHEDp8HEHp0HuHEDh$HED` HEHXHEH@H@PHHHHHHjEPEPEPjMQAWuAVLMADDH~HPHEH}u4L:<HSHƿ?nEOMHUuHEH)u1L,BHHƿmBEHE@L9ErHEHǀHUHEHH[HEHOHEHe[A\A]A^A_]UHHpH}HuUMdH%(HE1EEHEH@X% HuCHEHIL9\H*Hƿm1HEHHt4L9cH܋HƿlHEH@`HE UHEHGHEH}uRHEHHHEPIL9oHaHƿMlHdHEȋPHE@P9stHEP HEȋ@HEH辜uRHEHuHHEPILE9wHۊHƿkHHE@PEHEHHEHUHEH`H9EEHEH@PHHuHHѺ HHuCHEHIL8H9Hƿ%k@HEH&HH@HEHEHPHHEH@PH@HHKHEH}u4L)HHƿjHEHdHPHEH1HEHHPHEHPXHEIȹHRHEHEHu4L)H<Hƿ(jCUHuHEAйHu4L(HHƿiHEH@PHHHHHEH}u4Lg(HHƿtiHEH@`HEUHEЉHHEH}uRHEHHHEPILG6H HƿhHHEx$HEH$HEP HuHEHjjjjjWjjjA AH@xHPHEH}u4L_'HHƿlhEtEHHHEHЋHEHHHEHHPuHEHlu4L&HHƿgEHE@9ErHEHUH°HHkHE@PEHEHEPPHEʉHEHHEHUHEH`H9HEH@X̀HHEHPXHEH@PH@H@H@H@HHteHEH@PH@H@H@HHHHEH@PH@HUHHхu1L%HHƿfHUdH+%(t fUHH@H}HuЉỦMȋẺEHEH@`HEfUHEЉH.HEH}uRHEHHHEPIL3HHHƿ4fHHEPHE@P9stHEP HE@HEЉH襖uRHEH\HHEPIL,3H„HƿeH$HEH@H@HuUMHEHHEH}u4L4$HUHƿAeHE@LEHE؋PEЉEUHEH讇u4L#HHƿdYEyEHHHEHЋHEHHHEHHPuEHEHڃu4LT#HuHƿadEHE؋@9EwHE@PEHEHHEHUHEH`H9HEH@X̀HHEHPXHEH@PH@H@H@H@HHteHEH@PH@H@H@HHHHEH@PH@HUHHхu1L{"HHƿcUHH@H}HuЉUHMDEHEHfHEHEHH荝uHEHt4L0H HƿbnHEH@PHH8HHHEHEH@H9EtUMHEHHEH}u4Lg!HHƿtb}t\HE9EtMHEUHPAL<0 H*HƿbHHE@LEUEЉEUHEH胄u4L HȀHƿa*EWHEHUHHHHHH@HHXHEHUHHHHHH@H MHHPXEE;ErEEE+EHHEHHHMuHEIȹHu1LHHƿ`ME+EHHEHHH<EE;EdHEH@X̀HHEHPXUHH H}uHUHMHEH@PHH0HHHHEPE4HUHEjuAIHѺHHUHHH8H0,(D$dH%(HE1HDžPH8uH8HH谘u4L-MH~Hƿl_aH0H@H tGH8H@XHH H8HPXHHPHHXH0H@Ht7H8H@X̀HH8HPXHDžPH$HX4L[H}Hƿ^H8HHXH8H0Hjj(Rjjj$Rj,RIAHmHPH`H`uFH8H}ILh,cH|Hƿ]DžLF$vxH8HPHLHXHpAIHH#~HǸ_L8pHY|HƿE]H8HPHHXHpIHH}HǸy/LtH{Hƿ\H8HHPH8P`HpIȉѺH}HhHhu4LZ{H{{Hƿg\\HPHhLH`IȹHI|u4L~H{Hƿ\H0H@H ^H0H@%HEH8HPHLHpAHHK|HǸxy/LUHvzHƿb[H8HHPH8P`HpIȉѺH|HhHhu4LHzHƿZHhLH`IHzu4LHyHƿZLL;$H`H8H°HHAH8H詸IL(HyHƿZHUdH+%(t0YUHH H}HuHEHMHE@LHHHHHHEH@H@PH@HHI2HEH}u4LUHvxHƿbYEpHEHUHHHHHUHHHHHHEHHAHBUHHHHHHEHHHEHH菐EHE@L9ErHEUHHHhH`\XDTDPdH%(HE1H`HHDž|DžDžH`H@PHHHHzHHu4LH wHƿW! HH@H@H t:DžPEHH@H@% HtH@LDžxHHxHHHHHH@HHtHHZHHtFHH@H@H%t,HHHPxHDžxHHxH@L9x(XtDžxxHHHHԂ\ADPTtHHhHMQEADHOHu4LHtHƿUHH=tHHxXDMLHPtHhjWHnHuVH`H@HHHRHHPIL!$HOtHƿ;UH`H`HpTHH@H@H HH@H@%HH`HHHu4L]uHsHƿTHHxHHHHHH@HHHHXHPLt4HHHhjQAIHѺHHuVH`H@HHHRHHPILtHrHƿSHHH}H`HHHHH@PH@HHuFHH轱IL("H.rHƿSCDž|PtxH@L9xEDžxvHHxHHHHHH@HHHHHHHHu4LԻHGqHƿ3R\HHH@HHu4L| HpHƿQHHHHHHHHHHHHP$HHPPxH@L9xtHP$\HP$HH@H@H tHP$HPP(HHP\HPPH`\H`H4xu4L`5HoHƿmP|H`H@PHH`H@XHH H`HPX葚HHVtHHQ u4LIHnHƿOLKHnHƿOAHHHHHHu HHH`H茊u,L pWHnHƿNaHH>tHH9u;HHILoYHmHƿNLd ZHmHƿqNHH@HHH(Džx7HHxHHHHHH@HxxH@L9xrH`H@XHH!H`HPXHUdH+%(tLUHH`H}HuUMDEDMHEHEdH%(HE1EEHEH@HHUHR(HPILHBlHƿ.MHHEH@HtHMUHEȾH9dHEȋueHEH@%HHt EJHEH@HtEE/HEH@H tHEH@%Hu EEEHEH@H t{HEH@% HuiHEȋ‹EHHEH@PHHEUHMHEHHNEHEH*HtHEHUDMHEH@PDEMHUHuj}(W} Wu}W}WHH0HEH}u4L{ HjHƿKHE@EHEH@H t&HEH@%HuHEP0HE@$)EHEH@%HHtY}MHUHuHEAHEԃ}ZL HiHƿJ+HEH@%HuHEH@%HumHEP}HuHMHEjjAIHbHEԃ}L7 HXiHƿDJHEH@H tEEHE@ЉEEEHEȋEHEȋu_}܋MUHuHEAHEԃ}u:HEH@HILjHhHƿIHEȋU)DE}HuHEHMQEAHHEԃ}u/LH9hHƿ%I{HEHtMHUHEHH谬u6ELHgHƿH}HEH@HHEH@XHEHEH觊HEHڦILHKgHƿ7HHEH衦HHHǸHEHILHfHƿkGHEH@XHu E=u^HEH賥ILNH$fHƿG諍HEH@XH HHEHPXFHEHUIL(HeHƿFEHEHEHUdH+%(tEUHH0H}HudH%(HE1HEH@PHEHUHMHEHHt^HEHEt HRgHRuILHdHƿEH`HEH@XHtHHEH}>HHHEHEH@PH@HUHHHEH}u4LeCHCcHƿ/DHMHUHuHEIHH<HǸy1LLeGHbHƿCjHEHuGHEH@HHuILLHbHƿzCHHUHEHHH]UHH H}HuHEHEHEHPHEHHEHHUHHH}HuHEH@XH H!Hu4HEH@XHu!HEH@XH4uHEtHUHEHHHUHH@H}؉uHUHMH}u EԍPUԅtaHUHEHMHHщE}u4L|H0aHƿB}u HEHtqHEH+HEHEH@X%HtOHMHUȋuHEHu4L~H`HƿAHEHHEHEHHMHUȋuHu4LH5`Hƿ!AHEHHMHUȋuH]u4LH_Hƿ@EHEHHMHUȋuHu4LhH_Hƿu@HEHHMHUȋuHu4LH3_Hƿ@HEHhHMHUȋuH[u4LH^Hƿ?CHEHHMHUȋuHu4LfH^Hƿs?EHEHUHHHHHȋumHEHUHHHHHH@HMHUȋuHgu5LH]Hƿ>OEHE@L9EYHEH@H@%HHEH@H@HEHEHUHHHHHȋHEHUHHHHHH@HtjHEHUHHHHHH@HMHUȋuHTu2LH\Hƿ=?EHE@L9E1HEHHEHUHEHH9UHH H}HuHUHMHUHEHUHH`H}HuHUMdH%(HE1HEH@PHEHEHEHEH@HHEHEHEHEH@XH H!HuaHEH@X%@HuOHEH艽u?HEH@HILH[Hƿu<YHUHMHEHHtaHEHEȅt H]H)RuIL H[Hƿ;HHEH@XHt?HEH@HIL ]HZHƿ;HEH@XHHEHkH}HEHuH@HEHEH@ H@XHt3HEH@ HHXHEH@PHHUľHхt EăuCHEH|IL HYHƿ:}HEHUHPHHEHH@HUHRHHPH}}HEHtHEH YL9HZYHƿF:*HEH@HUHHRHEHEHu4L HYHƿ9HUHEH HHPu4LHXHƿ9HUHEHPHHEHttHEH读HE}tIHEHEHu1LH2XHƿ9HUdH+%(tA8UHHHhH`HXTdH%(HE1H`H@PHXHH[tjH`H@PHpH5TH,SHu1L~ H\WHƿH8jHpHXHXH`HhHu1LHVHƿ7HUdH+%(t7UHH H}HuHUHUHuHEHIUHATSHH}HuHEH@`H9sKHEH@H还IL 5H8VHƿ$7HEH@`HU苒H9HE苀HEHHHMHHEHP`HEHHH0I舂tHSML ;HUHƸ}6HHE苀HEHP`HEH@`HtHEHP`HEH@`HH!Ht1LCH&UHƿ6He[A\]UHHPH}HudH%(HE1HEH@PHEf)E)Ef~EHEHHUHuAAHѺHFMuG#Dt4LVQHeTHƿQ5HE@PtTEЅuCHEH蟓ILWHTHƿ4HEH@XHtJEЅuCHEH8IL^HSHƿ48EЅu 'HE@hHEȋHHEHHH轕H‹E؅t HUH0HRILgHSHƿ4HLkHRHƿ3HE@DurHE@@ugHEH)HHtHǸ}$HE@PHE@Xt[HEH@H@@puEotLHBHƸ#HE@XHE@Tt[HEH@H@@puEuotLHBHƸr#HE@THEH诬Ht@HEHIL{H1BHƿ#eHEH@XHuHEH苬t=HE@4u1L[HAHƿ"HUdH+%(t!H]UHSH8H}HuЉUHMHE؋E]HEкHHHȉE}tj}tEHEЋEH)EHEHHUHH蔃HmtILH@HƸ!uHEкHHEH]UHAUATSH8H}HuHUHEH@PHEHE@hEHE@|HH HH H>HE@xHE؋HE@hΉ菆HUBhHE@xwHE@hHUȋHU؋9RHEȋHE؋HEPhHE؋HE@hHHEHHHHwltEHSALbHx?HƸi HHE@xHE؋HE@hΉ葅HUBhHE@xHEȋHE@hΉ[HUBhNHEHH9Et>HEHrEHE@xHE@hMԉΉ HUBhHE@xHE؋HE@hΉׄHUBhHEH^u4LlHJ>Hƿ6HE@xHEHUHE@hډΉSHUBhIeHE@|ALH=Hƿ'HE@|tHE@|t HE@|uHEǀHE@xu2HE@|tHE@|t HE@|uHEǀHE@xuHE@|uHEǀHEt L%?L%?HEDhhHEt H?HHE@|{UATAUSPALH<HƿH He[A\A]]UHH}HuHEHEHEHHEE`HEHUHHHHHȋu6HEHEHUHHHHHH@@HEEHE@L9ErHEHHEHUHEHH9i]UHH H}dH%(HE1EHUHEHHu*L7-HX;HƿDHUHEH HHu*L1H;HƿEHUdH+%(t(UHAUATSHHHH@H8dH%(HE1HHH@PHEHEHHEDžhDžlDžpDž\DžtHHEEEHHH脛HEH@H@ HuHEHPH@HP H@HP HEH@H9H@H@ H@(HZHHt>H@H@ H@(HHHtH@H@ H@HtxHEH@H@HuDHEH@H@(HtZHHt"HEH@H@(H_HHuH@@XuVH@@XFH@H@ H@(IL`H8HƿH@H@ L`(HEH@HX(HHHxIeetATSML5dHk8HƸ\HHHHEE||u$HH|H@ǀH@t|EEH@@xtH@@xuH@@h;EsE} HEH@H@HtHHHFtH@@Tu^ttU3dttAL':|H67HƸ'H@tPT]H@@Tu ttFH@@T9tt4LH6Hƿ|HEH@H@HtuFHHHuILHl6HƿXHEȋ@LtH@PXHEȋ@8H@HP`H@@XzH@@XvH@H@`HWttHEHH@H HHHHHE HEH@H@HuGHEH@H@%HtHEH@H@HtHEH@H@% HHE@8EHEPLH@H@ @)‰U\t!\9Et}tH@H@`Ht"ptMp;EtBH@@Xu4L0H4HƿlE\EpHEHHEHUttHEHH@H HHHH9H@@XuH@pPXHHH3H@H@%Ht`H@@X9ptNHHHHkILrH3HƿnH@H@`H H@@X\to\HEHHuH(`tIL#H13HƸ"\H@HP`HEH_AHcH@HP`H@HP`HEHH8uH_tIL5H2HƸH@@XvDH@H@`Hu4LoHU2HƿA H@@xuH@@hEH@@h+EEHHH@XH?_HHHHEH}u4LH1Hƿe HE0 dDž``d9C‰EeHE;EHEEЍHHEȺEE9EEHUHHEHHrsHËEHUHHEHHMsI]tHSMLH0HƸHEEH@HEH@H@HupHEH@H@ Hu\HEȋHLHEH@H4EEEHUȋJLHUHRR)ѺEEu‹E‰EE9ErSHHHToHjEPILFH/HƿH^ UEH@PhHHHsHHH莒XTHHH蕒HhH@@h9hyHE‹hHHEHHHpqH[tHhPILH.HƸHH@hPhH@@h+EEH@@h9E: HHH@XH'HHHHEH}u4L H,.Hƿ HHHHHdHEHH蚼HEH@@hHEHH9EHEHEHHPHEHкHH@PhH@XhHEHHUHHoI(ZtHSML&H,-HƸHH@@h9Er H@UPhH@@hHEHЋdHEHݻdHEd9tvdHEHEH@HPXHEH@HPXH@ǀ@YtL~HL,HƸ= H@@h+EE}rH@@XuH@H@`HuH@@Tt:XtL$H+HƸ H@@xuiH@@h;ErFHHHjILHm+HƿY H@@hU)‰U H@@hEHHHHEHE@$EHEPPHE@L‰EH\HEHHpHEH@H@HtHEH@H":t DžtH@tMlE;ErhE+lEttEtEhEH@PhbhE;ErE+hEH@UPh7EhElHEHHEHUHHHH9\H@HP`H@pPXH@tPTH@@hu4L,MH)Hƿy 3H@@h9EH@@8uyH@@Pu]H@H@(HuMH@PhHEPALSH)Hƿ HH@@4H@@X6H@HX`l H9sQH@HP`HEHHjIL+]Hu(Hƿa H@@XxH@H@`HUH9s0H@H@`HUӺH‹x‰xExU}H@@h;Er:H@@|t,HEH@@h+E+Ex9H@@h+E‹xH@D`h=TtHSELSoHA'HƸ2HH@@h+E‹xH@Ph}tyH@@h+EH@D`hStHSELuH&HƸHH@@h+EH@PhH@@h;EsoH@@4uMH@PhHEPALHC&Hƿ/HH@@4H@@h9EsoH@@4uMH@PhHEPALH%HƿHgH@@4H@@h9EH@@8uyH@@Pu]H@H@(HuMH@PhHEPALpH&%HƿHH@@4H@@h9EsLHHHH@H@Ht-H@@HtHHH@XH HHHHPXH@XhHHHcHHEPEPSILHY$HƿEH HUdH+%(tkHe[A\A]]UHSH(H}HuHEHցHEЋ@4u4LH#Hƿ@HEHFt4LH#HƿzHEЋ@4>HEH@XH&tCHEHbILH(#HƿHEH@XH't4L{H"HƿOHEH@XH?tCHEHbILUH"HƿwHEH@XHzL2H@"Hƿ,HEЋ@46HEH@XH't{HEH HgHEH}tHEH@ H=uCHEH1aILH!HƿHEH@XH$HEHxHHtyHEЋXhHEHYH9sUHEH<H@H胙u1LYH HƿhHEH@(tPHEHCu@HEH#`IL#H HƿH]UHAVAUATSH@H}HuHUHEH@PHEHEHHEHE@u rHHHHPhHHH0HHHHH@(HHH@XH H!HuQHH@XHH!Hu4LkHHƿH@huyHH@pHuiHH@XH%tHHHHHP(HHPpHP0HPxHH@(HH@XH%GHHHXH0H8HHHXH@HHHH HX(HPHXHH0HX8H`HhHH@HXHHpHxHHPHXXHHHH`HXhHHHHpHXxHHHHHHHHHHHHHHH0HHHHH@(HH@04L|HHƿpHHH HHHHu4LhHHƿuHHHHyu4LH8Hƿ$HHH HHku4LHHƿ]H@4"HHH@(HHHH9HH@XH%HHHXH0H8HHHXH@HHHH HX(HPHXHH0HX8H`HhHH@HXHHpHxHHPHXXHHHH`HXhHHHHpHXxHHHHHHHHHHHHHHerHHPTHH@hΉHHHHHH9s]LHHƿHHH0HH#HDž HDžHtxHH|HHtXHH0HHHu4LH)Hƿ H@4tHt[duPHHH9t:<tLHHƸH@PuH@4uQHHHHdu4L&HGHƿ3 H@PH@LuHHDHP@HHIAȉѺHƿ萼u?t4L1HHƿ% H@4usHpDHH@HPhHAAHƿu4LH&Hƿ H@hu0Ht uHHPhHH@XH%HH0uFHHLIL Hh HƿTHHHHzuFHHLILH HƿDžH@43HH@XHHHpHHH@PHHH@PHHHHIIHHHǸ=yBHH@HILH- HƿHH@PHHHHH(H(u>HILH Hƿ6HHH(HH Ht%HHH(HHHuMHILkH1 HƿH(H蜣H@hHHH HHH@h)‰HHHHH MHSPILH| HƿhHHH@h)‰HHH HH@hHHH HH(HHJuMHIL H HƿH(H>AH(H%HHHIйHH.qu4L0HQ Hƿ=Ht]HH1j@(tGHH6u4LɨHHƿgH Hi@(tGH H6u4Ll HHƿy HHH0HHHu/LH'HƿtBHH8u/LHHƿHHH HH4u/LgHHƿt7H=HH7u/LH1HƿHHZhtNHHH2u*L"HHƿHH@XH%tGHHΎu/LR'HsHƿ_"H@4u1HH@XHH!HtHH4HHEH2tIL/HHƸH@PtzH@4ukHpDHH@HPhHAAHƿ5u,L74HXHƿD DžHH@PHHuCHHxDIL:HHƿiHHHHgsuFHHDILs@HHƿuDžHUdH+%(tH]UHH@H}HuHUHMdH%(HE1EHEHHEEHEH@H@HHUHMHHǸuE9E} EEHEHHEHUHEHH9uHEHHEIHEH@H@H@HHUHMHHǸJuE9E} EEHEHHEHUHEHH9uEHHUHuHEHǸ yHEHUdH+%(tDUHH0H}HuHUHEHHEH}u{HEHHEH}u1LkHHƿCHEHUHPHEHUHH}tHEH}t HEHEUHH0H}HuHUHEH.HEH}u1L7}HHƿtHUHMHEHHHUHBHEH@HuDHUHEHHLdHHƿqHEUHH0H}HuHUHEHSHEH}u[HE؋tHEH@H@H HEH@H@HILmHHƿHEHUHPHE؋tHEH@HUHPhHEH@HaHUHP`H}tEHEtHEHUHRHpHHHEHUHRHHHUHH0H}HuHE؋tHEH@HpHEH@HHEHEHHEHEHHExHEH@H9EuVHEH~HEH@tHEH@H@H@hHEH@H@H`H@`HEHEHEHHEHEH9EzHE؋tHEH@HPH HEH@HPHHEЋtHEH@H@H HEH@H@HHMЋ t H nH RPILHHƿHUHH H}HEHHEH}u1LHHƿt^HEHHHEHHHEHHHEHHHEHHHEUHSHH8H0H($LdH%(HE1HH@HPHHUt*LpHHƿ}H8H3HH'HtgH`H8HHH8H8u4L@HHƿHLH8HHH\tlLt HHHHH8PRILHHƿvH@H8ILbHHHƿ4HH@HWHXHXu4LٛHHƿHH@H8HHHXHBHHXH@HHu/LmHHƿz+HXH(HPXHX$P`HH`HXPpHX@tHX@xHXHǀHXǀH0tTHXH0H HZHHXHJHZHHHXHJ HZ(HH HX(HJ0HZ8HH0HX8HR@HP@HXHHH荹u/LFHgHƿSHXHu/L HHƿHPH@H@H@HHtYHPH@H@HHHHXHPHHхu,LHHƿGHH@H@@p%t#HHHHHXHPhHX"HH@HXHH菴HUdH+%(tWH]UHH0H}HuUHMHEHEHEH@HUHHHUHt}HEH@(HǺHEH}u1L$HHƿz,HEHPHEHPHEHUHHHUHAUATSHHH}uUHEH@PHHEHEEHEHYHEHEH@PH@H蕱HEH}u4LtMHHƿHEHH}t}u{HEH@PH@(H芹HEH}u4LVHQHƿ=0HEHHHUHEHHHEUP HE+EHEP$}tgUHEHWHEH}uKHEHPHHEPILbHHƿHHELh$}t HELA}t:HEX$HEHHLHEHH@H؉HEH$}tHEHP U}tHEHH@HEH}uH5VjjjjMMHH0u4LoHHƿHEP HE@$ЉEHEH@@tHEȋHLHEH@P)EEEHE9}tHE@ HEHEP$HEHe[A\A]]UHHH}HEHVufHEH@XH@HHEHPXHEH@PHHUHRHHPILf HHƿxHUHHH}HEH.VtfHEH@XHHHEHPXHEH@PHHUHRHHPILR HHƿHUHSHxHdH%(HE1HH@PHH|HH&HHHfHHHtNHH@XHH!Hu1HH@X% HuHH@X%HuHHqt7uqtHHbt DžsHHTtHH@XH2t Dž4LFHgHƿSG5H@,tZHHltHHgu4L͑HHƿHHOt?H3HHHH2HǸhrxHH@XHtbHHHtOHHHHdTH@H0HHHH2HǸqHHm0HHH%Ht H jH yt HNHyt HCHyHHHVIIHHaHǸJoHHHƿHtFHH.ILHHƿqHH@XHtFHH-ILH)Hƿ-HH@XHtFHH\-ILǵHHƿHH@XH!uHH@XH"tFHH,ILH[HƿG_HH@XH&uBHH@XH'u,HH@XH.uHH@XH/tFHHL,IL'HHƿHH@XH$HHMHHHuFHH+ILд H6Hƿ":HHHt HDžHH@XHtFHH;+ILvHHƿHHHHGPu4L1HRHƿ>VHH@XHH!HuOHHu4LŊHHƿ HH@XH%$HHZHHHH@XHHHxKHhHHH"uFHH)IL*HHƿ HHHuFHH7)ILe/HHƿ HH@XHJHHxJHhH HHHHWuFHH(IL9HHƿ HH !uFHH?(IL>HHƿ H HHuFH H'ILCHDHƿ0H HH@XH H!HtHHH HH@XHH!HumHHEuZHHWuGHHTu4L_OHHƿl HH@(HH_HHpCHHBHH@Hu4L׆THHƿ HHH@H@LHPPHPPHP$HP$HHHHzGHHHH\HHnnwFHH%IL\HHƿHH=%HtIL_HHƸHDžHHHHH@H@H@XH2tiHH@H@HuNHH@H@H$IL;gHHƿHHHHHHH9KHHBHH#IL~mHnHƿZHHLu4LpH1Hƿ5HHHHRuFHH]#ILHtHHƿHH@XH4HH3HHHH@H@H tOHH@HLH'Hƿ+HH@H@H$t4L{HHƿHH@XH-HHHHH!HHu4L-HNHƿ:RHH@Hu4LHHƿHHCHHQtHHH@H@H HH@Ht HHqjHPIL"HXHƿDHHHtHHH@H@H HH@Ht H"HiHPILHHƿHHuHH@HHHt!HH@HHHu=HP,P,Lp H1HƿZHH]tHHXu4LHHƿHHHgwFHHIL\HfHƿRjHHH tIL"HHƸHHHHCuLtgHEH7H@hH HHEHHSILW8H}HƿiHHEH~uHEHLtex|HuHELHTu4Lu?HHƿQGHEt[x|HuHEL2Hu4LjuFHHƿwHEH@XH%tqHEHH^u[x|HuHELH]u4LtJHHƿZHEH@XHtex|HuHELPHu4LxtNHHƿ腵HEH@XH-HEH@XH H!HtHEHHDHEH15HHEHHBt*HEH 5HHPHEHHBuCHEH@ILVHHƿ蝴HEH@XH(|HEH@PHHERHEH@H@XHH!Ht)HEHHHYHǸQEHEHUHHHHHȋHEHUHHHHHH@H@HP@HEH@H@@H9HEH@ HHEHEHUHHHHHH@@EHEPPEЃEHEPHE@ЃEHE@9EE9EHEH@H@Ht HE@LEEHE@9EtiHE@9Es]HEP HE@+EEHEȉHÿu4LMHHƿE;EtbE;EsZHEP E+EEHEȉHWu2LmMHHƿz_HEHHEHUHEH@ H9lEHE@L9EHEHHEHUHEHH9UHHPH}HuHUHMLELMEHEHiHEH}tHEH@HLHt$HUHRHHMHIHPRILn~HHƿxHHEHPHHEH@PHH HEH}u4LLH8Hƿ$>HEHHUHEHHTu4LK#HHƿ͌HEHUHRPHHHQHEHHEErHUMHEHP}H}HEHHE"HEH@H9Eu EHEHHEHEH9Euԃ}uzHEH@HdHEH}u4LM9HުHƿʋHEHUHPHUHEHHMEHMUHuHEHeuhHEP HE@$4HEP HEH@HHMHIHHVRPILI|EH7Hƿ#H HILzzHاHƿĈHHuFHHILzHHƿk E HHILszH)HƿM(}$HH@PHHHjQAAHeHu$HHHH%Ht HXHmHSIL{HuHƿaH~Eu E,0E,t"HH@PHJHJtZHHkILVyHܥHƿȆHHHEE,tH4Hƿ HEHHEHEH9EcEHEHHEE9Es{EPUHEHubHEHPHEHHHd uDHEH@HILHHƿq~EHEHHEHEH9EdHEHH[u*Lbr#H(Hƿ~EHUdH+%(t@}UHH@H}ȉudH%(HE1HEHEHEHGHUHEHH^UHEЉHHUdH+%(t|UHHHXHPHHDL8dH%(HE1HXH`,HHyH`H`u4Lq@H Hƿ|IHHHpHH#HǸy4L[qEHHƿ|DHPHpIȹHUHhHhu1L;KH;Hƿ'||H8H`HhjjjRAAH-.H u1L:OHƚHƿ{HhHUdH+%(tzUHH H}uUE}tEEHHEH@PHt/HEH@XH$tHEHBH@XHtE}tHEH@XHH HEHPXHEH@XHH!HEHPXUHHH}uUHEH@XHH!HtEYt}tRHEH@HHUHRPHHPIL0o}HVHƿBzHUHH H}HuUHEH+H@H@@Ht HEH@XH$tDHEHH@XHu%HEHHHt eHEH@XHt H}tSHEH蘅tCHEHILenHKHƿ7yHEH@X%Ht HE@u HE@ t }tVHE@tHEH@X%Hu9HEHBIL nHHƿx}tVHE@ tHEH@X%Hu9HEHILmHWHƿCxUHH H}HuHEH@H@@pEHEHWtUHEHHU苒HPALmHӖHƿwH"EHEHH@H ugHEHH@HuMHEHH@Hu3HEHH@H uHEHH@%HtFHEHH@(ILlHHƿvMEuXHEHH֯uBHEHILlHHƿvE%tlHEt]HEtOHEvHExv1LolHHƿ vsE%ubHE@pvVHE@t=vHHEHH6ILAlHHƿuUHAWAVAUATSH8HHHdH%(HE1HHHHHH@HHHHHDžHDžHDžDžHHHHHHstjHHt H˕HRILEHmHƿYtH5HHHHu4L2HHƿt5ZHHH@H HHH@HuHHH@H tHHH@%HtFHHH@%Hu*HHH@H)u HtIHHH@(ILi HHƿr4H@tFLi HÑHƿrH@H@ H@tH9HHH@H t^Ho 9sEHHILYi HHƿr3HHHHFHH@tHHH%I}tHSMLi" HHƸrqHHHPtHPpHHHHHuNHHH@ Hu4Lh, HޏHƿps2HHH@%HHuHHH@H t|HHHH@xH9sIHHH@(ILSh2 H)Hƿp1HHXpHHH)9s`HHHHRpHPALg8 HHƿoH$1HHH@%HHtHHHH@H u>HHH@H u!HHH@H)JHH@`HudHHH@(HHHR(HPIL:gD HHƿnH)0HHP`HHHHHuYHHHHR`HPILfJ HHƿmH/HH@XHtFHH@ILfP HHƿmF/HHH@H nHHz@TH;HHHЋHHHH‹HHӺHH9tlH聸tHPALe] HHƸplHHHHyHH@XH%tfHH6HHuKHHp&L*f HHƿk{-HHHH^uFHHILej HHƿok-HHmHWuFHHILdo H"Hƿk,HHH@H tGHHͪu4L)y HHƿjS,HH@XHHHPXHHHHHuYHHHHRXHPIL1d H'HƿjH+HHHH@HHH}u4L( HHƿiB+HHH@xH9GLc HVHƿBi*HHH@H Hu4Lyc HHƿh*HH@XH H!HuFHH#ILFc HHƿh)*HHHDHHHH L' H/Hƿh)HHH@H%teHHHHHHHL& HHƿgB)HHH@HuAHHH@H :HHH@% HHH@I%HHH|HHHHAAHmHB|H@|u4L% HHƿf<(H@H@AHHH@(ILa H;Hƿ'fHHHHH@H HH@XH H!HuFHH2IL` HHƿe8'HQHH@XHt4L` HKHƿ7e&HHHHHH9HHHHHH|u4L# HHƿdG&HH@X%Ht4L_ HiHƿUd%HHkHL_ H Hƿc%HHHuBHH@XILy_ HHƿc,%HH@XHt4LW_ HMHƿ9c$HH=u4L! HHƿb$HPxHHH7u4L! HHƿb;$HHYHHHHu4L'! HHHƿ4b#HH@H@ HHH@H*Hu*L] HHƿaHHHpHHHHu4L>  H_HƿKa"HH@HH@ HHHH9seHHHHRPIL] HHƿ`H)"HHH@H ttHHuH@4f?tLHHWu4L!H~Hƿ_!HHHuH{HHIH蓀HHu4LX !Hy~Hƿe_!HH@p9tNHHPpH@pAL[ !H~Hƿ^HH@%HHHH@HH!HH@HPHPtHPHPxHH@X HHHPXH@xHRtHPAL[ !H1}Hƿ^HHHHHHHu4L!!H|Hƿ]mHHHHHH&HDHDHLHH@H uHH@H)tH HHHRHHtH HR|HHItHDVpHHASAQAPPAADH uCHH;L`-!H{Hƿm\HH@HtEH@t7Hu&HvHH蚒HHHHtHH@H)tiHHHHA@H¾{u4LjHUdH+%(t|=He[A\A]A^A_]UHSH(H}HuHEЋ@oHEHH@%HHRHEHHEHEHH@H HEHHdHHHUHHEHHu4LQ"Hr\Hƿ^=HEPDPDHEHP`HMHEHHHEH}u4L"H \Hƿ<:HEPDPD#HEHH@H HEH@XHu4L?"H[Hƿ<HEHHHH訷HUHHEHHu4L"H0[Hƿ<`HEHP`HMHEHHjHEH}u4L"HZHƿ;HEH@XHH!HuCHEHIL;>"HyZHƿe;HEHřHtIL>"HZHƸ;HETHEHH@H)HEHH bHHHUHHEHHu4L}#HYHƿ:HEPDPDHEH@`HuHaHuHMHHHEH}u4L  #H*YHƿ:ZHEPDPDFHEHH@(IL< #HXHƿ9HEHPHHEHP`HEHUHHEHPPHMHEHHHEH}u4L:#H[XHƿG9HEЋ@(t7HEH@HILs<#HXHƿ8EHEHXH輄tIL`#HWHƸ8HEH]UHHH}HuH}t1H}t*HEHPHEH@H9uHEH@H@ H@0Hu HEH@H@ HH0HUHEHHUHH@H}HEHEH@XHuHEH@XH t HEH@XHtLHEH|BHEH}t5HEH@H@XHuHEH@H@XH tyHEHHEHEHHEHHEHEHUHEHHtHEHoHEHEHEHEHEHHEHEHH9EuUHH}HEH@H@XHH!HutkHEHHHEH@H規SHNRIL4HjXHƿ0HHEHHU dHe[A\]UHATSHH}HuHE苀uqHEH4HHEH@H SH+XRIL3HWHƿa0HHEHHU dKHE苀t!HE苐HE苀!ЅHEHHHEDHEH@HbHSATHWRILv3H WHƿ/H HEHHU dHE@DHE@@HURD9syHEHHHED`@HEH@HHSATH3RIL2HVHƿ/H HEHHU dHe[A\]UHATSHH}HuHEHHuqHEHHHHEH@H!SHVRIL2HUHƿu.HHEHHU dHE@8tHEHHHED`8HEH@H蝌HSATH-VRIL1H[UHƿ-H HEHHU d9HEH@H@XH H!Hu HE@HvHEH#HHED`HHEH@HHSATH }RIL1HTHƿB-H HEHHU dHEHtmHEHHHEH@HmSHJRIL_0H1THƿ,HHEHHU dHUHEHHHe[A\]UHATSHH}HuHEH@H@%@HHEH@H@%HHEHHuqHEHHHEH@H艊SHzSRIL{/HMSHƿ+HHEHHU d$HE@8uqHEH4HHEH@H SHSRIL.HRHƿa+HHEHHU dHE@8tHEP8HE@8!ЅtHEHHHED`8HEH@HrHSATHkRRIL.H0RHƿ*H HEHHU dHUHEHHHE@HKHEH@H@XH H!HHEPHHEH@H@P!ЅHEHHHED`HHEH@H興HSATHyRIL-HFQHƿ)H HEHHU dHEH3HHED`HHEH@HHSATHyRIL-HPHƿR)H HEHHU dHEH@H@HuHEH@H@%HHE@LXHEHsHHED`LHEH@HDHSATHPRILX,HPHƿ(H HEHHU dHEH@H@HH!HHE@LHEHHHED`LHEH@H蔆HSATHRPRIL+HROHƿ'H HEHHU d*HEH@H@HHE@LwHEHHHED`LHEH@HHSATHORIL+HNHƿ='H HEHHU dHE@$HHHƿ HHEЋHHUЉ d@HE؋HU؋R$9HEHHHEDHEH@H~HSATHbIRIL#HvGHƿ H HEЋHHUЉ dHEH@H@HHE؋@L@HEH=HU؋RLHMHIHIHHPRj@IL#HFHƿkH HEЋHHUЉ dHE؋@L@vpHEH輿HU؋RLHMHIHIHHPRj@IL#"HZFHƿH HEЋHHUЉ dHUHEHH'EEEJHEHUHHHHHȋtqHEHHHEH@H|SHGRIL!.HEHƿ/HHEЋHHUЉ dHEHUHHHHHH@H@XHH!HuqHEHYHHEH@H2|SH!RIL$!0HDHƿHHEЋHHUЉ d%}HEHUHHHHHH@9EHEH譽HHEHUHHHHHH@DHEH@H]{HSATH*FRILq 3HDHƿH HEЋHHUЉ d~0IHEHUHHHHHH@EEHE؋@L9EHEHHEEE}HEHUHHHHHȋMHEHUHHHHHȋtvHEHZHHEH@H3zSHERIL%@HBHƿHHEЋHHUЉ d!HEHUHHHHHH@H@XHH!HuqHEH謻HHEH@HySHjRILwEHIBHƿHHEЋHHUЉ dx}HEHUHHHHHH@9EHEHHHEHUHHHHHH@DHEH@HxHSATHCRILHHnAHƿH HEЋHHUЉ d~6HEHUHHHHHH@EEHE؋@L9EsHEH@H@% HtHUHEHHHEH@H@HtHUHEHHSHEH@H@HuKHEH@H@%Hu5HEH@H@HH!HuHEH@H@HtHUHEHH=mHEHFHHEH@HwSH*BRILZH?HƿsHHEЋHHUЉ dHUHEHHFHe[A\]UHSHHH}HuUHMHEEHEH@XHHEHGHEH}tHEH@H@Hu|HEHMHHEH@H&vHHSHBAPEPILiH>HƿoH HEHHU d@/HEH@H@H HEH@XHH!Hu|HEH蜷HHEH@HuuHHSH@PEPILlmH.>HƿH HEHHU d.HEHHHEH HHEH@HtHHSH9@PEPILpH=Hƿ.H HEHHU dZ-HEHH@XH H!H0HEHH@XHH!H HEHAHHEH@HtHHSHPPEPILrH<HƿcH HEHHU d/-HE`t|HEH貵HHEH@HsHHSH>PEPILuHD<HƿH HEHHU d,HEHHt>HEH@XH0t+HEHH@XH4tHEHEEHEH@XH-tHEHEH}HEH@HHDMHEHv~HEH蒴HHEH@HkrHHSHPEPILbH$;HƿH HEHHU d+HELv~HEHHHEH@HqHHSH`PEPILH:Hƿ#H HEHHU d*HEHPHu|HEHrHHEH@HKqHHSH<PEPILBH:HƿH HEHHU de*HEPTHEH@PHH'u|HEHֲHHEH@HpHHSHM<PEPILHh9HƿH HEHHU d)HEH@H@XHH!HHEHt|HEH)HHEH@HpHHSH;PEPILH8HƿKH HEHHU d)}|HEHiHEH@H@XHH!HGHEHnHHEH@HGoHHSHPEPIL>H8HƿH HEHHU d\(HEHt|HEH߰HHEH@HnHHSH:PEPILHq7HƿH HEHHU d'HELt|HEHUHHEH@H.nHHSH:PEPIL%H6HƿwH HEHHU dH'HEHPHt|HEHɯHHEH@HmHHSH9PEPILH[6HƿH HEHHU d&HEHXHt|HEH=HHEH@HmHHSH"9PEPIL H5Hƿ_H HEHHU d0&HEH@H@XHH!Ht|HEH裮HHEH@H|lHHSH28PEPILsH55Hƿ H HEHHU d%HEH@H@%HHEH@XH3t|HEHHHEH@HkHHSHPEPILH4Hƿ H HEHHU d$HEH@H@HHEHHAHEHH@X%Hu|HEH6HHEH@HkHHSH07PEPILH3HƿX H HEHHU d)$HEHH@HEH}tHEH;H9Et|HEH芬HHEH@HcjHHSHYPEPILZH3Hƿ H HEHHU d}#HEH@H@HHEHEHHHEH@HiHHSH5PEPILHs2Hƿ H HEHHU d$"HEH@H@HH5HHHHEHEH@HH9HEHHHEH@HhHHSHPEPILH1Hƿ7 H HEHHU dX"HEt!HEHE!Ѕ$HEHeHHEH@H>hHHSH4PEPIL5H0Hƿ H HEHHU dS!HEHHHEH@XH"t|HEH轩HHEH@HgHHSHPEPIL HO0HƿH HEHHU d HEH@H@H tHUHEHHHEH@XHH!HHEHUt|HEHHHEH@HfHHSH%PEPIL Hv/HƿH HEHHU dHEH@H@%HHHE@LuHEHHEH,HHEH@HfHHSHy2PEPIL H.HƿNH HEHHU dHEHH@H-HEH}tHEH{H9Et|HEHwHHEH@HPeHHSH PEPILG H .HƿH HEHHU djHEHHHEHHHEH@HdHHSHN1PEPIL Hy-Hƿ H HEHHU dFHEHHHEH}tHEH:H9E HEH2HHEH@H dHHSH PEPIL H,HƿTH HEHHU d HEHHt|HEH补HHEH@HzcHHSHP PEPILq H3,HƿH HEHHU dHEH@H@H hHEH@XH H!Hu|HEHHHEH@HbHHSH PEPILH+HƿH HEHHU dHEH@XH$t|HEHaHHEH@H:bHHSHX PEPIL1H*HƿH HEHHU dTHEPTHEH@PHHu|HEHţHHEH@HaHHSH<-PEPILHW*HƿH HEHHU dHEHEHEH#HHEH@H`HHSH-PEPILH)HƿEH HEHHU d=HEt|HEH蔢HHEH@Hm`HHSH4-PEPILdH&)HƿH HEHHU dHEt|HEH HHEH@H_HHSH,PEPILH(Hƿ,H HEHHU dHEHH:u|HEHxHHEH@HQ_HHSH;,PEPILHH (HƿH HEHHU dkHEH@H@X%Ht|HEHHHEH@H^HHSH+PEPILHx'HƿH HEHHU dHEH@H@H HEH@XHH!Hu|HEH5HHEH@H^HHSHlPEPILH&HƿWH HEHHU d(HEH@XH%t|HEH覟HHEH@H]HHSHPEPILvH8&HƿH HEHHU dHEHHHEHHHEH@H\HHSH *PEPILH%Hƿ8H HEHHU dHEHH@XH H!Hu|HEHtHHEH@HM\HHSHPEPILDH%HƿH HEHHU dgHE=v|HEHHHEH@H[HHSH(PEPILHy$Hƿ H HEHHU dHEHHHEHu|HEHBHHEH@HHSHPEPIL H#HƿdH HEHHU d5HEH@hHqHEH@hH@XHH!Hu|HEH藜HHEH@HpZHHSHPEPILg H)#HƿH HEHHU dHEH@hH@X%HtHEH@hHHHEHHHEH@HYHHSH PEPILH"HƿH HEHHU d-HEt|HEH^HHEH@H7YHHSH&PEPIL.H!HƿH HEHHU dQHEHHt|HEHҚHHEH@HXHHSH&PEPILHd!HƿH HEHHU dHEH@hHt|HEHIHHEH@H"XHHSH%PEPILH HƿkH HEHHU d<HEH@`Ht|HEHHHEH@HWHHSH%PEPILHR HƿH HEHHU dHEH@H@H*q HEH@X%@Hu|HEHHHEH@HVHHSH$PEPILHHƿ9H HEHHU d HE@LuHEHHEHyHHEH@HRVHHSH$PEPILI!H HƿH HEHHU dgHEHH@H@XHx|HEHHHEH@HUHHSH#PEPIL#HrHƿH HEHHU dHEHEt|HEHBHHEH@HUHHSHPEPIL&HHƿdH HEHHU d5HE vHE =v|HEH視HHEH@HTHHSHPEPILv)H8HƿH HEHHU d HE$tHE$=?v|HEH HHEH@HSHHSHPEPIL,HHƿ-H HEHHU d HE,=vHE,=@v|HEHmHHEH@HFSHHSH<PEPIL=/HHƿH HEHHU d` HE0vHE0=v|HEHєHHEH@HRHHSHPEPIL2HcHƿH HEHHU d HE4tHE4=v|HEH6HHEH@HRHHSHMPEPIL5HHƿXH HEHHU d) HE8dv|HEH諓HHEH@HQHHSHPEPIL{7H=HƿH HEHHU d HE<tHE<dv|HEHHHEH@HPHHSHyPEPIL:HHƿ4H HEHHU d HE@tHE@=v|HEHwHHEH@HPPHHSHPEPILG=H HƿH HEHHU dj HEDtHEDdv|HEHޑHHEH@HOHHSHPEPIL@HpHƿH HEHHU dHEHdv|HEHSHHEH@H,OHHSH2PEPIL#BHHƿuH HEHHU dFHELdv|HEHȐHHEH@HNHHSHPEPILDHZHƿH HEHHU dHEPHEH9HHEH@HNHHSHhPEPIL FHHƿ[H HEHHU d?'HE\t|HEH誏HHEH@HMHHSHgPEPILzIH<HƿH HEHHU dHE`t|HEH HHEH@HLHHSHPEPILKHHƿBH HEHHU dHEHE  HE$ HE( HE, HE0 HE4 HE8 HE< HE@ HED HEH HEL HEP Ѕt|HEHHHEH@HKHHSHPEPILZHHƿH HEHHU dHEH@H@H)HEH@X% Hu|HEHQHHEH@H*KHHSHVPEPIL!_HHƿsH HEHHU dDHEHH@HHEH轌HHEH@HJHHSHPEPILaHOHƿH HEHHU dHEHH@H@X%@Hu|HEHHHEH@HIHHSHvPEPILcHHƿAH HEHHU dHEH@H@% HHEH@H@%HHEHHt|HEH_HHEH@H8IHHSHPEPIL/jHHƿH HEHHU dRHEH@H@%HHHEH@H@HtHE@LHEH@H@HHEH@H@% HHE@Tt|HEHhHHEH@HAHHHSHPEPIL8sHHƿH HEHHU d[HEH@H@%HHEH@H@%HHEHHt|HEH訉HHEH@HGHHSHPEPILxyH:HƿH HEHHU dHEH@H@HHEHHtvHEHHHEH@HFHHSHmPEPIL~HHƿ)H HEHHU dH]UHH`H}udH%(HE1EEEEHEHHEEHEH@H9EtSHEHPHHEPILHHƿlHEPUdHE؋@ 9Et_HE؋@ HUHRHHPEPEPILHqHƿH EPUd1HE؋PLHEH@@)‰UHE؋P$HE؋@P9tyHE؋P$HE؋@PE9tcHE؋PPHE؋@$HMHIHHRPEPILH Hƿ_H EPUdHEH@H@Ht~HEH@pHtqHEHPpHEH@XH9u\HEH@pH@HHUHRHPEPILH: HƿHEPUd}tHMUHuHEH[EVHEHUHHHHHȋuXHEHPHEPEPILhH Hƿ*HEPUdUHEHUHHHHHȋHEHUHHHHHH@HtZHEHUHHHHHH@H@ H9Eu.HEHUHHHHHH@@(9E HEHPHEPEPILH Hƿ(HEPUdSHEHUHHHHHH@Ht[HEHUHHHHHH@HPPHEH@PH9u(HEHUHHHHHH@H9EuSHEHPHEPEPILH HƿNHEPUd~ }HEHUHHHHHH@HHEHUHHHHHH@H@XHHEHUHHHHHȋHHEHUHHHHHH@H,bHEH}tHEHH9EtSHEHPHEPEPILH Hƿ'HEPUdW EHEHUHHHHHH@HHEHEH@H9EuEHEHHEHMHEHUHHHHHH@HH9u}HEHpHHEHUHHHHHH@HHHHEHUHHHHHH@H@HHUHRHVQPEPILHcHƿH EPUd }vvHEHHHHEHUHHHHHH@HPHEPQILHHƿrHEPUd }HEH@H@HHEH@H@%HHEHUHHHHHȋHEHUHHHHHH@HE؋@P9HE؋HPHEHUHHHHHH@HUHRHHQPEPILHHƿOH EPUd EHE؋@L9EHE؋@$EHEHHEHUHEHH9>HE9EtZHEHUHRHPEPIL\HHƿHEPUd}uGHEH@HIL  HHƿUEPUdHEHHEHEH@HEEEHEHUHHHHHȋHEHUHHHHHH@H9EuEHEHHt\HEH@H@H tEHEH@H@%Hu/HEHUHHHHHH@H9EuEEHE؋@L9E+HEHH9EuEHEHH9Et"HEHH9EtHEHhH9EuEHEHH9EuEHEH@H@H t#HEH@XH9EtHEHH9EuE}HEHpHHEH@HHHHE؋P HE؋@$D@HE؋P HEH@H@HH}HHHVQAPRPIL&HHƿH0EPUdGHE@9EHE؋P HE؋@$ЍxHE؋H HEH@HPHHE@HuLFHHuVWQRPML-HHƿH0EPUdEHEH@HHEHEH;EuE"HEHHEHUHEH@HH9u΃}uxHEHPHHE؋H HE؋@$ȍpHE؋@ HMHIHIHHRVPIL%=H'HƿH EPUdHEHH9EuEHEHHEHUHEHH9;HEHHEGHEH@HEH@H@HPhHEHH9HEHPHHEH@H@H@HHMHIHRPILLHAHƿHEPUdHEH@H@HYHEH}tHEHP`HEHH9teHEHPHHEH@H@H@HHMHIHRPILFTHHƿ0HEPUd`HEHHEHUHEHH9}3}HEH@XH0u_HEH@XH-uLHEH@XH u9HEH@XH u&HEH@XH%uHEH@XH$tGHEH@HILeHHƿ=EPUdqHEH@XH@@H!HHEHXHEH}tJHEHfuHEH}t3HE@Lu'HEHuHEHH@H9EtGHEH@HILnHHƿwEPUdHEH@XH'tgHEH@HH HHHuHHEH@HILtHnHƿEPUd~~1HEH@XH/tfHEH@HHHHHuGHEH@HILxHHƿEPUdHEHE9EtCHEH@HILZHHƿEPUdTHEH@X%HtAHEH@HIL5H7HƿEPUdEHUdH+%(tUHAWAVAUATSHHH}HuUHE@ U)‰UHEH@H@HuWHEHXHHEHuHSEPILH}Hƿ HHELHEDHEDHEXTHEDHEDPPHEDHLHELHEx8HEH@0HEHEDx(HEH$HEP HEHpHEH@HAVAUATSASARAQAPWLMEHHPHEH}u4LHHƿHEHHEHHEH@PH@HH Ju4LH'HƿMEĉEHEH@H@HtHEXLEEHEȋ@P+EHEȉPPHEUPPHEȋ@$+EĉHEȉP$HEUĉP$HEP HE@$HEȉP EHEHUHHHHHHEHUHHHHHHEHUHHHHHȋt%:HEHUHHHHHȋPHE@P HEHUHHHHHHPuHEAHPu4LH{Hƿ HEHUHHHHHȋHHEHUHHHHHH@HPHHE@ HuHvHHQRURURPILHHƿoH0HEHUHHHHHH@PHE@P)AHEHUHHHHHH@PHE@P4HEHUHHHHHH@HxHEHUHHHHHUHEAHD薭HCHCHu4LhHHƿu HEHUHHHHHH@XHEHUHHHHHH@H@H@@HjHUR HMHIHHSPEPEPRILH9HƿH07EALHHƿ,EHE@L9EXHUHEHHHe[A\A]A^A_]UHH H}uUHEHNHEH}uKHEH@HUHPALsHUHƿHHE@ 9Eu UHMHEHHu1LpHHƿ}JHEH@PHgu1L+HHƿ8UHSH8H}HuHEHt HEHt HEHHEYHEH@H"/HEH@H@@HHEH@H@@HUHRHR@HHHlHEH}HEHE؃}wWHEHHEH@H@@HHSILGHRHƿHwHEHE܋E܃u^HEHHEH@H@@HHSILNHHƿHHEHHEHUHEHH9H]UHHk/E}t+})}t } t C<5EAL!H)HƿUHH0H}HuHEHHH}tMHEILHHƿlHEHEHEHUH2HEH@`H@*HHHEH}tHEH HEHEHEHUHHEILH%Hƿ- EEH9EsEEALiHHƿEHEUHEHHEH@@HCHEH@`H@)HwHEHP@HEH@`H@HHHHEH}tuHEHuHHt`HEH@@H?HUPuILH HƿHHEHEHEHUHHEH@`H@+HTHEHP@HEH@`H@HHH{HEH}tuHEHuHHt`HEH@@HsHUPuILFH>HƿHHEHEHEHUHHEHP@HEH@`H@HHHHEH}t}HEHuHHthHEH@@HHUPuILHHƿBHHEHEHEHUHHEH@@HdHUHHPILH'HƿHUHH H}HuHEHHH}tHEHUHHEH@@HtnHEH@`H@-HtOHEHP@HEH@`H@HHH1E}yEEHcHEHHEH@@HQHUHHPILHHƿHUHHH}HuHEHUHHH5HEPHEHEH@HUHHEHPHEH@HH0UHHPH}HudH%(HE1HEPHEHEHEHEH@HHEк HHHEH@HPHEH@HRhHHEH@HH@HEкHH0dHEH}t)HEH@H@H@hHpHUHEȹ HHEH@H@H@hHPHEH@HH*HEdH+%(tlUHHH}HuHxtdH%(HE1HEH@HEHEH@HEHEHHUHPIL9HHƿHHE(H螥HEH}u;HEIL=HHƿJHxH@pHuOHxH@pHUHPILBH>HƿHtHxHCE}y4L~IHHƿW}t;HEILHLHHƿJHxHP`HEH@H9tSHxH@`H@8HUHPILRH9HƿHHUHxHHItOHEHHUHPILYHHƿzHBHEHHEHHHxHBpHxH@pHu;HEIL_H\HƿHEHHhHxHx HHHEHxHxǀHxHHHHxHHEH@H@L@HEH@HUHxHHAЅu;HEIL sHHƿ-HUHEHH;HuHxHEHH<HHxHM@HH:u.L{HHƿEHUHHEPIL{~HHƿeH-HEtnHEHE9uVHEHEHHMRPIL/H?HƿHHxHEHHau4L~HHƿ藿cHEHxHкH9spHEHxHHEHHMHjRPILHYHƿH HEHxHPHUHEHHHEHxHEHEHxHEHEH@H@hHHE*HEH@H9xuHEH&HEHHEHUHEH@H@hHH9uHUdH+%(tYUHSH8H}HuHUȉMHUHEHH8HEH}uw}u"HUHEHHm8Ht hHEHHUHPILGHHƿqHHEؾH.uHEоHt HUHEHHHUHEHHRHEH@HEHEH}HU؋)HE؉HEH}HUЋHEЉHEH}HEH})HE؋)ȉHE؉HEHV}HEH`})ÉHEЋHEЉH]UHH H}HuHUHUHuHEHUHH0H}HuHEHEHEHHEEHEHUHHHHHȋHEHUHHHHHH@H@HtzHHEHpHEHHKu1L$zHHƿ1;EHE@L9EAHEHHEHUHEHH9UHHPH}HuHUdH%(HE1HEHEHEHEHUHEHH6HEH}uOHEHHUHPIL]HHƿWHRHEȾHtBHEHIL2HRHƿHEH轤tBHEHILHHƿ襹HEH@HUH wHH|u1LBxHHƿOQHEH@HUHH u1LwHYHƿHUdH+%(t&UHH H}HuHEHE}tEE-UHEIL#HHƿ}HEHHHUIHHJH¾H#HǸ蟮H#H|t8L #LHNHƿUHH0H}HuHUHEHHHEHEH諱EHEH蜱~+UH9s?~+EAL[)HHƿeHUHEHHgu1L v/HpHƿMHUHEHHSu1L2H(HƿҶUHSH8H}HuHUHEH@HEHEHHEHHUHEHH裖HUHHEHHu;HEILBHHƿ*XHEHHE(HEH@H@pHt#HEH@HPpHEHH3HEHXHUHEHHHCpHCpHuGHEH@HtILLHHƿsHEH@H@@H諼HuIL RHwHƿ!HHEH@HHEH@H@H HHEHHEHUHEHH9H]UHH H}HEH+tyH}t HEHH\IL^HHƿZL`HHƿ0eHEH褗E}tKHEHHEPILhH*HƿԳHUHH H}HEHHEHEHHE@HUHEHHBHEHUH8HHHEHEHEHHEHUHEHH9uUHSH8H}EHEH3uBHEHILZH5Hƿ߲HEH8HEHEH@HEHEHu_HEHHEHqHSILHHƿXHHEH@H@HPHHEHPpHEHHHHEHHEHHEHpHH[uBHEHpILTHHƿEvHEHHMHHuWHEHHEHwpHSILHHƿOHEHEHHEHUHEH8H9^HEH"HEHH44HEHHEHHH_u*LoHHƿ蹰}tJHEHqtILDHHƸk8HEHIL7HHƿ1EH]UHH H}HEHEEUHH0H}HuHUdH%(HE1HUHMHEHHvWu4LnHHƿ蘯HE؋E9s UHE؉E HE9sTHEH謶UHMHPRILGHoHƿHHUdH+%(t8UHH0H}dH%(HE1EHEHHE5HEH@H@@HUHMHHu#HEHHEHUHEHH9uHUdH+%(t螭UHSHHH}dH%(HE1EHEHtHEHHЖt HEHHEHEH@H=pHEH@H@@HUHHXWtsHEH@HlHEHEH;EsVH]HEH@HuluSILHHƿNHEHEHHEHUHEHH93EHUdH+%(tGH]UHSHHH}HudH%(HE1EEEHEHIL8 HHƿ荬HEHXt4LAkHHƿNHEHHEzEEHEH@H@@HtIHEH@H@@HUHMHHSt)E̅t%}uẺEE9EtE)HEHHEHUHEHH9oHEHHEHEHHEH@HijHSIL 'HHƿAHHEH@H@@HUHMHHuGHEH@HjIL,H3HƿݪEEHEH@H@@HUHMHHVRuBHEH@HiIL{4HHƿe}E̅E9EHEH@u}t>E̋UHPAL*8HBHƿHFE̋UHPAL$:HHƿ让HHEHXHEH@H~hHHEHHJuXHEHHEH@HHhHSILAHvHƿ HSHEHHEHUHEHH9eHEHHEHHEHHHYHUdH+%(tH]UHH0H}HuUHEH@PH@H@@puWHEH@HHUHRPHHPILSHHƿ.H&}HEH@PH@HUHH(HEH}uXHEHPHHEH@PHHMRPILZHHƿ覧HHEHHEH@PH@HUHHuoHEHPHHEH@PHHMRPIL_HzHƿ$HHEHHEHH^UHH0H}HuUHEH@H@@puBHEHILnHHƿ蓦 }HEH@HUHH蕆HEH}uOHEHHUHPILrtHrHƿHHEHHEH@HUHHufHEHHUHPIL%yHHƿ觥HHEHHEHHUHH H}HuHEHNHEHUHMHEHHsuHEHEHEUHH0H}HuU܉MEHEHH HHtHE@p}x }~7EAL<HHƿ薤E}x }-EALHHƿLE}HEH@ 9E}x }~9EALֿH6HƿE@tEALHHƸ藣}x }~:EALƿHHƿXEEUHHH}HuHEHHEHH>u4LaHGHƿHE@ u4LOHHƿ豢HE@u4LPHHƿrHEH@`@pHEH@Hu HEH@HEH@Hu HEH@HEH@H=wHEH@H=v1LܾH,Hƿ֡UHHH}HEH@HH6HEH@HUHHH}HEH@@HHEHPHHEHP@HEH@HHEP,P,UHH}HEHHE)HEH@H@H?t#HEHHEHUHEHH9uĸ]UHHH}HEHHE&HEH@Hot#HEHHEHUHEHH9uǸUHH@H}HudH%(HE1f)EfEEHEHEHUHEHH-HzHEH}u/L^ HSHƿHEHhH3u6HEILH Hƿ賟PHEH@`HEHǀHEǀ HEǀHEǀHE@PHEǀLHEH@`H@HH`HEH@`HUHHHEH}u/LUHMHƿHUHEHHBHEH@H@H@H@PHt_HEH@H@H@HHPHEH@HUHHхu3HEIL$HHƿi HEHEH\tFHEH{u*L]+HjHƿHEH趛HuHEȹHvu*L\+HHƿHEHB{HUdH+%(tޜUHATSH H}HuU܋]HEHHHHtuM܋]HEHHHHH)HEHUHEHHHtIL5HAHƸUHH H)H;EUHH H)HHEHH(IċUHEHHHHUHEHHATSILM:HHƿ_HMHEHHe[A\]UHSHHH}HuЉỦMDELM}EHHHHH>}HE؋HEHHHHE؋HEHHH)EH}u4LXHHƿm^HEHHUHHHtILs[H^HƸ HE؋HEHHMHHTHE؋EHEHH9EtMHEHTẼ}LhHHƿ胚tHE؋Ẽ}HEHILظpHHƿ*EALVsuHFHƿHEUȋẺƉ%E}u\EĉHHEHEHHLHSILAzHHƿkH]EĉoHHEHEHHH‹EPSIL }HbHƿ HEH]UHH`H}uUHMdH%(HE1E+EEċUHEHHEH}u4LHHƿ臘HEHsLHHƿ:HUHEHHr-UHEHEEHHEHЋU!Ѕt EăEEPH HUHʋM΃H HEH UHEЉHbu HǸN7yGLXHHƿ8HUHEHHq+HEHHHMHEHH/suGLaH!Hƿ˖HUHEHHqEčPU;EHEH HHruDLHHƿSHUHEHHpIHEHsUPEPAL޵ HNHƿHHEHUdH+%(tUHSH8H}ȉuHEHyEEHEH3zHEHyHUHURSPEPILb HHƿTH }u cHEHHGHEH@UċuHHEH}u4LSH=HƿHEH@H@ HEmHEH辏uRmEHHEHЋU؃!ЅtHEH芏m}tqHEHHEHUHEH@H H9zHEHUHPALkH[HƿHEHEH@HUHHBnEH]UHH@H}ȉuHEHwEHEHwEE+EEE}u HEH xHUHURPEPEPILC HHƿ5H HEHHGHEH@UċuHHEH}u4LQH.HƿؒHEH@H@0HEHEHHEHEH衍tqmEHHEHЋU؃!Ѕt:HEHmHEHUHRH HHm}HEHEHEHHEHUHEH@H0H9SHEH@H@ HEmHEHtRmEHHEHЋU؃!ЅtHEH讌m}ttHEHHEHUHEH@H H9zHEHUHPAL߱HHƿ)HEHEH@HUHHckEUHSH(H}HEH uEHE؋Lui}uYHEHttIHEؾHu4LlOHϽHƿyyoHE؋LtHE؋LHEH*t9r[HEHt+EHE؉HFLN#HAHƿHE؋L9EsYHE؋L+EHE؉HLvN&HټHƿ胏HE؋L;EsRHE؋LU)HE؉Hsu1LN)HuHƿ"HE؋LuHEǀLH]UHH0H}HEHEHHEJHEH@H@hHt-HEH@HPhHEHHEHEH;Es HEHEHEHHEHEH9EuH}uHEHEUHH@H}HuHUHMEHEHHEHEHHEHEH@H@pHu EaHEH@L@pHEH@HUHMHHAЅu8HEHHvtHEHjHUHEHHHEHEHEHHEHEH9EdEUHHPH}HuHUEHEH@H HEHEH@H0HEHEH@H HEHEH@H0HEHMHUHuHEHEHMHUHuHEHEHEHtHEHu7HEHHuu%HEHtHEHtEUHHH}HE8H訂HE@ HE@HE@HEH@HEH@ HEH@(HEH@0HEH@8HE@H覿HcHEHPPHEH@@HE@XHEHǀHEHǀHEHǀHEǀHEǀHEHHHEHHHEHHHEHHHEHHHEHHHEHHHEHHUHH H}HuHEHkHEH}u1LHHƿ蠊4HEHUHP@HEHHHEHHHEUHSHxH}HuHUHEH@`HEHEH@hH@HEHUHEHH!HEHEHHEHEH@HEHEH@HEHE@ EHEH@(HEHE@0EH}u4LHHHƿ裉?HEH@XHtHEHHXHE HHSNHEHiu>HEH訐ILSH{Hƿ%HEHHEH@@HH2u>HEHGILYHHƿňaH}HEHH;Es9HEHGILHHƿkHEHUGHuILHHƿ+HHEHUHHEHGH9sO=HHEHFHSILsHHƿ轇HUHEHHMHEHH9s>HEHFILfHHƿ`HE(HbhHEH}u/LHkHƿHEHUHPHEH@hHUHH6HEH@hHEHEH@hʉHEH@hHEHEH@hʉHEHUHP`HEHPHHEHPpHEH@L@HUHMHEHHAЅu>HEHFEIL1HyHƿ#EHEH@`H@H@ HHEH@`H@LP HEH@pHHEH@`DEH}MHuEIHA҅u;HEHDILŧ HͲHƿwEE;ESHEH]UHH H}HuHEHHHEHHMHHɉHEH}uLHEHHE#HEH@H@@H9EuHE#HEHHEHUHEHH9uʸUHH}HuHEHHEHEH@H9EuHEHEHHEHEH9Eu׸]UHH}HuHEHHE HEH@H9Eu#HEHHEHUHEHH9u͸]UHH H}HuHEHHE/HEH@HHEHHftHE#HEHHEHUHEHH9uUHH H}HuHE/HD~HEH}tHEHEHEHEHHE0HEH@H@HHUHH莂uHE#HEHHEHUHEHH9uUHH H}HuHEHHhHE HHtfHEHHE=HEH@HH HEH HH诂u HEH@#HEHHEHUHEHH9uUHH H}HuHUHEHHHEH}t HEH@UHH@H}HuЉUHM}t HEH( HEHHEHEо/H|HEH}tHEHEHEHEHHEJHEH@H@H@HHUHHuH}t HEHUHHEH@,HEHHEHEH9EuH}t HEHUHH0H}HuHUH}t HEHUHEHHHt E@HuHEHHtEH}tHEEEUHH}HuHEHHE'HEH@H@@H9Eu HEH@#HEHHEHUHEHH9uƸ]UHH}uHEHHE2HE@ 9ErHEP HE@$9EsHE#HEHHEHUHEHH9u]UHH}HEHHEHUHEHH9tHE]UHH}HEHHEHUHEHH9tHE]UHH H}HEH@H@ HEvHEH@H@@HtZHEH@L@@HEH@HUHMHHAЅu1L=HCHƿ~)HEHHEHUHEH@H H9qUHATSHPH}HuHUHEHFtBHEHILޠHHƿX~vHEHE9tlHEHHEHEHHuHQRPALH.Hƿ}H HEHEHEHE9s]HEHHEHHMRPAL+HHƿE}H_HEHEDHEH`HEH`A9s]HEHHEHHMRPAL؟HHƿ|HHEH@HPHEH@H@H9tVHEHHUHHPILHHƿ7|HQHEHHEHEH@H@HHEHEHHEHEH@H@HHEHUHEHH!{uWHEHHEHHMRPIL,HרHƿ{HHEHHEHUHEHH9`HEHHEHUHEHH9HEHHEHEH@HUHHt[HEHHEH@H9HSIL8H HƿzHHEHHEHUHEHH9hHEHHE~HEH@HUHHqtXHEHHEH@H29HSILAH`Hƿ zH'HEHHEHUHEHH9kHe[A\]UHH`H}HuHUdH%(HE1HEHHtHEHH@XHEHEHHtHEHH@pHEEaEHDHtPEHDHUHMHHхu4L7aHNHƿxE}vHEHHE HEHHtSHEHHUHMHHхu4Lj7fHͥHƿwxRHEHHtSHEHHUHMHHхu4L7hHjHƿxHEHHtSHEHHUHMHHхu4L6jHHƿwHEHHtSHEHHUHMHHхu4LA6lHHƿNw)HEHhHtSHEHhHUHMHHхu4L5nHAHƿvHEHHtSHEHHUHMHHхu4L{5pHޣHƿvcEHEHUHHHHHȋujHEHUHHHHHH@HUHMHHхu4L4sHCHƿuEHEЋ@L9E]HEHHEHUHEHH9HEH{t}HEHHE\HEHxH@pHUHMHHхu1L54zHHƿBu HEHHEHEHH9EuHUdH+%(tJtUHHH}HuHEH@X%HumHEH@XH%HHEHPXHUHEH HHu1Lj3H͡HƿwtUHH H}HuHEHEH}t HEHPHEHHEHH UHHPH}HuHUdH%(HE1HEH@X%Ht HEH@X%Ht HEH@XH HHEHPXHEHEHEHEHUHEH HHE܃}tHUHEHMHHщEHEH@XH%HHEHPXHEH@XH HHEHPXEHUdH+%(tWrUHH0H}HuHUHEH@PH@HkUE}tQHEH@PH@HVu4L1HHƿrHUHMHEHHVEHEH\}tNHEH@PH@HTu1L1HjHƿrEUHH0H}HuHUEHEH@H^TE}tMHEH@HyUu4L0HHƿqHEHHE[HEH@HUHMHH8u1L0HHƿ)qEHEHHEHUHEHH9uHEHHE HEH@HHEHHEHUHEHH9u̓}tJHEH@H?Su1Lj/H͝HƿwpEUHH}HuHEHEH}tHEH@XHt HE]UHH0H}HudH%(HE1EHEHHEEtHEHUHHHHHȋuKHEHUHHHHHH@H@H1tHEH@XH HHEHPXEHE@L9ErHEHHEHUHEHH9UHUHEH HHVu1L-HMHƿn%EtHEH@XH HHEHPXHUdH+%(tmUHH H}u}tNHEHHE*HEH@HPXHEH@HHPXHEHHEHUHEHH9uHEH HH+u1L,H[HƿnUHH0H}HudH%(HE1HEHHEEHEHEH}u1L$HښHƿmeH}tCHE@Lt8HEHu&HEHH@H@H@@HUHH0HEE9s UHEHUdH+%(tGlUHH H}HudH%(HE1EHE@puHUHEH HHH}tJEHUHRHHPIL >HęHƿnlHUHEHEdH+%(tkUHSHHH}HuHEH@PHEHEHEEHEHH HEH@ HHOH9EtPHEHHUHRHHPIL%]HHƿkHEHEHHEEHEHUHHHHHȋHEHUHHHHHH@H@HEHMHEH@ HHjH9EtWHEHHEH)HSILtkHHƿjHEEHEЋ@L9E HEHHEHUHEHH9EH]UHSH(H}EEEUHEHEdHHUHHu`}.tZ}_tT}-tN}+tH}:tBEHuALHHƿiHE}:uH}tBEHuALHіHƿ{iHE}:uEE]HEHCcH9EH]UHHH}HEHHtHEHHu?HEHIL5H%HƿhUHSH(H}EHEH@PHHHHguvHEHHHEHHUHRPHHPILHrHƿhH`HEH@PHHHH@gHEHHHHgHEHHEHHUHRPHSPILAHHƿkgHEHEH@PHHvHHfHEHHQHHhft`HEHHEHpHUHRPHSPILHHƿfHEEH]UHSH8HdH%(HE1DžDžDžDžDžDžDžHHH`Hf)0)@)PH@PuEHHILʋHHƿeDžHH@`H H!HtEHHILHHƿZeDžHHPHPHu4L;HUHƿd HHHHH@H葼uYHH@HHHPILHϑHƿydHDžHHHHHHH9bHHHH;sEHHILH"HƿcDžHH@HH9HH@HHtHH@HHHKHHHPIL8HHƿ*cHDžHHHH@H@pHHGbtJHH@H!ILHHƿbDžHH@HHP HH֑HHH@HHE@HHDu*L! H~Hƿ(bHHHH@H HUSPILR H*HƿaHDžHH@HHHH@H^u^HHXHH@Hi HSIL HHƿAaHDžHHHHHH@HH9YHHPHH@HHPHѺ Hwu6L HHƿ`Dž.HHHHHHH9FHHGuEHHIL  HqHƿ`DžHHHHH@H@XH@H!Hu]HHHHRHRHHPIL& H݌Hƿ_HDžHHHHHHH9THHHHH@H@XH@H!Ht]HHHHRHRHHPIL83 HHƿ^HDžHH@H@XH H!HtFHH@H@HIL9 HHƿO^DžHH@H@HH!XHHHH(H(v_HH@H@HHH(PIL܆@ HHƿ]HDžHH@H@PHhHHRHH?HH@HHE@HH?u*L"I HHƿ/]HH@H@PHHhH`@HHn?u*LL H-Hƿ\HH@H@PHHHRHJHHH`RPHEPILхM HɉHƿs\H DžHH@H@XH(vUHH@HPHHPILT HFHƿ[HDžHHXHH@H9tFHH@H@HIL~Y HވHƿ[DžHH@HYsuFHH@H@HILd` H|Hƿ&[DžHH@@`uFHH@H@HIL;f H#HƿZDžHH@H@HH uFHH@H@HIL"l H‡HƿlZDžHH@HHHH@HuZHH@HHRHRHHPILDŽr H7HƿYHDžHHHHHH@HH9]HH@Hit 'HH@Hht HHHHHHH9‹9teHHPPPPAL̓ H HƿXH DžH0H0Hu9Lȃ HHƿRXDž`軄H@H@Hu9Lh HOHƿWDžHHHHH@HPHH0HH藈Ht]HHHHRHRHHPIL HHƿ[WHDžHH@HH H@ HH|HHH@HH HE@HHd9u*L H#HƿVHHHH@H@HHMRPILK HӃHƿ}VHDžHH@HJnuFHH@H@HILU HmHƿVDžHH@HHHH0HHHu9LC H HƿUDžHHPHH@Hp H@HѺ Hu6L HHƿIUDž.HHHHHHH9?H0HH HHu4L HHƿTDžHHH^HH@H@X% H/HH@HHHH@H@Ht[H@LHH@H@HIL HOHƿSDžhH@LtYH@LHHRHRHHPIL HHƿSHDžHHHHHH@HH9HHHHHHH9HH@H@@pugHtHuEHHIL* HHƿRDžHHXHtmHHXH@XHH!HuIHHXH@HIL~ HHƿ,RDžHH1t*L H;HƿQ]~HXHXHu9L~ H~HƿQDž HHhSbHHHu\HHHHHPILJ~ Hj~HƿQHDžHH3%Ht\HHHHHPIL~ H}HƿPHDžHHHt|HHtgHHHHHHRPIL} Hf}HƿPHDžHHHHH5OHHHHH OHHHζHHNt\HHHHHPIL.} H|Hƿ@OHDžHHu{DžoHHHt\HHHHHPIL| H|HƿNHDžHHHHHfPaHH@HH@,HH@HHHH@HSuDžxHHHHH4MPHH@HHXHH~HtlHH@HHH@H@HHHRPIL{R HzHƿRMHDžHH@HHXHHH9~Ls{X H=zHƿLDžOHH@H@XH4t/L*{_ HyHƿLHH@HHHH@H@HHHHPILza H{yHƿ%LHDžHH@HHtrHH@HHH@H@HHHRPILzh HxHƿKHDžHHHHHHH9HHH蚅wH8H8Hu9DžL q HNxHƿJHHH2\wHHHHHu9DžL v HwHƿJHHHnHH@ufHH@H@H@HHHHPILCy{ HcwHƿ JHDžHH@H@H H H@PH9tmHHH H@PHH HIHRPILy HvHƿvIHDžOH H@PHPhH HHu+ H HM@HH+u*L HGvHƿHH H@PHHhH`@HH4+u*L HuHƿHH H@PHH HJHHH`RPHEPIL'x HuHƿAHH DžH HH HH HHawHH HH HE@HHM*u*L H uHƿGHHH H@HHMRPILw HtHƿjGHDžH HPHH8HH'xHt^HHH HRHHPILmw HEtHƿFHDžH HHHH8H HHwu9LHw HsHƿFDžH Hp HHH HѺ Huu9L w HzsHƿ$FDž2H HPHH0HHvHt^HHH HRHHPILv HrHƿEHDžH H@hHuqH HpH~tZHHH HRHHPILv HyrHƿ#EHDžHHHHHHH9uH@HtH@HrH0HtH0HrHHHtHHHrH8HtH8HqrHPHtHPHVrHXHtHXH;rHUdH+%(tjCH]UHH}HuHEHHE HEH@H9EuHEHHEHEH9Euָ]UHH H}HEtHEHEHEH@pHEGHEH@tHEH@H@HtHEHEHHEHUHEHpH9uHEHEUHATSH@H}HEEHEHHE'HEH@H@HEHHEHUHEHH9uHEHHEXHEH@H@HEHEH!EHEH@`Hu!H}uEHEHUHEHP`HEHHEHUHEHH9u}t )HEHHEHEHHEHEH@H@HEHEtHEHEHXHHEL\tSHPMLr HnHƸMAHHEH@Hyu2L HanHƿ A0HEHEHEHHEHUHEHH9He[A\]UHHHxHpdH%(HE1HEHEHEHEHEEHpHHhHEк HHGCHpHHMHUHxHTHEHE7HEH@HEHpHH}HMHUHxIHUHEHHEHHEHEH'GILq9 HlHƿ?HUHMHxHHu9HEHFIL[q< HlHƿM?HEHHEHUHEH9THEHLHEH}u>HEHdFILqA H7lHƿ>HEH@ HEHEHMEeHEH6MUHEHVMHEHEILpK HkHƿb>HUHEHH&u9HEHEILpN HhkHƿ>HEHHEHHEHUHEH9HpHHUHxHHSHEdH+%(t<UHSHHhdH%(HE1EEEHhHHhHE HH;@HhH4?HhHHEHEH@HHHEH@HH7HHD<HEH@HHhHHEHPHhHHhIHu4LHop HiHƿz< HEH@HEHHEHUHhHH9 HhH.uEHhHILny H;iHƿ;V HhH$u4L~ HhHƿ; HhH@`HtEHhHILln HhHƿF; HhHt]HhHuEHhHIL$n H,hHƿ:G txHhHteHhH4HpuEHhHILm HgHƿU:HhHPt]HhHuEHhHILm H;gHƿ9VHhHШu4L HfHƿ9HhHu4Lmm HfHƿW9HhHtHhHHhHHNHhH@`Hu[HhH@@HtKHhH@@H/u4L H fHƿ8& t*Ll HeHƿx8HhHH Hh@(PHhP(HhHHE@Dž|HhHHEH@HHHEH@H@`H@L@@HEHHHEH@H@`H|HHAЅ|HhH@(HHEH}HEHPHEHPHEHhHHHoHhHHEH@H;HSILk HidHƿ7H HEHHEHUHhHH9HhHHEHEHHEyHEHHHhHHHu4Lb HcHƿo6HEHoHEHEHEHHEHUHhHH9mHhH@H@ HEHEH0HEHE@ HhHHhHHMHUH\ItWHhHHEH=HhR(SPAL)j HbHƿs5HHEH@H@ Hu6L"j HbHƿ45EHEH@L@ HhH@HUHhHHAЅHhHtPHhHILi HaHƿ4HE@ HEP :LV HaHƿc4E.EHEHHEHUHhH@H H9}u }HhHILb H7aHƿ3HEH@HEHEHEHE@ ulHEH@H@8Ht\HEH@L@8HhH@HUHhHHAЅu-LC H`HƿP3HEH@HEHhH@H H9EXHhH@H@ HEQHE@ 3HEH@H@(HHEH@L@(HhH@HUHhHHAЅLu H_Hƿ2HhH@H@ HEHE@ ulHEH@H@8Ht\HEH@L@8HhH@HUHhHHAЅu-L HH_Hƿ1HEHHEHUHhH@H H9^+UHHHxHpdH%(HE1HxH@`HEHEHEHjbHpH"HEH}u4L HWHƿ*HEH@hHEHEHHEHEHHEVHEH@H%HtHUHEHH!cHEH@HHEHEHEHHEHUHEHH9uHEHHtaHEǀHEǀHEǀHxHEHEHEHEHEgHEHKbHUHEHHbHEHEH@HEHEHEH@HEHEHbHEH}uHUHEH 3HH54u1L H;VHƿ(HEHUdH+%(t (UHHH}HEHHt*HEHH@H@HPhHEHHHEHUHH H}EHEHHE#HEH@HtEHEHHEHUHEHH9uʋEUHH`H}HuHUEEHEHEHEH HUHEH}u HEHHE1HEH@HEHE@P%}uRHE Hu4L;) HTHƿH'ESHEH 8HHPu4L- HBTHƿ&HEH,.HHEHHu4L0 HSHƿ&cHEHHEHEH9E}u :HEH qHHyu4L8 HkSHƿ&HEHHEEHEHHEEHEHUHHHHHȋHEHUHHHHHH@H@H@@HEH}uO}_HEHփILZA HRHƿ3%EHE@P%}uRHE H7u4LK H$RHƿ$ESHEH \6HHu4LeO HQHƿr$DHEH+HHEHH{u5L R HmQHƿ$EHE@L9E$HEHHEHUHEHH9}HEH HHu1LvZ HPHƿ#XHEHHEHEHցuuILKY\ HPHƿ-#HUHHpH}dH%(HE1EEHEHHhHEк HH%HEHHEWHEH@H@@Ht7HEH@Hu&HEH@H@@PPHEH@H@@PPHEHHEHUHEHH9uHEHHEH}u LHEHHEHƿ^[tPHEHILJH>HƿCHEHEUHHH}HuH}t HEuhHEHHt%HEHHUHH u3HEHHtHUHEHHtUHHH}HuHEt HEHHEHHt iHEHOtrHEHHUHHPILINH3=HƿHHEt HEHHtHE@tSHEHHUHHPIL_IZH<HƿIHrHE t[HEHHEHHMHRPIL:IdH2<HƿHUHHH}HuHEHHuoHEtVHE t?HEHIL={H;Hƿ8UHH H}HuHS=H8HEH}u4LH#;Hƿ HEPHHEH}u>LHH:Hƿ} HEHSHEHEHUHPHEHEPHEHUHPHEH HDHEH0HDHEUHHH}HuHEH@hH9EtRH}tHEPHEHEH@hHt!HEH@hH@H@HPhHEH@hHHEHUHPhUHH H}HuHEH@H9EH}tHEPHEHEHHE"HEH@HUHH%HEHHEHUHEHH9uHEH8HE"HEH@HUHHHEHHEHUHEH8H9uHEH@Ht!HEH@H@H@HPhHEH@HHEHUHPUHH0H}HuUHMLEHUHMHEHHCHEHEHEH)E؋UHuHEH+HǸu1LHV8Hƿ UHSH8H}HuHUHMDEH]HEHt HEH0HEH HHLBH}u HEH@@Hu4LKH7HƿX UHuHEAH F#Hu1LHV7Hƿ XHEH@@HUH F#HH:u1L)9H7Hƿ H]UHH@H}HuHUHMEHEHHEHEH@HUHHHEH}u1LHr6Hƿ _uHMHUHEAH}HMHUHuHEAHEHEHHEHEH9ESUHH0H}HuHU؉MHEHEH@@Hu1LM H5HƿZwUHuHEAH T#Hu1LH[5Hƿ"HEH@@HT#HH8HEHEUHH@H}HuHUHMDEHEH}uH}u H}MHUHuHEHHEH}tH}tHEH;Et HEHEUHuHEAH c#Hu1L.HR4Hƿ+HEH@@Hc#HH=8HEH{?UHH H}HuHEHHUHEH}u4L H$1HƿHH]UHH H}HEH<t>HEHHE"HEHtHEHHEHEH9EuԸUHATSH H}؉uHEH.HE}tKHEHu;HEIL >HC0Hƿ }uYHEHnHEH9u;HEIL=H/HƿHEHu;HEIL=H/HƿCb}t H1H1HUHPIL=HC/HƿHUHE؉Hlu4LH/HƿHEHHEHHHEHHAHEHHHEHATSIL=H`.Hƿ HHEHH HEHHGHe[A\]UHH H}HuHEHu4LH H-Hƿ{HEHHEHEH@HDHHEHHHEHHmt,HEHH9EtPHEH HHAu1LH3-HƿuHEHHEHEH9E\HEH HHu1L]H,Hƿt HEHUHSH(H}H}u HEH@PH@@Hu HEHEH@PH@@HEHUHEHH{HEH}uNH]HEH[]HSIL ;H ,HƿHHEHEHEH]UHHH}H}uhHEHeHHuGHEHZeHHu&HEHceHHzuUHHH}HEHHtHEHHEtUHH0H}ؿIHEHEHH+HHEH}u 5HEHHEHEHHEHEH@H@H@`H9EHUHEH@H@H@`H)H9UHEH@H4uXHEH@H@H@HHUHHPILe9#H*HƿHoHEH@H@H@HILU9'H)HƿHEHEHEHHEHUHEHH9UHSH8H}EEHEHHE^E7HEHUHHHHHȋ HEHUHHHHHH@H@HEHEHP@HEH@PHHHH*t[HEH@@HHHEHYHSIL*>H(Hƿ?HE\HEH@@H{HHEHYHSIL*AH:(HƿHEEHE@L9EHEHHEHUHEHH9}tF}t@HEHYIL7HH'Hƿ^K}t@HEHXIL)MHn'HƿH]UHHH}HEHHHt/HEHHHEHHHtUHHpH}HudH%(HE1HEHEHEHEEHEHHhHEк HH=HEHHMHUHEHAHEHEHEH@HEHEHHEHE@@t:HE@@u,HE@@uHE@@ uHE@@%tRHEHHURH0t H8H@HHHHӼH8H@HHHHu(H8H@HHHH0t HHH@HPIL  fHHƿsH0t"H8H@HHHHջ H8H@HHHH耻EH@HEH8HEHEH@HH`HUHEHHHpHpHu4L HHƿ HpHpH@ HEHEHHE7HEH%HEH}u9H@ILZ/HHƿ,DžX` HEHX(HEHRH@SPIL$/ HHƿHHEH@LPHpLXHhHMH@HHMIHAHxHxhXZHEHH@HPIL.HqHƿHHDžhHEHX(HEHIH@SPIL{. HHƿHHEH@LPHpLXHhHMH@HHMIHAHxHxucXuYHEHH@HPIL.HpHƿHHDžhHxH}uHxHEHEHEHxP(HE@(9uHxHC]Hx@(HUR(9HxLHEHHHxD`(HEHHUR(AUSATPAL7-HHƿ)H Dž\HEHHxHEHEHEHDžhHxLHEH(HHED`(HEHHxR(AUSATPAL,HHƿ~H Dž\HxHHDžhHEHEHEHHEHUHpH H9\t^H@ILA,HAHƿLG,HHƿHDžxH}tHpHUHHHpH}u>HpHL>HHƿKdOHEHHE$HEH@HHHHH聿HEH}HE@P%HEH*ILe+ HHƿHEHHpH@ HEdHEH8H9EuGHEHIL-+ HHƿ?HEH!%HEHHEHUHpH H9uHEHHEHUHEHH9H8HRHuMH@IL* 'HHƿHEH$HEHEH@`% HEHHpH@ HEHEHHEHEHHEHEHxhHEHHUHHHHHtYHEHWHUHHPIL* FHHƿHHEH` HEHEHEHHEHUHpH H9EE Hhu HpHxHHHhHhHpHtGHxHSu*LHHƿLHpHxH]u*LCHHƿPd%u4HpILHcHƿ EE }tM}tGHpHhHHt*LZ%HHƿMHhHpHxAȹHTHEH}HpHptGHxHпu*LH{Hƿ%HpHxHںu*LH#Hƿd%u4HpILHHƿEE HUHxHH<HEHu*L*$HHƿ,HEHHEHEH@HHE@HHbuEHEH@H@@H<HEHtHxtHxt[HEH@H@HHuHHpPHEPIL#H HƿPHHEH@H@HHtLHEH@H@HHpPHEPILV#HF HƿHAHpHHEPILK#H HƿHEHEH@H%HHEH@HEH@H@@HHpHURPIL"Hu HƿHHEH@HHEH@HHHEH@VHEH@H@@HHpHURPIL"H HƿHEHEHHEHUHEHH9L}u}tHEHoHEHuFHEHILHU HƿE EzHEHHEkHEH@HuGHEH@H@HILH HƿE E HEHHEHUHEHH9uHEHHEkHEH@H/uGHEH@H@HIL=HU HƿE EzHEHHEHUHEHH9uHEHn.u8HEHIL H HƿHx@t HEHHHM`HuHxHu/LHu HƿHUHxHHwu8EELH# HƿQHUHxHHu8E@ELnHHƿ{HUHxHHu8EELHHƿ)}u }HEH@`%HuFHEHIL~ 'H HƿEEEHxu|}u}tpHEHIL-HHƿcL.HHƿ9EE}tkHxuVHEH9tFHEHIL5HHƿEEC}HEH@H%t/LDHHƿrHEH@@HtFLtJHHƿ6HEH@@H贶HEH@@HEH@HHtFLQQH9HƿHEH@HHaHEH@HHEH@8Hu/L.WHHƿ HEHP8HEHHHxHHHUHB@HEH@@HL\H|Hƿ&HEH@HHtBHEH@HHUHPILaH,HƿHHEH@@HtDHEH@@HUHPILcHHƿHHEUHXHPH}HEH@HHtBHEH@HHUHPILxH]HƿHHEH@@HtBHEH@@HUHPILzHHƿHHPHUHH}HpH茿tIHxHu*L4HHƿAHEHHpHxHu*LڔH=HƿHEHiHUdH+%(tUHH@H}HuHUȉMDEdH%(HE1EE LE}HUHuHEHjMAHHHEHEHUdH+%(t}UHH@H}HuHUHMHEHEHHE+HEH@H@@H9EuHEH@HEHEHHEHUHEHH9uH}u4LHHƿHEHHEHEH@HAUHEH@HUHH|tyHEH@HFHEH}u1LHOHƿPHEHPHEHPHUHEHH{ HEHHEHUHEHH91UHH}HEH@XHt,HEH@XHtHEH@X%@Hu]UHHH}HEH@X%HuSHEH0SHEHEHu,HEHH@HLtHEHH@UHH0H}dH%(HE1EHEHhHHMHEH}u4LRWH=Hƿ_HEH@ H@XHu1L ZHHƿiHEH@ HHXHUHEؾHхu1L]HHƿEuHUdH+%(tUHH H}HEH@X%Hu HEHsQHEHEH@H@Ht HEH@XH t HE@LEEHEHUHHHHHȋucHEHUHHHHHH@Ht/HEHUHHHHHH@HEEEHE@L9Ec}tEUHSH(H}HEH@HHEH}uDHEH@H.IL#HHƿxHEH@H@Hu`HEH@H8.HHEH@H%.HSILH[Hƿ}HHEH]UHSH8H}؉uԉUЉMDEDMċUЋEHHEH;EEH9EHE¸)кHHЉẼ}uTUHEHHO0HtIL"HzHƸ?UHEHH/ILH>Hƿ`EH]UHH@H}ȉuHEȋ@L9Er:EALHHƿHEHUHHHHHHHQHEHUHAHEEăE]HEHUHHHHH4HEHE܃HHHHH HHVHHQHFHAEHEȋ@L9ErHEHE܃HHHHH HEHUHHQHEHAUHHH $H@HHdH%(HE1DžrRiMDžHDžHHpHHH@PHHHHHIIHHHǸSlyFHH*IL!H Hƿ+HH*HHHPIL HHƿHHHHHaHHu>HILHMHƿo HHZu]HH@HHHRPHHPILHHƿHHHhHHHѺH|bt;HILA HaHƿ#HH2jHHTHUdH+%(tUHH`H}HuHUMLEDMHEHH9EuHEHJuCHEHh(IL#HHƿ+t4L)HfHƿu:}t4L.H#HƿE~HEHHEmHEHPHEHHEH@PH@HH=u4L6HHƿHEHHEHEH9EuH}u\HEH@PHtHEH@PHuxLQ=H<Hƿ^HEHu4L ?HHƿSHUHEHHTu/LBHHƿf)E)EHEHHE}tEEHuH HHEHUHHQHEHUHAHQHzHEH$IL\H&HƿHHEHHE)HEH@HUHHHw;HEHHEHEH9Eu͸<HUHEHHSu4LiHHƿHEHHE)HEH@HUHHH:HEHHEHEH9Eu̓}tAHEHu1LssH Hƿ-iHEH@PHgtHEH@PHau,LjyHHƿHEH@PHUHHH}HuHEH@PHt!HEH@PHHMHH$THEH@PHHUHHQu1LHHƿ*UHH0H}HuUHEH@PHHEHEHHEHHH;HEHHEiHEHPHEHHEH@HH7u4LeHBHƿdHEHHEHUHEHH9uHEH@PH}tHEH@PHwu4L HHƿ6}HUHEHHu4LHsHƿHEHuCHEH ILh H HƿBHUHEHHOu1LHHƿFHEHDu1LHHƿUHH0H}HudH%(HE1HEHEE}u EHHPHHоHHkHHHH)H9tHH$HH)HHt%HHHHHHHHEEHHEHHEHHE0EPUHHHEHHEH@HHEHHEHEH9EuHEH{@UHuHEAȹH\HUdH+%(trUHH H}HEHHu HEHHEHEHǀHEHHEH@XH%HHEHPXHUHEHHu1Lr~H]HƿHEUHH@H}HuHEHEH}tHEHYt ]HEHHE-EHEHUHHHHHȋt HEHUHHHHHH@H@HEEHEHHEzHEH@HHEHHt EaHEH@H@@Ht7HEH@@Ht*HEH@@HP(HEH@H@@H@(H9u EHEHHEHEH9Ex}u;EHE@L9EHEHHEHUHEHH9UHH@H}؉uHUHEH=HEH}u HE@LEHEHEHcHHHHHH@HEHEHuaHUHEHHtJUHEHu1L{/HHƿ"mm}x }R}UHH H}dH%(HE1HEH@PHHUHuAHѺHu@HEHIL=H+HƿME=HUdH+%(tgUHHHHHdH%(HE1HDžHDžHDžHH;HHH@PHHHH@X%HuFHHILZH*HƿLu4L`HHƿHHlHPALdHHƿ辺HHHHu4LtoHLHƿnHHDžH@LPHPLHHH@LHHHHHH@HHH@XH%HHHPXHPPHHLHHu4L{xHfHƿ船.HHIL\H HƿBHu"HH1HHHH@PH@H謑HHu4LzHHƿ迸eHHHPHHHH6;+Hu4L{HHƿ=HH@PH@HHH?HHBHHH@HHu4L3HHƿͷsHH@PHHtDHH@PHHHH۶uHHHHHHoHHHOHѺHHuFHHILyHHƿHH6HHH|HH@HHHPHHHHHǸTVyFHHILH Hƿ,HH@PHpHHHuFHH^ILHHƿ軵aHH@PH@HpHH轕HHBHHH@HHu4LH)HƿKHHHHHH9mHHHHXu4LHHƿҴxcHDžH@LHHH@HHH@XH%HHHPXHHaHHHHHHH<u4LrHHƿHH@XHH!HHPXHHqu4LrHpHƿ蒳8HHjHtQHHHHu4LQHHƿHtTHHHHu1LqHHƿ躲cHtTHHHHnu1LOqH:Hƿ\HUdH+%(tUHATSHHxtHhH`DpD\HEHPdH%(HE1HEHEHxH1HEHE@LEHE@LEtEHPt HPpt HHpYE+tAHxHHHSATEPIL+HHƿH \tBE+tt4Lx1HHƿڰ DžtHE@LE}HEHEHcHHHHHH@HEHEHtHEH+Hhu4L>HHƿ2 H`HEHhHHх}unHxHu[HxH@X%HuFHxH?ILJHzHƿ蜯[ UHEH*u4LFnOH1HƿS mtm}xE+E;En}u EtE+tEttE;Eu  HEHbEEoHEHUHHHHHH@HHXHEHUHHHHHH@HHHPXHEHUHHHHHH@H]HxH@PHH@HHEH}u4LFohHHƿHEHUHHHHHHPHEHPHUHEHHfHEPPMHEHu4LglnHRHƿt3EHE@L9EHEUPL}HxHHEHH@HEHEH@XH%HHEHPXHEHHEHHEHUHxHHu4Lk|H}Hƿ蟬^\tNHUHxHHu4L~H&HƿHHxHu#HxH@XHH!HxHPXHxH,HEptH}uHEHHEHxH@XH )HxHHE!HEH@0 HHEHP0HEHHEHUHxHH9u}HxH ILHHƿ$HEHHEHxH@XHH!HxHPXHxHduMLiHHƿ贪sptHEHhHEH}IHEH@XH2HEH@XHHEHc*HEHEHILHHƿEHxH@PHH@H薂HEH}u4LhHHƿ诩nHEHUHHHHHH@HHXHEHUHHHHHH@HHHPXHEHUHHHHHH@H-HEHUHHHHHHPHEHPHUHEHHEHEȋ@L9EHEHJuCHEH.IL1HiHƿ苨JHEH&u4L:gH%HƿGHEH@Hu4LfHHƿHxH׃H E\uwHEHE`HEHHUHxHHu4LpfH[Hƿ}<HEHHEHUHEH9uH}tQUHMHxHHu4LfHHƿ H}tQUHMHxHHu4LeHHƿ赦t}HxHHEHQHEHxHHEH@HMHHxH@PHHUAIعHuCHEHILHHƿHUHEHHu1LdHHƿ詥kHPtE+EHPHxHU+UHPALHHƿ@HHUdH+%(tfHe[A\]UHSHXH}uHUHMDEdH%(HE1HEHKEHEHEEEE+EEHEH$@L9EsẺEHEH$@LEDEHMHUuHE}WH}WAH(Hu4L#cHHƿ0 E;Er}u&HEHHEH}uEHEHEE)EH}u}u}u}t EEH}t }}E+E9Eu,Lv3HVHƿxOE+EHEHU)HSALY5H Hƿ+HHUdH+%(tJH]UHH}Hu]UHH H},HEH"HkHEH}uCHEH ILWH[Hƿ}HEH@HuGHEH@HIL]HHƿ"HE@LpHEH@jjAAHHHu1LVeHHƿ谡 HEHOHEH}UHSHHHD@H@ILZHHƿԏHXHHPLHpIȉѺ@H莰HhHhu1LSNH>Hƿ`\HhHPH.u1LMHHƿ HhHUdH+%(t,UHH@H}HuHU؉MDEDMdH%(HE1HEHHuHEHHtXHuHEHHѺHHu4L)MHHƿ6oEHHPHHоHHkHHHH)H9tHH$HH)HHt%HHHHHHHHEEHHEHǃLMLE؋M̋UЋuHEH}WHHu1L LH Hƿ-iHEH@X%H H}UHuHEAH})u1LHHƿɌHUdH+%(tUHHpH}HuHUMDEDMdH%(HE1EHEHv HEHEHuFHEHH@H@HHHHHtHEH@HHEHӽHEHEH@HHHH謇HEH}HEH@HHUH)HUHEHHPHHоHHkHHHH)H9tHH$HH)HHt%HHHHHHHHEHUHEHHEHHHHUHEHH脋HEH۵HEHEH@HHEHµHEH}HMЋUHuHEIHKHEH}u4LHHtHƿ薊P}EHUHH9siHEH¸)кHHЉEUHEHHILPHHƿEHHUHuHEj}WAAHHu1LUHHƿ訉eHEHMHUHEAIH2u1Lu[H%HƿGHEHUdH+%(tkUHHH}HuHEHUHHEH@XH HHEHPXHEHoHUHEHHUHHPH}ȉuĉUHMDEHEH@PHHEHEȺHAHEH}u4LDGwH/HƿQHEHHHxHEH}u4LFzHڸHƿVHEȋHEH@PHUujuVuQMQAAH H0HEH}u4LHRHƿtHEHHHUHuHEL%HHEH}u,L HHƿeHEHMHUHEAIH袼u4LHHƿ跆HEHEHHEUHSHxH}HuUMLEDMdH%(HE1EHEHHt4LHHƿ iHEH!HHEH}tHEHXEċE;Euq}t}u HWuHsH·HEHHSILHUHƿwH}vzHEH}t,LHHƿ4LHѵHƿ<HEH莫HEH}u4LCH|Hƿ螄HEHHHHEH}u4LHHƿDMDEȋMHUHuHEj}WHHth} tLHEHHHEHHBu*L->"HHƿ:HEHb H}tvHEHpt(HEH@PHMAtHEH@PHGOu,L,HHƿ~HEH@PHzHEH UHH H}HuUMDEDM}u:}u4LAHHƿ:~E(t }u E(}t4LQHHƿ}h}v4LVHpHƿ}.} HuMUHEAIHkE(tc}v4L#bHHƿ%}} HuMUHEAIHE(t_}u&DE H}MUHuHEEIH$bDMDEMUHuHEH}W} WuHH /LuH=Hƿ_|UHH0H}HuUHMdH%(HE1HEH@PHUHMHHteHEH@PHEt H'H#RuIL&HHƿ{HHEH̾u@HEHILH?Hƿa{QHMЋUHuHEH!u1L:HHƿ{HUdH+%(t8zUHH@H}HuU܉MLELMȃ}u:}u4LHyHƿzuHEHHEHEH@H@Hu4LH!HƿCzHEH虨9ErJHEPLHEPALHʪHƿyHHEH>+E܃EHEHuOHEHH@H@XHt1}tEpHMHUHEAHPL}t1LHHƿ8yHUMHEHUHHH}HuHEHHHCxuHEHEHH_hHxu HE^HEHH^Hwu HE8HEILfH>Hƿ`xUHH}}t&})}t}t H/GHg>Hš5EAL HHƿwUHHH}HuHEH@H@%HHu@HEH+IL#HHƿtwnHEHUHHEHPXHEH@H@H t H HH HEHPXHEH裡HUHEHH~UHH H}HuHEHHEH}t1HEH@XHH!HtHUHEHHuDHEH@HIL 7HبHƿevHHEHZHEH@XHH!HEHPXHEHUHHEHǀUHHH}HuHEH@H@%HHuCHEHhILHH$HƿuHEH@H@H t H@ H@HUH}Iwu1L%4QHHƿ2uYHEH@HHXHEH@H@H t H H HUHRH HBXHEHhUHH@H}HuHUHMLEHEH@H@%HuqHEH@H@% Hu[HEH@H@HHUHRPHHPILUcHHƿ7tHHEHUHHEHUHPXHEH@HHXHEH@H@H t H HHUHRH HBXHEH@H@H tDHEH4HEH@XH4t%HEH@HPXHEH@H@H HPXH}tKHUHEHHF{u4L2}HHƿ#s|H}HEHHHEH@H@PH@HH觏HEH}u4L1H$Hƿr HEHUHP`HEЋtHEHUHRHpHH"HEHUHRHHHHUHEHH8zu1L1HHƿrqH}teHEH;EtHHUHEHHyu1L0H/HƿqHUHEHHLUHSH(H}HuHEؾHRHEH}u/L30HHƿ@qeHEؾHBRHUHBHEH@Hu/L/H^HƿpHEؾHQHEH}u/L/HHƿpHEHPHEH HZHHXHJHZHHHXHJ HZ(HH HX(HJ0HZ8HH0HX8HR@HP@HEH@HPHHEHPHHEH@HPPHEHPPHEH@HHEHPXHEHpH|HEH@HEH@HUHPHE\HEH@HHEH耼IL{HPHƿ]HEH9Er EH;EUHEHHIŋUHEHH IHEHHHUHEHHHAUATSIL&HHƿ@]H HEHB@TH;EHUHEHHwIHEHpHHEH@THEHHEATSILնHHƿ\HHEHHUPTHe[A\A]]UHHHHHDdH%(HE1HtFHH薺ILQHfHƿ[HH@Ht HGH HHRHHpIHHG|H¾zyFHHILHōHƿR[6HH@PHHHHoH0H0u4LH`HƿZgH0H@ H@XHtrH0H@ HHXHH@PHHхuBH0H@(ILH͌HƿZZ>H0HHjjAIHѺHHu4L HYHƿYfuAHH:ILe H HƿY=0HH@PHtHH@PH)u4L HHƿ-YHH@XHH HHPXHH@PHHHHuAHHCIL HHƿXf)P)`DžlHH HHPHXHHQH`HhHAHQHdH ,,uHƿLHEHHEHEH{EHE;EH}HEx`HEU)AHEDHEH8HE@LuAHEHpUHEjWuAPADHaH u1L HY~HƿKUHAUATSH8H}؉uHUHMLELMUHEHHMԺHH‹EHHEUHEHH]ԺHH‹EHHEHEHH9E!H}HUHEHH衬IHEH蚩HHEHHEHHyIіtATSMLqH6}HƸJHHEtuHUHEHHHHEHHEHHIOtHSML=H|HƸDJHHEHUHHEHH;E H}tyHUHEHHsIHEHHEHHZHHEHSATSILH |HƿIHHEtuHUHEHHHHEHHEHHתI/tHSMLH{HƸ$IHHEHUHHEHUHEHHcHUHEu1L$H5{HƿHHe[A\A]]UHHHXdH%(HE1HXH@PHhHhHXHthHhHXH9Xu HhHu4L2HvzHƿHbHXHPHHpHHzHǸyBHXH@HIL]6HzHƿGHXHPHHHpPILW;HyHƿAGHHhHHpHXH u1L=H]yHƿFLHXHeqHXH@XHH HXHPXHhHXHXHUdH+%(tEUHATSHHHdH%(HE1HHHXHPHPH@XHH!HuFHPH莤IL1NH^xHƿECHHHǀXHPH@XHH!HPHPXHPHoHPHHHH`HHt%H`_HCHXHXuFHPH蹣ILZHwHƿEnHXH`HHHHt[H`HHH5`Hs_Hu4LMcHwHƿDHHHHPHޢI.tH`PSML hHvHƸDHHHHH`HPHu1LmH;vHƿC#HHHHUdH+%(tBHe[A\]UHHH}HEH@`Hu&HEH@`HP8HEHH@HHd#UHHH}HuHEH@@HgJHH}uHEHH@HEHH#UHH}HuHMHuHHVHHQHFHVHAHQHE]UHHH}HuHUH}uHEHH@HEHH`'UHHH}HEHHEHH@HHeAUHHH}HuHEH@PHuHEHPPHEHH"UHHH}HuHEH@XHuHEHPXHEHH!UHH}HEH@`]UHH}HuHMHuHFxHHHQHHHAHQHE]UHH}HEH@@]UHHH}HEHEu HEH@pHUHHH}HEHHHUHEHH2tHEHEH3HEHEHEHHEHUHEH@H9uHEHE؉H3UHSHXH}udH%(HE1HEHH@HEHHHEH}u4LwHjHƿ7EEHEH@hH HEHEH@hH0HEЋEtHEHEHEHEHt@HEHHEUHEH2HEHHEHUHEH9u׸HEHHEHHo9uFHEHHILMHiHƿ6HUHEH 7HHBHUdH+%(t6H]UHH H}HEHH@HEHHuHEH}tHEHD_HEHHtJHEH@@Ht=HEH@@H=ILHhHƿ 6UHH0H}HuHU؉MDEЋUuEPALHhHƿ5HHEHHEHE@9EsUԋEЍPHE@9s(HE@9EHEPHE@Ѓ;EriHEPHE@ЍHHE@uԋUuuQPRAL&HgHƿ 5H HEHHEHEH9E4HEH HEH}u1Lg/HkgHƿ4,HEUԉPHEUЉPHUHEHHlUHH0H}HuUHM2UHMHEHH6HE2uHEHH9Et H;EsHEHEЉUHHPH}HuHUHMDEdH%(HE1H}MHUHuHEAȹHyu4LWRH2fHƿd3HE<:wHEHE<:fHEWEEE\-HHEHHH%tHHUHuHEHѺ HbHEHEHEt HE<:uEEHE<-ubHE,HHEHHH%HUHuHEHѺ H}HEHEHE<+uuHEo,HHEHHH%tHHUHuHEHѺ HuHEHEЋEtEPEЉEHEtHE<:EU9r EPE9sFEUHPALnHdHƿH1HUE)zMHUHuHEAHu1LHcHƿ0\HEF HEILHWcHƿ0HUdH+%(t/UHSHXH}HuHUMLEHEHEH@H@@HtHEH@H@@H7it4LyHbHƿ/HEH@HHE}tRHEH@HHu;HEIL=HUbHƿ/c}tOHEH@Ht;HEILHbHƿ2/}t[HEH@HEH@9u;HEILߏHaHƿ.HEHHE2HEH@HP@HEH@H@@H9u HEHEHEHHEHEH9EuH}HEȾ(HHEH}u4LsH`Hƿ-. HMHEк(HH0HEȾHHEH}u4L;H`Hƿ-HEH1eHEHUHP HUHEHHSHƿHEH@HP@HEH@H@`H@HHHMNHt3HEH@HP@HEH@H@`H@HHHLNHu 8HEPHEH@ @P+EHEH@HHHEHHEH}uHEH@HHEmHEH@H@@HV&UPuALHRHƿH}t|EHUHRHHH HHEH HHEH@H@@HHu1L@HQHƿMHUdH+%(tpH]UHH H}HEH@ Ht4L΀H+QHƿHEHUHRHHHWHEH}t@HEHEHEH@ Hu+HEPHE@HEPHEH!VHEHEHEHUHRHHHhWHEH}t8HEHEHEH@ Hu#HEPHE@HEPHEHUUHSH(H}؉uHEH@ HuWHE؋XHEH@HHSIL1HOHƿHCHEH@ @P9EuxHEH@HEH@+UԉHEH@ H@H@PHEH@ H@H@PUʉHEH@ HE@(HEHHE؋PHEH@ @P+EԉHEHpHEH@ H@H@PH@Hu1LCHNHƿDHEHUHRHHHUHEH}tHEHEHEH*H]UHHH}HuHEPHE@HEPHEHSUHH0H}HudH%(HE1HE؋@EHEЋ@EUE9C‰EHE؋PHE؋@ЉEHEЋPHEЋ@ЉEUE9F‰EE;EsE+EHUdH+%(tUHH0H}EHEHHEHEH@ HuFHEH@H@@Ht!ILg}wHHBHƿ;H}wHEHH\HEHHUЋӺHE}u[HEHHHEHCHSALtKHAHƿHE;EuPHE؋U쉐HEH\ILtSHAHƿ9HEHH‹EPEPILitXH6AHƿ HE9EsMUHuHEHMUHuHEHYH]UHSHhH}HuHUHMDEdH%(HE1HEEHEHOHEHEH@pHEEHEH@`@p%u6HEILsrHH@Hƿ HEHHHEHH}u6HEIL9:yH?Hƿ 2H}&HEH;EHUHEHHmHUHPIL,sH?Hƿ> H}$HUHEHHmHHUHEHHumHHEHHHrHǸǩHƿ :HEH9E}HUHEHHlHHUHEHHlHHEHHHrHǸ'Hƿ HEH9EuNHUHEHH]lHUuPILrH>Hƿ H=HEHUPuILyrH=Hƿ{ HHEHEHEHUHPILkrH=Hƿ5 HHUHMHEHHu/LH7=Hƿ yHEIL=H=Hƿ HEHpu0HuHEH@ HHẼ}tRHMHEHHu6HEILqHt<Hƿ) HEHu^HEHYtHEHWu>HEHuILBqH<HƿHHTtHEIL{<H;HƸuE}u0}t*LpH;Hƿ8EHUdH+%(tdH]UHH0H}HuU܃}t HE@HE@ EHEHHHEHE@ ;Er HEH@HHEHEHH9EuHEHPHEHHH>?HEHHHEP HEHʉPUHHH}HEHH?HEHHHEP HEH)щHUHH0H}HuU܉MHE(HHEH}u4L3H:HƿHEHHH‹EPEPILo5H:HƿHHEHUHHEU܉PHEU؉P HEP HEPHEHHHEHHUHH@H}HuЉỦMȋŰEЃEHEH;EsHEHEẺEHEHHHEE9EHEPHE@Ѓ;EHEH@ HHEPHE@Ѓ9ErHEPHE@+E E+EEMUHuHEHu4LbH!9Hƿ GHEPHE@ЉEHEHHEHUHEHHH9UHH0H}HuHUH}ucHEHHuHEѺHJu4L<tH`8HƿIzHEHHE^HEHHEPHuHEHu1L|H7HƿHEHHEHEH9EuUHH@H}HuHUHEHHEHEH@HHt!HEH@HHH!Ht0HEH@HHEH@HH!HHEH@HwHEH@H@@Hu(HHH6HH6H^HEHEHH HE6HEHHP@HEH@H@@H9u HEHEHEH@ H HEHEH H9EuH}HEؾ0HzHEH}u4L HD6Hƿ-HEHPHEHHEHH9HEHP HEHH9HEHP HMHEHHu2LH5HƿHEHHEHEH9EUHH0H}HuHUHEHkHEH}u1Le5H55Hƿ}HEH8HUHMHEHH8uRHEHILiH4HƿHUHEHHHEUHHH}uHEHHE@ ;Es(H9HH\4HH4HHE@ 9EsSHEPEHEPHE@ +EHEP HEP HEPHEHHHHEHHUHHH}HEHUHEHHHHEHHUHH}EHEHH HEHE@EHEH@ H HEHEH H9Eu؋E]UHSH}Hu}toHEHE@L9Et[HEH1XLHEH]H‹EPSILHEHRIL_&H(HƿNUHH}H}tMHEHHE6HEH@HHEH@HH!HHEHHEHEH9Eu]UHSH(H}HuHEHHEHEH@Htu4L_>H'HƿHEHPHEHHH u4L"DH'Hƿ/HHEHHEHEH9EMHEHHEHEHPHEHHH蔀u4LIH'HƿHEH@H-u4L_KH&HƿlHEHHEHEH9EMHEHHuTHEHHEHs,HSAL+^PHS&HƿHH]UHHPH}HuHUHMLEdH%(HE1HEHEHEȉHUHEHH.u4L%gH%HƿQHUHEHH`u1L%lHl%HƿdHEHE/HEȋPHEȉHUEHHHEH@H>HSILNHHƿBHEHEHHEHEH9EHEH>IL{HKHƿ}tHEHHUHHnHEHHUHHfnt@HEH >IL(HHƿjEEH]UHHH}HEH\UHH H}HEH2_HEHEH@XHH!Ht!HEH@XHH!HuH}u HEH@XH"uHEH@XH!t EHEHUHHHHHH@H@X%Ht5HEHUHHHHHH@H_t^HEHHt5HEHUHHHHHH@H^tEHE@L9EBUHH}HuHMHHQHEHUHAHEHMHuHHVHHQHFHAHMHEHUHHQHEHA]UHSHXH}uHEEHE@LEE}u4LKHnHƿ}t:}t4L H.Hƿg}u*HEH@H@HuHEH@H@% Ht}uJHEH@H@% Hu4L; HHƿHHEH@H@HtpEԺuЉЅt_HEH@H|:HHEH|HSILsJH+HƿH`EԺuЉEHE@LHHEHH@H@PH@HH莼HEH}u4L(HHƿA}t}}uGHEH@H9ILI:HEHƿ~EEEcE;EsEHHEH‹EEЉ:EuԉU܃}uEEEЉEHHEHЋUʉEHE@L9ErjEEHHEHEHE@L9ErEEԉEEEEE}EEЉ‹EЉEHEHUHHHHHH@HEHEH@X%HuE;Et EPU EPUUH HUHʉEE;EwE;Eu:EALnHdH Hƿ8EE;E4LlHX HƿHE@LEEXEHHEHЋ9Eu m2HEHEH HEHȋHHHHH HEHUHHHHHHHHEHEH HEHȋHHHHH HEHUHHHHHHH)EHHEHЋHHEHЋEEHHEHЋUH HUHʋH HUHʋEHHEH‹EEHE@L9EE}tH]UHSH(H}HEH@H@%Hu4LHf HƿdHEH@H\5IL H HƿEEHEHUHHHHHȋugHEHUHHHHHȋt:EALEH Hƿ.E]}RHEHUHHHHHH@H]4HHEHUHHHHHH@H04H‹EPSIL H HƿHE+EHEHHHEHUHHHHHHXH HHHCHHCHHu4L Hj HƿhE+EHEHHHEHUHHHHHHXHRHH(HCHHCHHu4Ld HHƿ}HEHUHHHHH4HEHE+EHHHHH HHVHHQHFHAHEHUHHHHH4HEHE+EHHHHH HHVHHQHFHAEHE؋@L9EHE؋@L+EHE؉PLH]UHHHXHPLdH%(HE1HXHPHLx HHLHPHpAIHH¾ryFHXHj1ILuBH-HƿPHpH,u>HpILDBHHƿvHXH@PHdHpHHQtmHXH@PHdt HVHzRHpRILAHHHƿHjHXH@PH@HpHHHhHhu1LHHƿ{HhHUdH+%(tUHHHHH@H84L(dH%(HE1HH9(tHH9(t H*HPDHkHP4L@H Hƿ'H@Hu HHH@HHPHpIHHH¾?pyFHHH.IL@H}HƿH(H HXHHHHPHXHpIȹHH`H`u>HpIL$@ HHƿH8HHH@PHH8fHHJHhHhu4LHyHƿHhH`4H8jXAIHѺH\Hu;HpIL_?HHƿH`HH`HUdH+%(tUHSHxH}HuUHMLEDMHEHENHEHEUHHHHHHEH@PH@HH誦HEH}u4L/H)HƿHEH^HEH}u4La4HHƿnHEH@H@Ht2HEȋ@Lu&HEȋuHEH@PHH;E HEȋEHEH@H@H t HnH{cHEHEH@PHHUHHHHEH}u4L=HHƿ}t%HEHUȋZL‹E‰EVHEHu HEHH@U‰E$HEHUȋJLHUR)ѺEH}HEH HEH`HEH@P}uHUujQuMQMQAAHWH0HEH}u4LcXHHƿpEH}UE UEЉHHHHHHEHHUHEIHHCHCHu@HEH VLgH(HƿUEЉHHHHHHEHHHEHH1H}UHHHHHHEHMHUHEIHHCHCHu=HEHXULpH`HƿMUHHHHHHEHHHEHHsEE;E]HEHTH]UHH@H}؉uԉUЉM̋EЅu HEHEЋUԋEH‹MкHHEHEHHH HEHEHH HEUHEHHu̺HUHH0H}uUMDE؋M؋U܋uHEHCEM؋U܋uHEH+E}uE0}uE%E;EuE9EsE+EE+EUHH}uUM܃}t%HEH@%HtHEH@HtEEHEHEH@HuHEH@HtE܅uHEHHEEtHEHHPEtHкHHEH;ErHE]UHH}uHEH@HuHEH@HtNHEH@HtE6HEH@H tHEH@%Hu HE@]UHHH}uHEH@H@%HuAHEH@@;Er1LH!HƿHEH@@U)‰UHH H}HEHFHEHEH@H@H tlEUHEHUHHHHHH@Ht*HEHUHHHHHH@MEHE@L9Er HE苀/LH-HƿUHHH}HuHEH@HuHEH@Ht$HEH@% HuHEH@% HtJHEH@% Hu?HEH@% Hu-HEH@HuHEH@Ht{HEH@HtHEH@Hu&HEH@HtHEH@Ht(HEHH(HEH@(HHѼUHHH}HuHUHEHHUHH}HE@(]UHSH(H}HEHPDHEHEHHEPLHEHH]UHH0H}؉uHEHDHEHE؋9Er4L#HHƿHEUԉP(EHEHUHHHHHH@Hu4L,)HHƿ9HE@(EHEHUHHHHHH@HHEHEUԉP(EHEHHEHMHEHUHHHHHH@HH9uEHE@L9E UHH0H}HEHBHEE_HEHUHHHHHH@Hu4LCHwHƿEHEHUHHHHHH@HHE:}u HE@(HUB(HEUP HE@$EHEHHEHMHEHUHHHHHH@HH9uHEHUHHHHHH@Hu1LNHtHƿEHE@L9EUHSHXH}uHEH@HEHEHQu4LdHHƿEmHEHUHHHHHH@HEH}u4LmHHƿ!!}t}t.DHEHEH)ÉډUHEEREHEH_E:EAL0{HHƿ蕿EuEHUH"u4L8~HHƿEE}t HEH HEHHEȋUHEH>HEH}u4L}H:HƿԾEEAHEHHEHEЋ@$EHUHEHHz}t HEHHEHEHEЋE;ErEHEHHE?}uHEHHUЉB(HEЋUP HEЋ@$EHEHHEHUHEHH9uEHE؋@L9EH]UHH0H}HuUHMHEH=HEHE@LwfHEHUHPHEU܉P8HEHUHHEH9 u1LM|HHƿZUHHĀH}uHUHMdH%(HE1HEHHEHEH=HEHE@8u4L{H4HƿμEHE@8EȋUȋE9C‰EHEH@PEHEHEHUHEH9HC‰EHEHuCHEHILZ-HHƿ$HUHEHHuCHEHmIL0-H0HƿʻHEHIHEH5;EskHEHtIHEHu4LFz HHƿS?HEHEH)EE}HEH@HEHEHEHEPLHEHEEEEEHE@8EEEHEH&EHE@LvHE@LE}w4Lly%HHƿyeHEH@H@%@HuJHEH@H@%Hu4L y(HHƿHEH@PHHPHH95HUHBHEH@HEH}u4Lx*HHƿ譹EEHE@8HE@8EEHEH& u4L:x1HHƿG3HEx`HEDDEMUHuHEjWu}WHPkH HEHeILX*8H(Hƿ¸HMUHuHEHu4Lpw;HHƿ}iHEH+EĉHEHKu4Lw@HHƿ&HMUHuHEHu4LvCH=Hƿ׷HEHru4LvGHHƿ蓷HEH@XH H HEHPXHE@H}}}t }t_HEHUHEH2LuWHRHƿHEHUHEHukLu]HHƿ薶L0(eHHƿbQH}tHEHHEHEHHUHRPHEPHHEH|HUdH+%(t9UHH0H}HudH%(HE1HEH5HEHEH_E}(HEH@H@HuHEH@H@HtgHEEщȅt4L'tHHƿ4HEEEHUHEعHu4LsH1Hƿ˴zEHEPHHE@HtDHEHIu4L]sHHƿjHEHk4PPHEUHE؉Hu4LrHnHƿHEH 4PPHEHEؾHu1LrH Hƿ観XHEH@XHH!HEHPXEH}t UHEЉHEH@XHH!HEHPXHUdH+%(tvUHHH}HEHUHHH}HEHUHH0H}uHUHMdH%(HE1H}tH}u1L|qHHƿ色vHMHUHuHEAHu1L)qHHƿ6#E9EuE;EsHUdH+%(t;UHH@H}؉uԉUHMHEH1HEUHEHEUHEHE}t}u4LapHHƿnHEHU‰EHEHU‰EHE؋HEEH)EMEHEuHHHEH;Es@HEHeIL"H(Hƿ°HEHEȉUHATSH0H}ȉuĉUdH%(HE1HEH0HEHM܋UuHEHdu4Lo HHƿ,UHEP$HEP$HEȉHEȋAċ]HEHHLH)HEH@PHHEHE;Es}u)HE@8uHE@8@}u HE@8HUdH+%(t賮H0[A\]UHSHH}Hu|xDtDpHEHhdH%(HE1HEH&/HEf)E)Ef~Et;xuCHEHV IL 3HHƿ賮HEH@PHEHEHHUHuAAHѺH&uGt4L:HHƿ1HEH@H9Et:tL@ ?H@HƸ߭HEH@H@HuHEH@H@HtzHEtщȅt[HEH HHEHNHSILBHHƿEHHMtxHEH%u4LkHHSHƿBHEHEHw)ÉډUHEHOËtHEHËU)‰U]HEH H‹Eȅt HHkTHSMQRILLHHƿ9H HEH HtEHSALPHBHƸH|HEH: HHEH?LH‹t+xHىHHǸnI H‹t+xv HtHRt+xRPAL' ]HHƿiHHhtHEHjAAHEHu4LhaHiHƿXtxHEH7uCHEHEILeHHƿ袩HEH6ugHEHILm qHHƿOHhHEHѺHu HEHIL. wHNHƿHhHEHѺH|u4LgyHHƿ蚨HE@L9xHEHIL HHƿDxE`HEHUHHHHHH@HEHEH@XH%HHEHPXHEH@XHH HEHPXEHE@L9ErHEUP8HEH@XHH HEHPXHUdH+%(tЦH]UHATSHHxHplhDdD`HE HXHE(HPdH%(HE1HxH0'HEf)E)Ef~EHE@8E}tE;EtEHEH@H@HH!Htd}w^HxH HHEH%GHSILHHƿiH `;duFHxHIL?HwHƿHMHU`HxHHEH@H9pt:tLVHHƸ荥HxH@PHHUHxAAHѺH uGt4LH}HƿHM`dHxHu4LcH&HƿuHEX(`HEH}ËU)‰UHxDHEX(dHEHID)‰UUEH‹UӺHHEEHxH@PHHxH@PHHHxIċEHxHRPHHxH@PHHHBHHxH8H‹Eȅt HMHKHATSRILyHHƿsH LHHƿEluIHxHHUHPAL}H]HƿHtHEILHHƸ貢{tLHHƸxHxHUHPALHHƿ4Hhu4LHcHƿlHxHMHHEHRBH‹d+`HىHHǸ?HHƿnUHSH(H}HuEH}HEHHEHEHsHHHEH@HxHSILH6HƿЖHHEH@HuEHEHHEHEH9EoEH]UHH H}HuHEHEHEHUu1L'UHHƿ4#HUHEHHtUHAVAUATSHĀH}Hu|xDtDpHE HhdH%(HE1EEEHEHHEHEH@H@%Ht-HEH@H@HuHEH@H@% HtJHEH@H@% Hu4LTHwHƿHEH@HUHH\u4LSH(Hƿ”WHE@LE}u4LqS HHƿ~HEH@PEЉE}w4L$S HHƿ1E;EsaHEH@HHuGHEH@HkIL  H.Hƿȓ]Eu4LyR HHƿ膓MpHuHEH͖u4L(R HHƿ5HEH蚢uCHEHIL0  HHHƿwHEH@XHH!HEHPXHEH1HEH@H9EHE9tHE9poE;EcHE@89ESHUHEHHNuCHEHIL ' HkHƿHEHeHtIL` , HHƸ译EuCHEHIL\ / HHƿnHEHǸ聧u4L P5 H|HƿHEH@H@HuHEH@H@%Ht}uE }wE}t4L6D HHƿ艐HMHUuHEH}E}t }tVUE9HEHIL+ P HsHƿ E9EEU)HEHWMHUHRR)SPAL \ HHƿ袏H3UHH|PAL c HHƿXHHE@89EUHEH@PHHHIHEHIHEH/HHE@8HEH@PHHHKItHAUATSMLm h HHƸ蔎H E;EskDMDEM|HuHEh}WHH LMs HHƿ'E9EswDMDEx|HuHEH}Wh}W}WHWH LL{ HHƿ訍=DtLEx|HuHEh}WHIHu4L.L HHƿ;HEpHE@Lu HE@L9EtTHUHEHǸuvLK HHƿ貌JHEH@PH&u1L`K HHƿmHUdH+%(t萋He[A\A]A^]UHH0H}HuU܉MDEDMHEH) HEHEH@H@%Ht-HEH@H@HuHEH@H@% Ht HEH@H@% Hu 2HEHPHEH@PHHH͌u HEH@HUHHu HEH@H@HtHEH@Ht HEH@H9EuPHEE9u?HE9Eu0HEPLHEH9EuHE@89Eu OHEH@H@HHEH@H@% Huz}u}tn}u HEU؃}u HE@8E9sCHEHIL8 HHƿ*HEH@H@HuHEH@H@Ht_HE@LvS}tMHEPLHEH@@)9Us4L HHƿ蝉HEE9t!HEH@H@Ht HEH@H9Et4}t$HEPLHEH9Et }HEPLHEH9EujHE@89Eu^HE9EuOHEHJHHEPILd HHƿ蜈H}u}tUHSHhH}HuHUdH%(HE1HEHZHEHEH赿H}uqHEHEHEH@PHH@HUHMHH(uCHEHhIL8 H+HƿŇ HEH@H@Ht HE@LtCHEHIL HȻHƿbHEHPHHEH@PHHӍHEH}u4LE HnHƿOHEX`HEH@PHEHEHEH@PHAH襽HEHEHPHEH@PjjSuQVAAHH0HEH}u4L0E HHƿ=HUHuHEIH蹴HUHHEHHu=HEH%LD H-HƿDžHEHHUdH+%(tބH]UHSHHhdHX`dH%(HE1HhHK|d+|EHEHhH8HEHhH@XHt4L3 HCHƿ݄ HhH?u4L9 HHƿ薄> HhH@PH4{u4L>C> HHƿK HEH跻HEH諻HEH@H@HHE@LHhH@PHH}HH&HEH}u4LBQ HHƿ誃R HhH@PHHUHHvuHEHhH@PHH{HUHEHhHHhHHӅHUHhH@PH@H[HEH}u4L\ H8Hƿ҂z HEHHHhHH2u4LnAa HHƿ{# HUHEHH tHEH@H@%Hu^HEH"HHhHHSIL<e H\HƿHD`H}HMЋUHXHhEIH\u4L@k HHƿ茁4HEH@H@HHE@LHEHEHEHH9EumHEHEUHEHXHhH HH聭HCHHCHHuaL?{ H<Hƿր~HEHEHEHHEHEHPHEH@HRHHPHHEHHEHEH9E:HEHLHEH@H@HHE@LsHEEHEH@0HH HEHP0HhH@PHHhHĵHHHHu4L> H#HƿeHhH@XHH HhHPXHhHHEHEUHEHH@HPXHEHH@HH HPXHhH@PHHHHdHUHBHEH@Hu4L= HDHƿ~dHHHHHHhH@PHH@HH_HEH}u/L HҲHƿl~CHE@LHHHHHHEHHEHHHEHUHdHHHHHHhH@PHH@HH _HEH}u/L[ H#Hƿ}HEHHt3HE@LHHHHHHEHHEHHXHEHUHHEdPL|t|xHEHE1HhHHHEH@HHSIL̲ HBHƿ|HHEH@HPXHEH@H#UHPXHEH@HHP0H#UHP0HEH@HHXHEHPxHEIȹH艜u]HhHHHEH@HHSIL HHƿ|HxHEHHEHUHEH9|xHEHE1HhH HHƿuHHEH@XHH!HEHPXHEH@XHH!HEHPXHEHuHEHiHUHEHH~tHUHEHH~u4L3K HoHƿ u%HEHUHHHHHHEHUHHHHHHEH 0HHHUHBHHEH@HHu1LP3Q HèHƿ]t|HEH ϫHH诠HUHBHHEH@HHu1L2T HbHƿsHEHUHHEHUHHe[A\]UHSHXH}uHUdH%(HE1EHEHHEHEHuHEH@PHt HEH@H@%Hu HUHEHH;tHUHEHHBu4L1 HNHƿrHEHHHrHEHH@HUHH'u,HEHH@HUHHu /Ln HHƿHrHEHH&H{qtoHEHHHHaqtUHEHH1HGqt;HEIL% H%HƿqrHE@LHEHkH9t4L HץHƿqq$EHU؋EHHHEHHt2HEHUHHHHHH@H!tEEHE@L9ErEUHH@H}uUHMLEDMHEHnEHEH@XH HEHE;Er{HEHIL H{HƿdHEHIL HBHƿcEEE;EuMHEH.HHEPIL~ HHƿcHEJE9Es&DEH}HM؋UuHEEIH}MHU؋uHEAHUHSHHH}ȉuĉUMLEHEHHEHE؋@Lu H H HEHE؋@L9Es H H HEHEHuCHEHIL HږHƿtb}}HEHHHEHRHHHMUHEIAHHHMHǸHEHo_uCHEH/ILHrHƿ>HUHEHHEHݜIL !HrHƿ:>HUHEAHѺHu@HEH}IL$H@rHƿ=HUdH+%(t<UHSH(H}HuUHEHHuWHEHHEHwHSAL4HqHƿD=H;H}tHEH9vt HUHEHHIu4L=H:qHƿ<HEH@t}tQHEHtHEH u1LaCHpHƿn<lHEHHuTHEHHEHvHSALIHHqpHƿ HEHUH°HHUHUHEAHѺHu HEH@XHH HEHPX}t%HUHEHugHEHYu1LUhHQHƿb!}tHEHluHEHUdH+%(tiH]UHH}HuHUHEHEH}t HEH HUHEuHEH@HPHEH@H!HtTH}tHEHPHEHH!Ht6HEPLHE@9tHE@LvHE@LHUR9rHEHE HEH@Hz]UHH H}HuUHMHUHMHEHHUHH0H}HuUHMЋUHuHEHHEH}tHEPHEЉUHHPH}HuHUHMLEHEH跛HEEEHHHEHEHH#EHHEH@H@H#EHuwHEH@PHHUHH肗HEH}tRHEHuHEHUHMHHхu1L:HIOHƿE}?>UHH}HuHEHEHEPHE]UHH H}HuHEHEHEHHHHEH@H!HuSHEH@(ILmSHNHƿ$HEHHEH@H HEHUHHH}HEH@(Hs8HH-u H}8HEH@(H{8HHu Hk8HEH@(H?8HHu H 8|HEH@(H08HHu H8UHEH@(HHHu HIP.HEH@(H8PHHdu HHUHSH8H}HuHEHHEHEHOHEHEHHHEHHHHEHEH@PHH@HUHH*HEH}t?HMHUHuHEIHHOHǸ+xHEH-HEHEH]UHAUATSHHH}HudH%(HE1EHEHHEHEHEZHMHUHuHEIH Hu4LvHKHƿHUHEHѺHHEH}zEuVHEHuHHEH起HSILH_KHƿHEv H HӾHEHPHEHHIHEHHƿ HEHUHHEHUHPHEHhIL\ H>Hƿ6 EHEHE{HEH@H4HEHPEHMH}I*u1LH">Hƿ !HEHHEHUHEH9tHUdH+%(tUHSHXH}HudH%(HE1H}tHEH:HHEHEHEHEH3HEEHEH@PHH@HUHHUHDЋEHDHtT}t H>HV)H}t HHMH|HMHuIHH¸qy4LNH<Hƿ[6E}7EuHMHEHUHHHHHHXHEHHq4HCHHCHHu4LH,<HƿHEHHtxuHMHEHUHHHHHHXHEHH3HCHHCHHu1L.H;Hƿ;EHEȋ@L9EHUdH+%(tJH]UHH}uUHEHUHHHHHH@HEHEHUHHHHHHEHUHHHHHHAHBHEHUHHHHHHEHBHEHHHEHUHHHHHH@HEHEHUHHHHHHEHUHHHHHHAHBHEHUHHHHHHEHB]UHH H}uUE;Es-EEEPMHEHvEE;Er+EEEPMHEHImE9ErݐUHHH}HEH@H@HuHEH@H@HtHE@LHHEH,;HEH@H@HtHE@LPHEHUHAVAUATSH0H}HuUMDEDMHEH~HEHE؋EHEH@H@%@HtHEH@%HukHEH@H@%HtHEH@%@HuCHEHpbILH38Hƿ-HEH2uCHEHbIL|H7Hƿz}HUHEHHXIHELp(HEHaIHEHPHEHH'HHEH蝣MMLHHHpHǸѠH"HƿHhHEH辱u4LJ@H!HƿW HEH@HtWHEH@HtDHEHiu4LGHS!HƿV } u HEE EEuHE@8EHEEHE@$EHEH@H@HuHEH@H@%HHEH@PHHhHUHBHEH@Hu4LQH Hƿ HEHH@HEPPHEPPHE@LHEP$HEP$HEHEP$HEPPHEǀHEHEHE@L9tHEHIHHEHlt)HSALZ} ZHHƿ4HHhtHEHjAAHNHKHEH@HtUHUHEHѺHu4LkHHƿHEH@H'tMHUHEH%u4L)nHHƿ6HEH@PHUHH u4LڨpHMHƿPLrHHƿHEHiHEHEH@HHEH@PHHeHEH}u4L({HHƿ5HEH@HH!HHE@L9tt4LǧH:Hƿ=HEH4GILz HHƿHE@LpHMHUHEHqu4L8HHƿEDE}MUHuHEEAHHE@LPHEPLHEHLxHuHEhjjjAAȉѺH2H u4LHHƿHEH@HH HHtHEH@HHHHu4LHHƿ,HEHPXHEHH HPXHEHPXHEHH HPXHE@LPHEPLHEHX(HEH9EHSILy HHƿHHE@LPHuHEѺHt)HE@LPHuHEѺHLH{Hƿ~HEH@HttHExLx|HuHEhjjjAAH$H u4LHHƿHEpHEH@HHE@Lt~HEH tHEH?HHuTHEHX(HEHCHSILHGHƿHFHEH@HL`w HHƿHEHu4LFHHƿSE"HEHUHHHHHH@HHXHEHUHHHHHH@HHHPXHEHUHHHHHH@HHXHEHUHHHHHH@HHHPXHEEщȅtVHEHUHHHHHH@HHXHEHUHHHHHH@HHHPXEHE@L9EDE}MUHuHEEAHgHEHRAHHEHWHSILu HHƿHHUHEHǸu4L=HHƿJHEH@HHE@LHEHu1L͠H@HƿFHEHx1u1LHHƿHUdH+%(tHe[A\]UHH H}HuUMDEDMHUMHEHUHH H}HuUMDEDMHEH aU HU(HEHjAAHѺH|HUHH H}HuUMDEDMHUMHEHUHH H}HuUMDEDMHUMHEHUHH H}HuUMDEDMHUMHEHhUHH H}HuUMDEDMHUMHEH/UHH H}HuUMDEDMHEH_U HUHEHH`UHH H}HuUMDEDMHUMHEHUHH H}HuUMDEDMHUMHEHqUHH H}HuUMDEDMHUMHEH8UHH H}HuUMDEDMHUMHEHUHH H}HuUMDEDM}MUHuHEHu(AAHHu1L-HHƿ:UHH H}HuUMDEDMHUMHEH;UHH H}HuUMDEDMHEH]@LDMUHuHEu(} W}WjAHH UHH H}HuUMDEDMHEHx]@LD@MUHuHEu(} W}WjAHJH UHH H}HuUMDEDMHEH]@LD@MUHuHEu(} W}WjAHH UHH H}HuUMDEDMLE(}MUHuHEMAH u1LG;HHƿTUHH H}HuUMDEDMHUMHEHUUHH H}HuUMDEDMHUMHEHUHH H}HuUMDEDM}MUHuHEHu(AAHHu1LJMHHƿWUHH H}HuUMDEDMHUMHEHXUHH H}HuUMDEDMHEHZ@LDMUHuHEu(} W}WjAHH UHH H}HuUMDEDMHEHZ@LD@MUHuHEu(} W}WjAHgH UHH H}HuUMDEDMHEH1Z@LD@MUHuHEu(} W}WjAHH UHH H}HuUMDEDMLE(}MUHuHEMAH'u1LdrH HƿqUHH H}HuUMDEDMHUMHEHrUHH H}HuUMDEDMDMDEMUHuHEu(} W}W}WHH UHH H}HuUMDEDMHUMHEHUHH H}HuUMDEDMHUMHEHUHH H}HuUMDEDMHuHEjjjURAAHH UHH H}HuUMDEDMHUMHEHUHH H}HuUMDEDMHEHWD@LMUHuHEu(} W}WjAHH UHH H}HuUMDEDMHUMHEHUHH H}HuUMDEDMHUMHEHGUHH H}HuUMDEDMHUMHEHUHH H}HuUMDEDMHEHV@LxMUHuHEu(jjjAAHH UHH H}HuUMDEDMHEHMV@LxMUHuHEu(jjjAAHH UHH H}HuUMDEDMHEHUD@LMUHuHEu(} WjjAH H UHH H}HuUMDEDMHEHUD@LMUHuHEu(} WjjAHH UHH H}HuUMDEDMHEH-U@LD@MUHuHEu(} W}WjAHH UHH H}HuUMDEDMHEHT@LxMUHuHEu(jjjAAHH UHH H}HuUMDEDMHEHgT@LxMUHuHEu(jjjAAHH UHH H}HuUMDEDMHEHT@LxMUHuHEu(jjjAAH7H UHH H}HuUMDEDMHEHS@LD@MUHuHEu(} WjjAHH UHH H}HuUMDEDMHEHAS@LxMUHuHEu(jjjAAHsH UHH H}HuUMDEDM}MUHuHEHu(AAH"Hu1LlHHƿyUHH H}HuUMDEDMHUMHEHzUHH H}HuUMDEDM}MUHuHEHu(AAH^Hu1LHHƿUHH H}HuUMDEDMHEHQ@LDMUHuHEu(} W}WjAHbH UHH H}HuUMDEDMHEH,Q@LD@MUHuHEu(} W}WjAHH UHH H}HuUMDEDMHEHP@LD@MUHuHEu(} W}WjAHH UHH H}HuUMDEDMHUMHEH芼UHH H}HuUMDEDMHUMHEHQUHSH(H}HuU܉MDEDMHEHOXLHEHOغNjM؋UHuHEu(jjjAAH H H]UHSH(H}HuU܉MDEDMHEHpOXLHEHaOغNjM؋UHuHEu(jjjAAHH H]UHH H}HuUMDEDMHUMHEHUHSH(H}HuU܉MDEDMHEHNXLHEHNغNjM؋UHuHEu(jjjAAHH H]UHH}uEHEH@H't)}uLEHEHPEHH!Hu)EPUHHHDHE}uE]UHSHH}HuUHEPLHEH@HKËUHEH8HHHHHHHHHH]UHATSH H}HuHUHEH@H9EuXHEH@H+HHEHmHUSPIL`H@HƿHdHEL`(HEHJmHHEH@H#+HUHATSPIL_HHƿtH He[A\]UHH}uEYHEHHEUHHHHHH!Ht*}HUHHHHHEPUu]UHHH}HEH@HVUHHH}HEH@H/UHHH}HEH UHATSHPH}HuHUHMDEHEHEH@H@PHHEHEHHEHEH@H@Ht!HEȋ@LuHEHH@Hu(HEHHEH@HH>t z HEHHX(HEH@H)HSIL^HHƿwHHEH@H@HtHEȋ@Lu HE HEH@H@HuHEH@H@% HHEHH@HH!Ht&HEȋ@Lw HHEs HEHH@(H_HHtIHEHH@%@H9 HEHH@% H HEHH@H HEHEH@H@HHEHH@%HHEȋ@Lt_HEH@H'HHEHiHSIL\H/HƿHq HEHH@Hu+HEHH@% HuHEHH@Ht HEHEHH@%@HHEHH@%HHEHEH@H@HuHEH@H@%HHEH@H@Ht;HEHH@%Ht&HEHH@%HHEHEH@H@%Ht=HEHH@Ht'HEH@H@%HPHECHEHH@Hu%HEHH@(H HHyHEȋ@Lt{HEH@Hx%HHEH}gHSILZH'HƿHHEHEHPHEHHEHEtHEHH@HH!HHEȋ@LHEvHEHEH@@HE HEHEHPHEHHED HEH@Hy$HHEH~fATSILYH*HƿHcHEH@H@Ht H HEHHE+HEHH@HuHEHH@HEHEH@H@%@Hu#HEH@H@%Hu HEHEvHHEHEȋPLHEH@@)9t*EHEHEH@@HEHEBHEȋ@LwEHEHEHEHH@HuHE}HED HEH@H"HHEHdATSILMX+HHƿHHEH@H@HH!HHEHH@HtBHEHHEH}tHEHH@H#EHSHHE@HEHH@HuHEHH@Ht1HEH@H@H#t HHEHEHH@(H HHpu1HEH@H@H#t HHEHEHH@HuHEHH@% Ht5HEH@H@HH!HEHHE2HEHH@Ht1HEH@H@HH!HuHHEHEHH@%HHEHgHEH}HEHHpHEHEH@H@%HHEHH@HHEH@H@%@HuuHEH@H@%Hu_HEH@HHHEHbHSILUPHHƿEHHEȋ@LHEH@HHHEHaHSIL\UVH<HƿH~HEH@H@HtZHEHH@(H?HHt(HEHH@Hu&HEHH@% HuHEH}HUHEHH<HUHHEHHu4L~gHbHƿHEHH9EHEHHX(HEH@HUHHĦHUHR(SPILFTjHHƿ舿HHEH@(IL=TmHHƿOHe[A\]UHAUATSH(H}ȉuĉUHEH1?HE؃}u4L}HLHƿeHEH@XHH!HtH}tHEH@H@% HtCHEHILSHHƿlHE؋9EuuHEHIHEH^HËUHEH@PHHHATSILbSHRHƿHgHE؋H8HEHpUHEH*u4L|HHƿ蒽HE؋EHE؋UHEHPHE؋9Eu~HEHIHEH]HHE؋HEH@PHHHATSILRHIHƿH^}UHEH@PHHH IHEHHËUHEH@PHHHLHHH:RHǸKZuCHEHuIL4QH8HƿҲIHEHuHEH@HEHEHu4LvJXHHƿ耲HEH@H@HtEEċEąuHE؋PLHE؉HEă}u HE؋@8EEHEH@HtEăw HE؋@LEĉEȋEȉ8u4LpjH(Hƿ±9}u HE؋EEԋEԅuHEH@PHH蠸Eԋ}UHuHE؋MQHMQAAHHuHUHEHHHEH.tCHEHILIzHSHƿd}ċUHuDEЋMHEEAH$}HuDMDŰMUHEHuDEAPWEHcH uCHEHILHHHƿ*HEHIL[HHCHƿݯTLOHHHƿ詯 HUHMHEHHҶu4LLnHHƿYEHEL`(HEH HHEHOATSILGHWHƿHHEHW HU؋JLU)эQHPALGHHƿ蠮HHE؋PLHE؉H_EHEH@H@HtEHE؋@8EH]HEH[.HEȉHHhHEHEHQtA}HuD]ȋMUHEuDEAPDEAPWLUAEHAH ]HEHPHEH9u}tUMHEHp-HEHuCHEH IL&HHƿcHEH@H't}t HEHX(HHEH:-HMIHEH SATILHBHƿܬHHEH@XHH!HEHPX}HuD]ȋMUHEuDEAPDEAPWLUAEHAH HUdH+%(t讫He[A\]UHH H}uUMUMHEHUHSHHH}HuHEH),HEHEHEH@X%Hu4LjH0HƿʫELEHEHUHHHHHH@H@XH HEHUHHHHHH@HUHHTHEHUHHHHHH@HHcHEHUHHHHHH@HEHEHUHHHHHH@H@XHt+HEHUHHHHHH@EHEHHEVHEHu8HEHH@H@HEHEH%Ht HEЋ@$EHEHHEHUHEHH9uHEHtUHPALC H/HƿɩHHEHHE.HEH HEHH@H@HEHEH%HHE苐HE苀)9UskHEHHHEH+hHSILB HiHƿHHEHtHEHOHHEHgHSILB HHƿ蘨HHEHHEHUHEHH9EHE؋@L9EL!gHHƿ.6LfHcHƿH]UHH0H}dH%(HE1HUHEHHtHUHEHHu1Lgf=HHƿtnHHƿHHPH~H@HoH0H`HH@XHtHH@PH@HH茀HuFHHIL%{HHƿSHH赳uFHHIL=H`HƿHH.HH@HHHRPHHPIL=HHƿ芣HL=HHƿ\HH@HHHRPHHPIL=HsHƿ HL=HEHƿߢL=HHƿ赢[DžHHHHHHHȋt*HHHHHHHȋu4L=HHƿHHHHHHHH@H6<HHHHHHHH@H;HHHHHHHH@HHHJuBHHHHHHHH@HHHJ,uKHH@PH诗u4L_H,HƿƠlHHHHHHHH@HHXHHHHHHHH@HHHPXHHHHHHHH@HHXHHHHHHHH@HHHPXH@L9?HtgHHuTHHHIL;HHƿkH HHHtHIL:HeHƸHH@L9uVHHKHHPIL:HHƿ蜞H>HH@@HH@@;sxHHHHH>HHRRHHSPRIL>:H^HƿH HH@H@HDžDžDžHHL񉕴Ѕu DžHHHHHHHH@HHHFHHHHHHHH@HHHtFunHHHHHHHH@H@XHu7HHHHHHHH@H@XHt;r>HIL8HHƿ4 H@L9](HH@PH衒u4LZHHƿ踛^ HHHH蜦t4L8HHƿd H0H@HHAIHHH@X%HuFHHqIL)H4HƿΚt thHPALq7HHƿsHHH@PH@HHHHu4LXHQHƿ DžDžHH@PH@PHHIL6!HHƿn uHHbtHH@PHHHRL+LPHHHPQMAH(HuFHHLIL69HHƿ詘O HPHmHHPHH@PHHH%u4L0WDHHƿ= HHHHHPH9uDžXHPLЉHHHHHHHȋHHHHHHHȋH@HHHHHH HHHHHHHu4LUWH]HƿHH@HHXHHPHIȹHͶueHHHHH@HHSIL\ZHHƿ[HHH@HH0HHHHHH HHjHHHHHu4LTgH Hƿ襕KHH@HHXHHPHIȹH{ueHHHHH@HHSIL jHoHƿ HHH@Hy7HHHH HH ЃH@L9HDžHHHHu4L&SxHHƿ3HHH u8LRzHAHƿۓHHu4LRHHƿ萓6HPHHHPHH@PHHH!u4LRHHƿ!HH@Hdu4LQH<Hƿ֒|HHHHHPH91DžHHHHHHHH@HHXHHHHHHHH@HHHPXHHHHHHHH@HHXHHHHHHHH@HHHPXH@L9DžHPLЉHHHHHHHHHHHHHH@HHHHHHHHH@HHHHHPHHHHHPHHH@XHHHHHHHHHH@H HHPHH`HHHǸ0y/LNHbHƿAHH@PH@H`HHpH(H(u/LNHHƿ蛏HH(HPHHHPHH`HHHǸ>/y,LNHHƿ(pHH@PH@H`HH2oH(H(u,LMH0HƿʎH H(HPHH@L9HH^u1LOMHHƿ\LHUdH+%(t|He[A\]UHHH}HuHUHEAHUHH H}uHUHMHMHUuHEAHUHSH(H}HEH HEHEH@X%HuCHEHIL*HHƿTHEH@PHu4LKHrHƿ oHEHlHHEHq-HSIL*HHƿ赌HEHEHUHHHHHH@H@X%HusHEHHsHEHUHHHHHH@HHHEHUHHHHHH@H@X%HHEHUHHHHHH@HNIL)HHƿ請HEHHt~HEHUHHHHHH@HtWHEHUHHHHHH@HIL#)HHƿHEHUHHHHHH@HuuaHEHUHHHHHH@H;IL(HHƿ蘊HEHHHEHUHHHHHH@Hҽu_HEHUHHHHHH@HIL+(H[Hƿ[EHE@L9E4HEH~u1LH HHƿ蟉H]UHSH8H}HEH HEEEHEH@H@H EEHEHLEԺUEԺuЅuEHEHUHHHHHH@H,#u.HEHUHHHHHH@H"tEE;ErCHEHIL&&HɼHƿcEHE@LE9EHEH"EHE@L9EuCHEHIL&1HIHƿHEH@@tpHEH@@;Es`HEH$HHEH)(HUHRRSPAL3&8H˻HƿeHH]UHH0H}HuHEHEHEt 3HEH@X%Hu HEH@XH t$HEHWHEHEH@XHH!Ht HEHHEElHEHUHHHHHȋtCHEHIL+%[HHƿ-HEEHE@L9ErHEHHEHUHEHH9]UHH0H}dH%(HE1EHEHEHEHDt4L$iHHƿ肅HUHEHHtEt1L#DnHHƿ0ZHUHEH HHGu1LCqHGHƿ EHUdH+%(tUHH H}HuHEHHE/HEH@(HUHHЃu HEHEHHEHUHEHH9uHUHEHH+HEH}u1LBHuHƿ LHEHUHHH蚻HEILC#!H&Hƿ轃HEUHH H}HuHEHHE#HEH@H#EHtHESHEH@HEHUHEHH9uHEIL"/HHƿ-UHH}HE]UHHH}HEHHt1HEH@XHH!HuHEHuUHHH}HEHH@pUHH0H}HudH%(HE1EnteHEH HHHEH}tDHEH@ H@XHt3HEH@ HHXHUHEؾHхtEt HEH?HHUdH+%(tUHH@H}HuЉŰUHEHHM̺HHEEHHEHUHEHкHuHEHUHEHHHEHUHEHHHUH‹EHUHH0H}؉uHEHHEH@PHUHHHEHILH͵HƿQ}UHH H}HuHUMDEHEUPTHEHUHPXHEHUHPpHEH莧HEHUHHEPHEHEHuHEH@XH HHEHPXHEH@HPXHEH@HHPX}tHUHEHH HEHPxHEHHHUHHH}HuHEH@0H HHEHP0HEHUHHEH@XH HHEHPXHEH@H@H tHEHUHPhHEH@H_HEH@HPXHEH@HHPXUHHH}HEHH@hHtHEHH@H{HEHH@hHEHHP0HEHHHP0HEHǀHEH@XH%HHEHPXUHH H}HEH@PHHHH*HEH}u4LH*HƿzHE苈HE苐HuHEHjjjjjQjjjAAѺHHPHEH}u1LHHƿzHEHUH°HH誱HEUHH0H}HuHU؉MDEHEHt?HEH@HILBHHƿyHEH;Eu4L,HұHƿVyHEHPPHEIй@HHHHEH}u1L7HhHƿxwHEUԉHEHHEH}u1L7#HHƿx"MHUHuHEAH)UHSH(H}HEHIu4L70HHƿ!x.HEHPHEHEH*E}HEH@XHHEH@PHHAUuCHEH*IL9HHƿwHEH@PHHUHHu?HEH@HILh>HHƿ*w7EHEHHxH讯HE苀PHE艐HEH@XHtHHƿrL\HjHƿqLrH@HƿqoHEH@XHH!Ht'HEH@XHH!Hu HHE.HEH@XH tHEHt H`HEH}t8HEILHHƿqUHH H}HEHHEH}tHEH@H@%HuHHEؾHȍEHEH@H>HHEؾH衍EE;E~EEE;E}EEHEH@H9EtjEHEH@HHEHEH@HHE"HEH@H@HHEHEHHEHUHEH@HH9uHEHHEHUHxH@PHH9HEH9Er HxH@PHAHEHEH;Es H$HE\HxH@PH~AHEHEH;EsH}u HHHE}c}u HEHEHEH}lH}tHUHEHH IL%M}uHEH HH(}t L-vL-iHUHEHHͿATuSAUILHYHƿ*^H }c}u:tLH HƸ]}c~:裩tLHʖHƸ]}u:ctLHHƸ`]He[A\A]]UHAUATSH(H}HuHEȋ@TEHEHEH9r%HEH]ܺHHHHHEH@@HRUHEH@PHHH-IHEHHEH@PHHH IHEH@HHHEHHAUATSILiHrHƿC\H He[A\A]]UHH H}HEH#HEH}u@HEHkILHHƿ[PHEH1HEH}u1LsHHƿ[HEH@UHH H}EHEH@H@%HuGHEH@H訹ILH4Hƿ[HEH@HHE/HEH@9EsHEH@EHEHHEHUHEH@HH9uE}v1LgHHƿiZ3EALL HaHƿ2ZEUHSHXH}dH%(HE1HEHHHEHE@HEH@PHHUHuAAHѺHfqtEuCHEHIL<HHƿnYHEHoHYumHEH趷ILHBHƿY3HEHHEH]HEHHH9HUdH+%(tXH]UHSH(H}؉uEHEH@XH H!HuCHEHILHHƿQXHEHRHHCt }5E连HEH&HEH@PHHUHHu>E胞L,H̐HƿW HEH趙uvE5dt HHHEHʵHSIL0HQHƿ"WHEHEHE}u/L8HHƿVHEH@PHHUHHE}u9HEHIL;<HHƿmVHEH@PHHUHHru@HEH蹴IL@HEHƿVEHEH@PHHy3u@HEHbILFHHƿUE}t^HEH@PHHUHHJu@HEHILqMHHƿ[UEEHEH@PHH}u1LVH6HƿUvHEH HHhHEH@PH'tHEH@PH!%u1L\HÍHƿTEH]UH}uHUUEHHUH H]UHH}uUUMEΉUHH}uEHEH H]UHH(}uHUMHUMEΉXEEE܃t&E9EsE9EsUE‹E!ЉE#E¸ )кЉE}w E} vE EUHH0H}HuHUHMHUHEIH{HEH}u4LH$HƿRHEH%HHhJuHEHEhHEHŌHH8JuHEHE8HEILHHƿZRUHH H}HuHUHUHEFHOtHEHEuUHH0H}uHUHEHEH9Est}u,L-HƊHƿQIHUHEHHILHHƿUQEEUHATSHH}HuUHMDEDMHEHEHEHEHE HEHE(HxHE0HpHE8HhHE@H`dH%(HE1HpuH<~Hƿ EHUHEȾHmzuCHEHTILH}HƿD1HEH@HHEHEHHHEHHH9Et^HEH{HHEHǢSuILHO}Hƿ DHHEH|ILH}HƿCHEH@PHHUHHqu@HEH%ILH|HƿCHUdH+%(tBH]UHATSH H}؉uEE EE;ErE9EswUHEHH}IċUHEHHhHËUHEHHSATSIL#H{HƿBHEE#EԅtdUHEHHHËUHEHHHSILHs{HƿDBHEEHe[A\]UHH}uUUMEΉUHH}}t}t; H'77EAL HE|HƿAHA|UHH}}wZEHH.HH.H>H{dH{[H{RH{IH{@H67EAL7H{HƿAHEUHH}}tV}w }t}t H{@Ho7EALFH){Hƿ@HO{UHH}}t0}w3}t}w'}tQ}uHIH{@H{7EALWHzHƿ @H=UH}uUUEH‹U҉H]UHHH}HE\HEH@H@PHE`ΉUHH}EHEH@HHEHEH@@$EHEHHEHUHEH@HH9uHE苀`;Es HEU`]UHSHH $HHHHxHpdH%(HE1DžHX5} HHxHIAHH|yHǸty4LuyHxHƿ^>HHǸ9| HHxHHIIHH yHǸy4LxHRxHƿ=HHǸK9yT'<9HPH _PILHwHƿ>=H&H?HΉ,5yT;8HPHZPILHVwHƿ^HUHƿHHEHEUHSHH}u}u4Lt5kHTHƿHE@p% ts}t E#EtVEtLHEH@HyILrH:THƿ"}t E#Et4L{HSHƿ}w}wjHEH@H yHHEH@HxHSILbHqSHƿTHXEtIHEH@HxIL3HSHƿH]UHHPH}uHEEHEHHuBHEHILHRHƿV HE9Eu = HEH@H@UHiu4LH2RHƿHE;EsVHEH$uHHHHt4LFHQHƿHEUHEH@H@H@H@PHt`HEH@H@H@HHPHEH@HUHHхu4LHGQHƿ*HEHHUHMUAȉHHu4LHPHƿHEHHUHMUAȉHPHu4LMHwPHƿZ1HEHHEHEH@HEHEUHEH HHEHUEAЉHHu4LHOHƿHEHHHEHUEAЉHOHu4LHHrOHƿU,HEHHEHEH@ HHEHHHEHxUEAЉH{OHu4LHNHƿHEHHHEHxUEAЉH$OHu5LQH{NHƿ^5HEHHEHUHEHH9HEHHEHUHEHH9HEHHEHEH@HEHEH@HHUHMUAȉHŹHu4LHMHƿkHEHHEHEH@HHUHz MUAȉHMHqu4LH;MHƿHEH@HHUHz$MUAȉHMHu4LHLHƿHEH@HHUHzPMUAȉH3MHu4LMHwLHƿZ1HEH@HHUHMUAȉHLHHu4LHLHƿHEH@HHUH`MUAȉHLHu4LHKHƿgEHEHUHHHHHȋHEHpHHEHUHHHHHH@HxUEAЉHKHu4LHJHƿHEHpHHEHUHHHHHH@HxUEAЉHTKHL0 HZJHƿ=HEHpHHEHUHHHHHHxUEAЉHJHunLHIHƿ EALHIHƿ aEHE@L9EHEHHEHUHEHH9HEHHEHUHEHH9)UHSHH}uHEHHuBHEHIL{#HHHƿ HEH@H@@puI}u E:}v1LuI,HxHHƿ[ }}teHEH9EsTHEHHEHHSAL2HHHƿ HHEU䉐H]UHHH}uHEHHuBHEHIL?HGHƿr HEH@H@@puI}u E:}v1LHH-GHƿ y}taHE9EsRHEHHUHPAL[NHFHƿ HHEUUHHH}u}u1L&ZHhFHƿK "HE@P9EuHEUPPUHHH}HuH}t HEuHEHǀhHEH@HUHHHUHHEHHu1L~pHEHƿ UHHH}HuH}u HwHEHEH@HUHHjHUHHEHHu8HEIL)F}HEHƿUHSH(H}HuHEؾHHEH}u4L &HDHƿHEH@`%HtwrHEHEHlHtz-HEHHEHBHtx-HEHHEHtp-HEHHEЋ@PHUHZbHEH%Ht HEHc(HEH t HEHs HEH-HEH]UHSHHH}HuHUMHEEHEH2HEH}u2LZDH$CHƿEHEH@@HtHEH@@H?t2L#DHBHƿETHEHHUHHPILCHBHƿcHHEHJt9HEILTH;BHƿEHEuMHEHHUHPIL$HAHƿHEbHUHEHHSHEHEHHUHPILHAHƿbHH}tHUHEHH?HEH@H@HPHHEHPpHEHǀHEHHEHHH螮u>HEHILR2H@Hƿ/HEHHEH)ÉHE)ȉHEHEHVHU)HEHEH@H@HPHHEHH HEH}HUHMHEHHvtHEuJHEHHUHPILH?HƿH6}"HEHtHEHuJHEHHUHPILSHr?HƿUHHMHEȺHHuGHEHHUHPIL5;H ?HƿH_HEHNtHEHSILɻH>HƸHEH}t}u}tHEH@HHEHEH]UHHH}H}t/HE@,t HEP,P,HEH@@H;UHHH}HEHƿUHH H}HE@LALI?.HF?HƿHE@PAL5?/H?HƿrHEHHt1H>Hƿ&HE苀t[HE苀HEH@H@PHHH`bHEHEIL>6H]>HƿL>9H3>HƿHEHGH轋Lh>;H=HƿQEMHEHHrEHE@L9ErL>H=HƿUHHH}HuHUHEH =HH, u@HEH ILDH(=HƿUHSHHH}HuHUdH%(HE1HEHEHW=HHղ HEHHEH .=HHr tHEH@0 HHEHP0XHEH@HXHHEH HSIL3WHE<HƿHlHEH-&HH" t}HEHHEH &HHï uXHEH@HXHHEH| HSILaH;HƿHHUHEH fHHC HUHEH@H@PHHZ{HUHHEHHuXHEH@HXHHEH̱ HSIL|jH:Hƿ^H%HEHHPXHEHHHPXHEHtfHEȋuXHEH@HXHHEH8 HSIL(sHj:HƿHHUHEH HHy uUHEH@HXHHEH° HSILzH9HƿTHHUHMHuHEAHHUdH+%(tZH]UHHH}HuHEPLHEH :HHǸu4LHM9HƿHEH@0% HHEHEHEH@H@PHHHEH9HǸVu4LH8HƿHEHHtbHEHHPHHEH +9HHǸu4LHB8HƿHEtZHEHEH 8HHǸu1L*H7Hƿ7HMHEH}HHU6UHH H}HuHEHHEH}u1LHZ7HƿHEHHUHEUHHPH}HuHUHMLELMHEHEHEHEdH%(HE1HEHHuHUHEHH%HUHHUHMHEHHu4LH6HƿHEHHEH@HHEHHEHHEHHHEHH}t0HEȋ@PHEH@HHUH HHEȉHEHHEH@HH(HUHUHEHHHUdH+%(trUHHĀH}HuHUdH%(HE1HEH@HEEEHEILѲH[5HƿHUHMHEHHu4LiH5Hƿv5HEPHE@L9tsLfH4Hƿ0HE@HURLHPAL^H4HƿHHEH@ HhHH HEHvHHEHEH@PHHUHuAAHѺH3tEЅu>HEHTILѱH3Hƿ;EUHPAL4H3HƿHUHEH@0@9uUHEH@0@9tYHEH@0HHEH@0PEuHQRPALLH&3HƿH 0HEH@0EMRPAL3H2Hƿ>HHEH@0AtHEH@XH HHEHPXEEHEHUHHHHHHpHEH@PHHUAAHѺHi tEЅuXHEHUHHHHHH@H@HIL]H1HƿWEUHPAL2H1HƿHE*MHEHpUHHHHH@9MHEHpUHHHHH@9HEHHUHHHHHȋUHPALH2H1HƿfHHEHHUHHHHHȋAtrHEHUHHHHHH@HHXHEHUHHHHHH@HHHPXEEHE@9EHE@9Eu>UE܋MRPALH)0HƿH6EHE@L9Em}tHEH@PH蟃EHUHEHHEHUdH+%(tfUHH@H}HuHUHMDEDMEHEEHEHHttHEHHEHHOHEH}HEHH@HIL˭H /HƿmHEH@H@XH t H|HEHHHEHHNHEH}uCHEH@H@HILi#H.HƿM;tHEH@0% HuM] HEH@0% H;HEH@HNHHEH@H@PHtILʬ/H-HƸ!HEH@H@PHʀMDE}HMUuHEEAHo UHHPH}HuHUHMLELMHE@LEEEHEHHuZHUHEHHhHUHHEHHu4L2JH,Hƿ?HEHHEHE@LuEHEH@0% HtFHEHE@P9uEE!HE HHU tEE}HEH@L@HHEH@H@PHHEHEH@H@PHuHEMIHLiH+Hƿ(HEH@0% HuTHEu4LʪoHt+HƿkHEEHEH@H@PH%HHEHEPPHEH@H@PHEAAHE}u4L"yH*Hƿ/HUHEHH o u1L׫|H*Hƿ~DE}HMHUHuHEEAHE}2LxH%*HƿE!}MHUHuHEAH{UHHHxHpHhdH%(HE16u X X HuHMHUHxIIHѺH53HX X u HMHUHEHHHtxEupEu_EubHEPHtMHuHMHUHEIH5HǸu!EuEuEu W HhtW HhW HUdH+%(t+UHH H}HuHUHEHPHEH@Hp0HEH@H@PHH}HMIH1UHHH}uUHEHPHEH@Hp0HEH@H@PH}MAAHn3UHHH}uMHEHUHHH}uMHEHZUHH H}HuHUHEHHt^HEHHiHHUHEHHu1LbH'HƿoTHMHEHHH]]u1L>H&Hƿ UHHH}HEH@0HHEHUHH H}HHEH}u4L H4&HƿHEHbHP HEH~HP(HEH@HEHS,HUHB0HEH@0HtHEH@ HHEHPHEH@(IL2H%HƿHEUH}HuЉUHEHEE؃HHEHHEE܉EHEHPHU1EEHHU1ЉEEHHU1ЉEEHHU1ЉEEHH}U1ЉEHEH;EMHEHEЃe:HEHPHU1EEHH'U1ЉEE؍PU؅uE]UHH0H}HuHUEHEE]EHHEHHUHcHMHH)֋UHcHUH<HH_H¸E}x&EEEEHHEHHHuHEUHHH $HH $H@HHHdH%(HE1DžHt HHHHu4L<H6$HƿMtGHHu4LkCH#Hƿ=HH HH1IL#GH#Hƿ6uw2)H¸t HHeHRHR#RPL PLJH#Hƿ+H gȹHHHHHRHHHt HHHH HRH"RPILTUHa"HƿxH 9H+9tTHPAL[H!HƿH6t=AL!aH!Hƿ%Ht`HHHHHPILi!hH!Hƿ+HLHHHPIL!jH HƿHHt HHUdH+%(tUHH }EH HǸ$E}uwH¸/t HkH9HRHRPL R LۭzHHƿH EztrxH¸t HHHRHίRPL LVHcHƿzH UE։5uoH¸t H`H.HRHRPL LЬHHƿH EEpttwnH¸t HHHRHRPL LLHYHƿpH EUHHH $HH $H@HHHdH%(HE1tGHHwu4L:HHƿ=HHtwMDH¸t HHHRHRPL kL"H/HƿFH HH HHvILHHHƿ{HPH@uwkbH¸t HHHRHRPL L@HMHƿdH H@u/LHHƿ trH¸pt HHDŽHRHRPL LiHvHƿH 6 tr H¸St HyHGHRHaRPL LHHƿ H urH¸St HHHRH'RPL L`HmHƿH -trH¸pt HmH;HRHURPL |LݧHHƿH HHHHHHHH,g^HHHt HHHH HRHzRPIL.H;HƿRH twH¸St H2HHRHRPL :LHHƿH 3HE+H։THHHHHHH¸St HHRHRH RPL LHHƿH tmH¸St HHԀHRHRPL LvHHƿH HHHUdH+%(tUHH H}dH%(HE1HEHHtmH¸St H@HHRH͢RPL WLHHƿH HE@HMHΉyHE@9ttG>H¸t HHzHRHRPL eLH)Hƿ@H EHUdH+%(tYUHHHHHHLdH%(HE1f))fDžHHuHu4L8HHƿ#HHǸHHHHǸu H5tx<3HHt HHj|HHRH}RPIL GHHƿ-H jHUdH+%(t5UHHHXHPdH%(HE1HPHXHH.tWEHƿH EJtqQHHHEt HHvHMHRHRPIL$H HƿHH HEHUHH`H}UfEdH%(HE1f)E)EEfEHEHHEH}u4LH/ HƿHE/H^HEH}tHEHEHz uHEHP_HEH:Uf}u H H HMRPIL H Hƿ HHEBHǸE}}uut}i tq]THHEt HHtHMHRH$RPIL0H HƿTH *LH Hƿ$HUЋEǸ%HHEt HHsHMHRH RPILkH HƿH EtoHHEt H~HLsHMHRHbRPILH HƿH EHUdH+%(t3UHH@}dH%(HE1f)E)EfEEAL H HƿHUЋE̾ǸumH¸t HtHBrHRH1 RPL -rLH HƿH ẺtmH¸t HHqHRHRPL qLiH HƿH HEdH+%(tUHHH}HuHEHx u u3HEIL7 HHƿoHHEt HHpHMHRHRPILwHHƿH UHH}HuHMHEHPpH@hHHQ]UHHH}uHEILa%HgHƿ"E諾yLHUPHPIL(HHƿHUHH@HdH%(HE1HIL/HHƿfH`HHHFHH։wHhHH9uuH`HH9ubHHztOqhHPHPILH5HHƿH yOHPHwPIL8HmHƿ(HHEdH+%(tRUHH H}H2 HE4HEHEHEH@HUHH$uHEHEHHEH2 H9EuUHH0H}؉uH2 HEHEHHEQHEHEH}tHEH@HUHHHEH}HEH@ILwTHFHƿHE@ qtPHUHRPH,PIL^VHHƿHHEPHEH@HHEPHEH@HHEH@H9HEH-H}t)HEHEHEHHEH1 H9EUHH}EƿKUHH`HHdH%(HE1t BuWRHQRILqHHƿXHHxcHʹtOȾHPH7PILuH-HƿHHBHǸyHHyNEHHt HH|jHHRHRPILxHHƿ?H 0t H։腽u=81t/LIHHƿ :-$HHt HH[iHHRHRPILHcHƿH xH`HHHuNHHH։Du0HhHH9uH`HH9u LH#tO*!HPHPILHHƿAHHL~HKHƿHUdH+%(t0UHH@H}HuЉỦMdH%(HE1EHEH袹HHPHHпHHkHHHH)H9tHH$HH)HHt%HHHHHHHHEHUHEHHƾHEHHUHкH HHUHuHEѺHE}t\}u,MȋUHuHEHEUHEH*UHEHMȋUHuHEH}EEHUdH+%(t薽UHH0H}؉uԋEԃEEԃ EEԃt+w<tt0EER`EEWSHEؾH= EԃALiHHƿ譽}}tMHEHvHEH}u }t BEHUHRQPILHfHƿ!HHE@U։荸E}u !蕻HUHPILzHHƿ躼H HEH}u4L`{HHƿmHEHHHEHPHEH@Hu@HEHLzHNHƿ )HE@}t BEHUHRQPILHHƿ觻HHEؾHs ( tHEHpMUHEHEHEHpMUHEH_E }tHEHH( HFHEH@HHEHLyHHƿٺEUHHH}H' H7HEH' UH}E]UH}Er' ]UHH}^' u0}t*LuxGHHƿE!' UH}E' ]UH}E& ]UH}E& ]UH}E& ]UH}E& ]UH}E& ]UH}E& ]UH}E& ]UH}E& ]UH}& u E]UH}E& ]UH}E]UH}& u E& ]UH}EK]UHH}u(H% Hծ(H& H輮跱AHHHYH¾(H% HǸ,X}u }}t&}u (HHHU% Hcp}u2}t,:HH¾(H"% HǸW8AH$HHH¾(H$ HǸWUH}E=% ]UHH}Et,LVH+Hƿ3*LDHHƿUH}E]UH}Ep]UHH}E}$ w$ t,LHHƿ芶*LuHVHƿ^UHH}HEH]UHHH}HEHHHaUHHg]UHHH}HEHH# HRaUHH# ]UHH7# ]UH}EU# ]UHD# ]UH" ]UH|" ]UHp" ]UHd" ]UHX" ]UHL" ]UH@" ]UH4" ]UH]UH " ]UH" ]UHP]UHp" ]UH8]UH}E! ]UH}E! ]UH}}u! #E]UH]UH_! ]UH+! ]UH! ]UH]UH]UH{]UH! ]UHH! ]UHHM]UHH {]UHH}HEHz]UH]UH}E]UHH}HuHEHuHUHEHEHEHEH}uHE]UHSHH}HuH}tH}u-HEHEHHUHEHHyHHغHH]UH}0 ]UH0 t*L2HHƿo0 ]UH0 ]UHSH8dH%(HE1Dž 2Ua0 X0 @HH¾辭tL腰|PHTPL YL_|WH"Hƿ蟱HDžBHHiHxHPStcHcHiH xH PHPIL{\HHƿHE%EH$HP%/ HcHHHHHHHcHiHHP H%xH‹HHiH xHPHΉhtcHcHiH wH PHPILzcHHƿHHHiH{w:. XHH辨HcӋHcHkzHHH H8wHcËHcHkzHHHHwt4HHiHvHH^DžtoHHƿtR賭說PHPL LylHPHƿͮHHEdH+%(tH]UHHdH%(HE1Džla.*, , , HpH¾Džhmn, HhHcHkzHHHHut4hHHiHduHpHDžlhhvltiHpHƿbtL) PHPL LxHHƿCHDžhu+ HcHHHHHHhHcHiHHP HxtH hHHiH^tHΉ輨tccZhHcHiH +tH PH#PIL&wHHƿfHhhHEdH+%(tuUHHldH%(HE1+-<* "HpHUtr|sH¸_t HHSHRH\RPL DLQxHHƿuH HpH!) Hƿ$toH¸_t HPHSHRHRPL LwHgHƿH ) HEdH+%(tUH*( HL( HƿOto H¸_t H{HIRHRHRPL LvHHƿH B( UHH }ElE(!u}tUHHHHHHhLpLxt )E)M)U)])e)m)u)}dH%(HH1Dž0Dž40HEH8HPH@HH0HHH0HH,,x,HHH9s Dž,,x,HcHHH9uCHH,HHHHHH,HH)HHHHdH+%(t|UHSHH}H}t HEu_p[HHHHu9.t4_t/-t*+t%/t =t!t:t&t #tHEHPHUuH]UHATSHH}AH}t HEu HE<-u HE<.unHEHtHEH<.uPHEHuAf\HHHHu.t_t-t +t,AHEHPHUuA~H[A\]UHHH}HEHUHH0H}HuHEHEHEHEEH}HEHEHEtpHHEHHHtWHHHUHHu}.t}_t }-t}+uHEHPHUUE}HEHPHUE}uHEUHH H}EvUHHHHHHH4HƋUHHHHHH HEHHHDuUHHHHHYHE}vUHH H}ENUHHHHH3HHEHHaHtUHHHHHHE}vUHH H}HEHpHEH}tHEbENUHHHHHbHHEHHПHtUHHHHH4HE}vUHH H}HEHCHEH}t8HEILIbHTHƿ胣THEHHEH}t8HEILBbHHƿ4UHHH}HEHsUHHH}HEHpHuHEHoHtUHHH}HEHHUHH0H}HuHUHEHEH}bHEHCHEHc&HEH@XH0tHEH@XH2HEH@XH.t HHEH@XH/t HfHEH@XH4t HNHEH@XH%t HFHEH@XH&t H+tHEH@XH't H9PXHEH@XHt HHUHcHUHHH讏HtYEHH7>HHUuPILSHHƿ蛓HeE}fHUHEH)HUH}EEHH=HUHcHUHHHHtYEHH=HHUuPIL9SHHƿےHE}fHEH@ HEHEuHEH@tpHEH@UHcHUHHH2HtLHEH@HUuPILRHUHƿ-HHEH@HEH}^HEHHEHHEHEHcHELEDEDEEHMHUHEHLHIHH IHEARAQAPWVQRASILR+HHƿbH@}HEHHEHH聍 ԏˌHHEt H7zH9HMHRHRPIL]0HHƿːH HEHHEHH芒yvA8HHEt HyHr8HMHRHRPIL]5H`Hƿ8H HUdH+%(tWUHHPH}ȉuHUE} }h_H¸t HxH7HRHlRPL 7L=\IHHƿaH z衏twߊH¸t HMxH7HRHpRPL 7L[NH HƿH HEHHEHJ HtHVH9EH- HtH9HH/H(H HHvHEH}u4L ObHVHƿ.KHEH  ՎHtL蛌蒉PHNPL LuXhHHƿ赍HHEHPH+EHH * HEH HΉ苅HEH}H}uyH t HcvH15HRHoRPL LYmHHƿH HEHEHH9E,HyH9EHP HEHH> HEHEȺHbHE5HEHMHU؋uHEH)uEHEHHEHEؾ HHEH}uHEHHƒ}u HHHRILtHHƿHEUH]UH]UHHH} P /   u\tQPHPL 83LUH;HƿH  9{ ¾uD` V HPALKHHƿ蝊HM5, HPALwKHyHƿQHUHHH}    ¾*u5t ALKHHƿJ\S1 HPALJHHƿxH UHHH} LH?Hƿ uHEH'y s ;x ucHEHH"HH[H¾HQ HǸ(y/LAHHƿsH HǸ  uqڃH t HFqH0HRHRPL  LTHHƿڇH yu*LF!HHƿ衇HEH9 Hwu*LNF%HHƿ[UHH H}dH%(HE1HEL,H0HƿHUHEHu*LE/HHƿņN 5? 8}tL?6PHUPL & LQ4HHƿYHH H)H H HEH9LHcH HHEH9sFHEHH HRILjG9HHƿ̅HDHEHH[ HRILG>HHƿ膅HHEH.HEdH+%(t蟄UHHH}} 5   = PVQRALRGJH$HƿH e u)c e ЃuD HEH`UHHH}| 5*   =  PVQRALGUHHƿdH  t* u  uHEH UHHH}Hu uoHEH8EHHHuUHEHV HEILFrHHƿ誃HEHD1HEILFuHHƿkHEH  UHHH}Hu tFz{ u= HEIL9FHHƿ1HEILHHƿ踂1 ~'  UH  ]UH ]UHHH}   u4 ~*LEHFHƿ ALEHHƿHEHHEHUHHH}= u*LZEHHƿ茁  ALXEHrHƿJHEH|UHHH}HE uHEHnHH HJHEHDHH H/HEH!;UHLHHƿ{]UHHH}HEHhHEHUH]UH]UHHPH}dH%(HE1HEHEHEHEEEHEu(HEuHEHEHEHE!HEHEHgzEă}y5EAL2HHƿ~L L6HHƿ~HEHMHuHHRHURILHHHH5HǸ}H Eă}HEHYBHH膁uHEHgBHHltCHEHPL xpLEHHƿ}HHEHPL 5pL]GHHƿ}HHEHUH HHǸ{Eă}y0EALAMHjHƿG}Et2EALAOH3Hƿ}HEH}HEHhwHEH}HEdH+%(t|UHH}HE]UHH}HE]UHH}HE]UHHH}HuL&HHƿ)|UHHH}HuL&HHƿ{UHSH(H}HuHU؉M$HEHPHEH@HHztHE0HEH@uHEH@u?HEH@IL<*HHƿE{HE#EԅuKHEHUHRHPIL?.HHƿzH^HEHUH HZHHXHJHZHHHXHJ HZ(HH HX(HEHH HUHEHHхuH]UHH H}HuHUM$HEHPHEH@HHytHE0HEH@uHEH@u?HEH@IL߿EHHƿyHE@u?HEH@IL>IHgHƿyHE#EuKHEHUHRHPIL!>NHHƿCyHYHE@tHEHPHEHPHEHPHEHPHEHH(HUHEHHхuUHHH}HEHƿxUHH H}ELEAL!HHƿuxMHEH&\HEHE@L9ErHEHHEHEHUHHHHHH@Ht_HEHUHHHHHH@H@HUHPALٽ(HHƿwHEHE@L9EfL*HzHƿiwUHH0H}HudH%(HE1EEHUHEH JHH( EHUHEH :HHe( E}uF}u@HEH+ IL;7HǼHƿv_}tF}t@HEH* IL;=H{HƿjvUEHEЉHUdH+%(tuUHH@H}HuHUHEHR* HEHE؋@Lu;HEIL7PHHƿuEHEȋt;HEIL*VHHƿuHEHPHEH@H@PHHHEH}u`HEH@Ht HEH@H]HuIL4\HHƿtHHEH@HH[HHpHtfHUuHEIHƔu4Lt3cHHƿtHEH@HEH}u;HEIL9hHDHƿ3tXHEHPHEH@H@PHHHEH}u`HEH@Ht HEH@H[\HuILnHHƿsHHUuHEIH蔓u1LB2sH`HƿOswEHEH@HEH}tHE؋@L9EaH}u HE؋@L9Es8HEILCzHHƿrUHSHHHH@H8dH%(HE1H5HpHHHHxHθHEHHH8HEHHEHHHHEHHEHHH_HEHHEH@HHEHHEHHEH@HHEHHEHPHEH@HHv HUH}t5HEȋ@PHEHHHaw̫HHHHEȉHUHEHH8HUdH+%(t]UHHPH}HuHUdH%(HE1EEHEIL=H"Hƿ^HUHMHEHHu4LHݣHƿ]jHEP HE@L9tsLT%HHƿ]HE@ HURLHPALHWHƿF]HHEHHEHEHUHHHHHH@HEHEH@PHHuAAH~tu>HEH0IL$HHƿ\EHE@L9EWEHEHUHHHHHH@HEHEH@PHHuAAHsu;HEH{IL$HHƿ[hHEHP0EHUHHHHHHHEHPHEHUHPHEHUHP HEUHH@H}HuU܉MLELMȃ}tHMHUHEHHEH}t*HUHEH‹uHEHHEH}u+HUHEHH`HUHEHH`UHH@H}HuHUȉMHEHHEEHEHHEHEH+EI}Ѓ}t,#HMHuHEMIȉщHHE<:HEHHEHEHOHEHEH+EI}Ѓ}t+!HMHuHEMIȉщHUHE<:tHEHHEEw}umHEHHEHEHHEHEH+EHHUHuHEIIйHt!HEHHEE HEHUHEUHH@H}HuEEHEHH HEH}u/LHxHƿ&HEHQ^HEHHE!HHUHH%u}-t}:t }+tEHEHHE HHUHH%t E HHUHH%t=HE<:u)HEHHUHuȹHEN}-t }+HEHHEȀ}-uHEHHUHuHupHEHUH)HUHUHEHHMuHHEH}tdHUHEHH\HUHEHHEHEHHEHEEӀ}ZHEHUHPE}t}uHEHHUHH; UHH0H}HuHUHEHH^HEHEHXHPEHEHcHHHHHHHHOHEHEH@ H9Et^EHcHHHHHH`HEHP HEHH9HEHPHEHHUHEH mHH54 u9L HpmHƿc HEHEHEUHH}HuHUHE@)t*uHE@HE@ HE@ -t&-wT!t#uJHE@HE7HE@$-u*HEHEHEPHEPHEPHE@ -u=HE@$&v1HE@$*w%HEHEHEPHEPHEP]UHH}HEHuMHMH ףp= ףHHH HHHH?H)HHHHHHH)HHuMHMH ףp= ףHHH HHHH?H)HHHHHHH)HHu]UHHH}HuH}u/HEHtHEHHHUHEHHHTUHHĀH}HuHUHMLEdH%(HE1HEH-H+EHEHEHEHE@ -t@HE@ !uHEH;HEHE@ #HEHHEHE@$-tdHE@$!uHEH=HEHE@$#uHEH-HEHE@$&v}HE@$*wqHEHQHEaHE@)u;HE@HcHE@HHHfHHiQHPHEHHEHE@-tHEHQHEHUHEHH}EtHEH-HEHUHEHHUEtHEH-HEHUHEHHUHEHHEdH+%(tUHHHHHdH%(HE1HDž8HDž@HDž(HH@HUHHHEHUHPHXHEHUH`HhHEHUHpHxHEHEDžpDžllhHH@HH0H0H@H0H@ HHHt4LHgHƿxtttLt#HHHH@HHH@HH\uHH-ld^t/`9_twHHEHH9H~ H+HH‹EHHHHEHH+HHHHHHiЀQH(HH(xH(HQH(iZtctt*ADžX DžPPTDžPPTTX  HH HH H>H@PH(H@HH(|H@TjH@HHH)HHH(HH(<H@X*H@HiH(HH(H8H8H@H@XH8t1H8H@tH(H-H(H8H8H@pH@ X[H@HiЀQH(HH(8H@HiЀ: H(HH(H@H*HHHHH?HH)HHdHH‰)ЉdH@H*HHHHH?H)HHHHH)HHH`HH9H~/dd`HH‰)Ѓ `J`HH‰)Љ`-dH@‰)Љd H0H8H0HH0H0HH@H9>H(HPHHH.H(HH HPHIHHHPHHHH HH@HH HEIHHb HǸ֯ u1LHaHƿhHHHUHH HHHHHu1LHiaHƿ\HUdH+%(tUHH`H}HuHUdH%(HE1HEHEHEHEHEHEHUHEHHHEE-EE-E-HEHu,LH`HƿYHUHEHH-t;HEHt.HEHt!HUHMHEHHHEHtHUHEHHx HEHUdH+%(tA UHH@H}HuHUdH%(HE1HMHUHEH5_HǸ t1L6H_Hƿ kHEоH HEH}u1L;HF_Hƿ9 HUHEHHEHPHEHHEHUdH+%(tC UHH0H}HuUMLELMHEHH}ul}t}t"QHUHMHEHHdHUH9HUHMHEHHHUHHEHHu UHH H}HuHUHUHMHEHH UHH H}HuHUHUHMHEHHY UHH@H}HuHUHMDELMHEHE}t*HEHu HEHGHUHuH}H (HEHu HEHGHUHuH}H UHH@H}HuHU؉MLELMHEHEHEt=}t HH}t HHHMHH8}t HdHS}tHEHHMHHUHH0H}HuHUHMHEHEHEtH HEH'HH=HEHH HHUHH0H}HuHUHMLEHUHMHEHH UHH0H}HuHUHMLEHUHMHEHH{UHH@H}HuHUHMLEHUHEHHHEH}u1LYHs[Hƿf HMHEغHH#UHH@H}HuHUHMLEdH%(HE1HEHH@(HEHH@(H % ЉEHUHMHEHH HUdH+%(tUHH@H}HuHUHMLEdH%(HE1HEHH@(H%EHUHMHEHHM HUdH+%(tUHH0H}HuHUHMLEHEHHvHHMHEHHUHH@H}HuHUHMLEHEHEHUHEHHHEH}u1L9HYHƿ%HMHUHuHEL AH~UHH@H}HuHUHMLEHEHEHUHEHHHEH}u1LFHYHƿ%HMHUHuHEL dAHUHH@H}HuHUHMLEHEHEHUHEHH6HEH}u1LOSHiXHƿ\%HMHUHuHEL 5AHBUHH@H}HuHUHMLEHEHEHUHEHHMHEH}u1L`HWHƿ$HMHUHuHEAAHUHH@H}HuHUHMLEHEHEHUHEHH萝HEH}u1LmH.WHƿ!$HMHUHuHEAAHUHH@H}HuHUHMLEHEHEHMHUHuHEAAHUHH H}HuHEHEHEHHUHH HEH}u1L2HLVHƿ?XHEHHHEHHUHH)xu1LHUHƿUHHpH}HuHUHMLEdH%(HE1HEHEHEHEH@H@H$HEHuHEH}u4L6HPUHƿCHEHxHUHEHHF^u4LHTHƿHMHUHuHEAAHHEH@H@H t$HEHH@XH4t HEHEOHEH@H@Ht HEHE.HEH@H@H tHEHHKHEH}tHEHXHu5HEH9HMHUHuHEAAHHEHXH@HEHEHtHEH}u1LHSHƿcHEHEHEHE&HUHEH HHl HEH@HEH}uHMHUHuHEAAH8HUdH+%(tUUHSHXH}uHUHMEaEHHHEHHHEЋEHHHHEHHHEHEHHHEHHHHEHUHEHH' HEH}u4L3HMRHƿ@HMHUHuHEIHHHǸ y1LѾHQHƿdHUHMHEHHisu1LHQHƿEẼ9EH]UHH H}HuHUHEHqHUHHEHHu4LHQHƿ HEHHEHPxHEppHEHu1LHPHƿbHEHHEHHEHEHsu1LHHbPHƿUUHH`H}HuHUHMLEdH%(HE1HEHEEHE؋@Ht5HEHs5HMHUHuHEAAHHH HEH}u4LrHOHƿHEHHPHUHEHHu,LH9OHƿ,'HUHMHuHEAAHEHEH EHUdH+%(t#UHH@H}HuHUHMLEHEHEHE@Hu8HEH@PHHt$HEH@PHHMHEHHHfH GHEHH1UHH@H}HuHUHMLEHEHEHE@Hu=HEH@PH@hE}t HHzHuHMHH HEHH ˣHHUHH@H}HuHUHMLEHEHEHEHEH@H@H t$HEHH@XH4t HEHEOHEH@H@Ht HEHE.HEH@H@H tHEHH${HEH}tHEHPHuHH HEHHHEHPHMHEHH`UHH@H}HuHUHMLEHEHEHEHlHEH}u1LذEHWLHƿJpHUHMHEHHhu1LJH LHƿ$HMHUHuHEAAHUHH@H}HuHUHMLEHEHEHEH@hHt!HEH@hHPHMHEHH(HEغH fHH<UHH@H}HuHUHMLEHEHEHEHHt HEHH HuHMHHUHH@H}HuHUHMLEHEHEHEH@Ht6HEH@H@Ht%HEH@H@HP8HMHEHH?HEغH }HHSUHH@H}HuHUHMLEHEHEHEH@Ht6HEH@H@Ht%HEH@H@HP8HMHEHHHEغH HHUHH@H}HuHUHMLEHEHEHE@t(HE@xHEHPHMHEHH| HMHEH6HH UHH@H}HuHUHMLEHEHEHE@t(HE@ xHEHP HMHEHH HMHEHHH褻 UHH@H}HuHUHMLEHEHEHUHEHH苽HEH}u1LHHHƿHMHEغHHLUHH@H}HuHUHMLEHEHEHUHEHH蒹HEH}u1LH HHƿHMHEغHHUHH@H}HuHUHMLEHEHEHUHEHHHEH}u1L`HzGHƿmHMHEغHH*UHH@H}HuHUHMLEHEHEHUHEHHcHEH}u1LHHFHƿHMHEغHHUHHpH}HuHUHMLEHEHEHEHEHEH蓃Ẽ}uBHEHEuuHEu HEHPHHMHEHH}t-HEHH@H@HHEHEHHHE HEH@HHEHEHHHEHUHEHH HEH}u4LHEHƿ}t H}Hћ}t HHHMHuH}IIHHH¸" y1LGHEHƿ fHUHEHH HEH}u1LFHDHƿHUHMHEHH{UHH@H}HuHUHMLEDMHEHEHEHHEH}uHEغH EHHJ}t%HEHH H}HUHuHEIHFH}HMHUHuHEIH8UHH0H}HuHUHMLEH}HMHUHuHEAIHUHH0H}HuHUHMLEH}HMHUHuHEAIHUHH@H}HuHUHMLEHEHEHUHEHH艝HEH}u1LHCHƿHMHEغHHUHH@H}HuHUHMLEHEHEHEHҝHEH}uHEغH ~HHTH}HMHUHuHEIHUHH@H}HuHUHMLEDMHEHEHEHHEH}uHEغH HHJ}t%HEHH H}HUHuHEIHH}HMHUHuHEIHUHH0H}HuHUHMLEH}HMHUHuHEAIHUHH0H}HuHUHMLEH}HMHUHuHEAIHUHH@H}HuHUHMLEDMHEHEHEH$HEH}uHEغH ÖHHJ}t%HEHH H}HUHuHEIHH}HMHUHuHEIHUHH0H}HuHUHMLEH}HMHUHuHEAIHUHH0H}HuHUHMLEH}HMHUHuHEAIHUHH@H}HuHUHMLEDMHEHEHEH;HEH}uHEغH HH_J}t%HEHH H}HUHuHEIHH}HMHUHuHEIH|UHH0H}HuHUHMLEH}HMHUHuHEAIHUHH0H}HuHUHMLEH}HMHUHuHEAIHUHH@H}HuHUHMLEHEHEHUHEHH蓦HEH}u1L*HD>Hƿ7HMHEغHHUHH@H}HuHUHMLEHEHEHUHEHH蛧HEH}u1LH=HƿHMHEغHHcUHH@H}HuHUHMLEDMHEHEHEH1HEH}uHEغH -HHJ}t%HEHH H}HUHuHEIH.H}HMHUHuHEIH UHH0H}HuHUHMLEH}HMHUHuHEAIHUHH0H}HuHUHMLEH}HMHUHuHEAIHUHH H}HuHUHEuHEH@H@HnHEH@HPHHuHEIHtHHHǸΉ y1LH;HƿHEUHSHXH}HHHEHUMDEdH%(HE1HHHEHEHEȁHHоHHkHHHH)H9tHH$HH)HHt%HHHHHHEЋEt7}HEH@hHHEH@hHPHHEHUHEHetHEHjHEHEH@XH$tvHEHuhHEHEH@XHtHEH@XHEKHEHHtHEHHE*}t$HEH@`HtHEH@`HPHHEHUHEH9EHUHEоHHEH}u4LH9HƿEt}tHHUHEHHu1L7HQ9HƿDV}MuHUHEAHvu1LH9HƿHHUdH+%(tH]UHHpH}HuHUHMLEdH%(HE1HEHEHEHEHEHEHEHXHEHEHu4L3HM8Hƿ@HEH>uEЋEЅtHEHH@HEHEHEHEȋuHUHEAȹH,uDHUHEHH" LH7Hƿ$HUHMHuHEAAH}HUdH+%(tUHHpH}HuHUHMLEdH%(HE1HEHEHEHEHEHEHEHXWHEHEHu4LH6HƿHEHsEЋEЅtHEHH@HEHEHEHEȋuHUHEAȹHuDHUHEHH譾 L(H.6Hƿ!$HUHMHuHEAAHHUdH+%(t%UHHHhHHHPHXdD`dH%(HE1HEHEPodHXHpHEHEHHE0HEH@t `HEHPHE@HHEH}u4Lء@H4HƿHhHEHHu4LBH4Hƿ;HEH@`d0HPHhAHu4L&EH@4Hƿ3HEHHEHEH9EHXH^sHXHHEHEHHxHE7HEH@pHXHXHHPHE@HMHEH}u4LVMHp3HƿcHhHEHHu4LOH"3Hƿ`dPHXHhAHu4LQH2HƿVHEH@xHxHEHEHxH9E*HXHHEHEHHxHxH@H@H@XH$\HxH@H@H;`HEHEHPXHXH9tHEHHXH9HxH@H@HEHUHE@H~HEH}u4L\H1Hƿ8HhHEHHu4L9^HS1HƿF`duHUHhAH7u4Lܝ`H0HƿHxHHxHxH9E`dYHXHHEHEHHE*HEH@t `HEHPHE@HHEH}u4LjH30Hƿ&HhHEHH`u1L˜lH/HƿHEH@`d0HPHhAHu1LjoH/HƿwHEHHEHEH9EHUdH+%(tUHHpH}HuHUHMLEdH%(HE1HEHEHEHEHEHEHEH?OHEHEHu4LH.HƿHEHkEЋEЅtHEHH@HEHEHEHEȋuHUHEAȹHiuDHUHEHH蔶 LH.Hƿ$HUHMHuHEAAHHUdH+%(t UHHpH}HuHUHMLEdH%(HE1HEHEHEHEHEHEHEHMHEHEHu4L0HJ-Hƿ=HEH;jEЋEЅtHEHH@HEHEHEHEȋuHUHEAȹHuDHUHEHH LH,Hƿ$HUHMHuHEAAHzHUdH+%(tUHH@H}HuHUHMLEDMHEHE}tHUHEHH讒HEHUHEHHgHEH}tHUHMHEHH}HEغH HHUHH0H}HuHUHMLEH}HMHUHuHEAIHUHH0H}HuHUHMLEH}HMHUHuHEAIHUHH@H}HuHUHMLEDMHEHEHEH׎HEH}uHEغH ̀HHJ}t%HEHH H}HUHuHEIHH}HMHUHuHEIHUHH0H}HuHUHMLEH}HMHUHuHEAIHUHH0H}HuHUHMLEH}HMHUHuHEAIHUHHPH}HuHUHMLEHEEUHEHH8HEHEu4LjH)HƿwHUHEHH臷 HEH}u4L5+H2)Hƿ%HEоH輯 HEH}u1LVH(HƿKEHx fH*HHH fH*XHEHUHMHEHH_UHHPH}HuHUHMLEHEHHEHUHEHH7HEHEu4L H(Hƿ HUHEHH HEH}u4L) H'HƿHEоHO HEH}u1L Hu'HƿhLHEHx fH*HHH fH*XHEHUHMHEHHUHHPH}HuHUHMLEdH%(HE1HEHEHEHTHEHE苀HEH}t[HEH@XHH!HuAHUHE@(HE@LvHEHLHEH@@)HH)HUHEH@PHEHHEH}HMHUHuHEIHHUdH+%(tNUHH0H}HuHUHMLEHUHMHEHH UHH@H}HuHUHMLEdH%(HE1HEEHUHMHEHH HUdH+%(tUHH0H}HuHUHMLEHUHMHEHHӗ UHH@H}HuHUHMLEHEHEHEH@XH%tXHEH@XHH!HtHH NHEHHHEHE苀Hw=HE苀Hu H޲HͲHEHUHMHEHH1 HEHܵH fHHUHHPH}HuHUHMLEdH%(HE1HEHEHEHvHEHEHt!H}HMHUHuHEIHHEH H eHH[HUdH+%(t讼UHHPH}HuHUHMLEdH%(HE1HEHEHEH*HEH}HMHUHuHEIHHUdH+%(t2UHHPH}HuHUHMLEdH%(HE1HEHEHEH~tHEHt HEHEHb|HEH}HMHUHuHEIHHUdH+%(t茻UHHPH}HuHUHMLEdH%(HE1HEHEHEH{HEH}HMHUHuHEIH`HUdH+%(tUHHPH}HuHUHMLEdH%(HE1HEHHEH}t$HEH@(HtHUHEHH eu HEH}HMHUHuHEIHHUdH+%(tmUHHPH}HuHUHMLEdH%(HE1HEHEHEHCHEH}HMHUHuHEIHAHUdH+%(tUHH@H}HuHUHMLEHEHEHEHHtHEHt HEHHIbHEHUHMHEHHޭUHH@H}HuHUHMLEHEHEHEHHt!HEHH(HH/u HaHEHEHHEHUHMHEHHPUHH@H}HuHUHMLEHEHEHEHHt HEHHRaHuHMHHUHHPH}HuHUHMLEHEHEHEH"HtHEHH@HEHEHEHEHP HEHH̝HEH}u1Lw H Hƿ衸HMHEȺHH^UHH@H}HuHUHMLEHEHEHEH@HuHEغH 6`HH *HEH@HH}HUHuHEIH6UHHPH}HuHUHMLEdH%(HE1HEHEHEHxEH}HMHUHuHEIHHUdH+%(t̶UHHPH}HuHUHMLEdH%(HE1HEHEHEHxEH}HMHUHuHEIHHUdH+%(tQUHHPH}HuHUHMLEdH%(HE1HEHEHEH賚EH}HMHUHuHEIHHUdH+%(tֵUHHPH}HuHUHMLEdH%(HE1HEHEHEH{EH}HMHUHuHEIH#HUdH+%(t[UHHPH}HuHUHMLEdH%(HE1HEHEHEHbEEuH}H ޭHEHH舩H}HMHUHuHEIHHUdH+%(t躴UHH@H}HuHUHMLEHEHEHEH@XHt!HEH@XHPHMHEHH̨HEغH ]HHUHHPH}HuHUHMLEdH%(HE1HEHEHEHDEH}HMHUHuHEIHHUdH+%(t̳UHHPH}HuHUHMLEdH%(HE1HEHEHEH@ HyHEH}HMHUHuHEIHHUdH+%(tLUHHPH}HuHUHMLEdH%(HE1HEHEHEH@ HHEH}HMHUHuHEIHHUdH+%(t̲UHHPH}HuHUHMLEdH%(HE1HEHEHEH@ HEH}t0HEHEH}HMHUHuHEIHHEHH ZHH̦HUdH+%(tUHHPH}HuHUHMLEdH%(HE1HEHEHEH>HEH}HMHUHuHEIHHUdH+%(t裱UHHPH}HuHUHMLEdH%(HE1HEHEHEHHEH}HMHUHuHEIHwHUdH+%(t'UHHPH}HuHUHMLEdH%(HE1HEHEHEH&EH}HMHUHuHEIHtHUdH+%(t謰UHHPH}HuHUHMLEdH%(HE1HEHEHEHHr EH}HMHUHuHEIHHUdH+%(t+UHHPH}HuHUHMLEdH%(HE1HEHEHEHǓEH}HMHUHuHEIHxHUdH+%(t谯UHHPH}HuHUHMLEdH%(HE1HEHEHEHhQEHUHMHEHHTh HUdH+%(t8UHHPH}HuHUHMLEdH%(HE1HEHEHEH@HEEHEH@XHHEH@XH0u|HEH@XH-tHEHHp tSHEH@X%HtHEHHuJHEH@XH t7HEH,/H@H@% HuHEH7PEHEH@XH t3HEH.H@H@% HuHUHEHHcWHEH@XH1tDHEH@PHHUHuAHѺHtEtHEHEHUHMHEHHf HUdH+%(teUHHPH}HuHUHMLEdH%(HE1HEHEHEH@XH t0HUHEHHtHUHMHEHHSHEȺH UHHgHUdH+%(t躬UHHPH}HuHUHMLEdH%(HE1HEHEHEH@XH t0HUHEHHtHUHMHEHHr HEHH THH躠HUdH+%(t UHH@H}HuHUHMLEHEHEHEH@XHH!Ht8HEH,@4tHUHEHH4-HEH@XHHEH*HHEHEHHEHEH=Hƿ0H$HUHMHuHEAAHHUdH+%(t0UHHPH}HuHUHMLEdH%(HE1HEHEHMHUHuHEHuTHEH@HHUHRPHHPIL fNH\HƿOH$HUHMHuHEAAH2HUdH+%(tOUHH@H}HuHUHMLEHEHEHEH@XH uHEH@XHtHEH@X%HEEH=֐LEȋMHUHuHEMIH UHH@H}HuHUHMLEHEHEHEH@XH"t1HEHuHEHXtE+HEH@XHtHEHnWEEH=ULEȋMHUHuHEMIHIUHH@H}HuHUHMLEHEHEHEHUuHEt4HEH@XHtHEHHtELHEH#tHEHE+HEH@XH$tHEHm+EEH=LEȋMHUHuHEMIHYUHH@H}HuHUHMLEHEH@XHEH}ȋMHUHuHEIL0!HUHH@H}HuHUHMLEHEHEH2>HEHEH@H@X% HHEH@H@X%Ht=HE@u HHESHE@$t HHE;HϔHE.HEH@H@X%Ht H̔HE H?HEHUHMHEHH,UHH@H}HuHUHMLEHEЋ@`HuHHEHUHMHEHHՈUHH@H}HuHUHMLEHEH@X%@HEH=+LEȋMHUHuHEMIH_UHH@H}HuHUHMLEHEH@X%HEH=LEȋMHUHuHEMIHUHH@H}HuHUHMLEHUHEHHoHEH}u1L`HHƿHMHEغHH跇UHH@H}HuHUHMLEHEHE轠uHMHUHuHEH܈7HEHEH=;LEȋMHUHuHEMIHUHH@H}HuHUHMLEAuHMHUHuHEH`/EH=GLEȋMHUHuHEMIH{UHH@H}HuHUHMLEHEHEşuHMHUHuHEH7HEHEH=CLEȋMHUHuHEMIHUHH@H}HuHUHMLEHEHEHE@HtHMHUHuHEH]:H=KHEH@P@LEHUHuHEMIHmUHH@H}HuHUHMLEHEHEHE@HtHMHUHuHEHӆ9H=HEH@P@LEHUHuHEMIHUHH@H}HuHUHMLEHEHEHE@t.H=ӌHEHLEHUHuHEMIH胅HMHUHuHEHUHH@H}HuHUHMLEHEHEHE@t.H=HEH(LEHUHuHEMIHHMHUHuHEH袅UHH@H}HuHUHMLEHEHEHE@t.H=HEH,LEHUHuHEMIH荄HMHUHuHEH'UHH@H}HuHUHMLEHEHEHE@t4H HE@AH}HUHuHEIIDH HMHUHuHEH覄UHH@H}HuHUHMLEHEHEHEH@H@H tHEHHHEHEH@H@H t:H=gHELEHUHuHEMIHKHMHUHuHEHUHH`H}HuHUHMLEdH%(HE1HEHEHEH@HEHH6HEHEH@XHtH HEHEH@XHH!HuH>PHEWHEHQuHHE7HEH@XH t8HUHEHH萸 HEHHHEHEH@XHH!HH(HEHEH@XH0HE@Ht~HE@Ht"H5H =HEHHHEH@PtHZHEGHEH@P-HcHEHEH@XHt]HE@HtRHE@Ht"H4H HEHHKHEH@PHHHeHEHEH@XH%HE@HHE@HtH4H )HEHHtHEH@P@8t HYHE=HEH@P@8t HHEHEH@P@0tHbHEHUHMHEHH,HUdH+%(t谊UHH@H}HuHUHMLEHEHEHEH@H@XH%tHHE@HuHHƿIjHlH}uXHEH@HXHHEHX HSILxYBHHƿiH HEHOHHg uXHEH@HXHHEH HSILNYEHHƿxiHHEH ؍HH HEH}uXHEH@HXHHEHh HSILYHHHƿhHHEH@H@PHUHHhHEH}uYHEH@HXHHEH HUSPILXKHHƿ{hHHEH@H@PHUHHHEH}uVHEH@HXHHEHk HUSPILXOHHƿgH"M}HUHuHEAHHUdH+%(tfH]UHHH}HuHEPTHEH 1HHǸ衂u4LD&YHHƿQg2HEH@XHPHHEH HHǸBu4L%ZHHƿfHEH@0%Hu`HEH@pHPHHEH pHHǸсLp%]HHƿ}faHEH@pHPHHEH !HHǸqu1L%_HHƿ!fUHHH}HEHnHH@eUHHPH}HuHUHMLELMHEHEHEHEdH%(HE1HUHMHEHH  u4LN$uHHƿ[eHE@tHEHE@tHEHEHHEHHHEHHEHHEH@HHEHHE@t HEHHEH@H9u HE?HEHHEH@H9u HEHEHHEHHHC| HUHUdH+%(tcUHH@H}HuHUdH%(HE1@qu jHuHMHUHEIIHѺH5~Hwt&HEغH HHxtu Ew Eu)E wE uEvPG*LVTHǽHƿ0cH}t HEȉtVH}tOHEH@0%Ht=u+HEغH VHHwHUdH+%(taUHH H}HuHUHEHPpHEH@Hp0HEH@H@PHH}HMIH賩UHHH}uUHEHPpHEH@Hp0HEH@H@PH}MA AH)UHHH}uMHEHUHHH}uMHEHZUHH H}HuHUHMHEHHHu1LRHHƿIaUHHH}HEH@0HZHEHZUHH H}H!HEH}u4LHTHƿ`HEHdHP HEH3HP(HEH@HHEH|HUHB0HEH@0HtHEH@ HHEHPHEH@(IL[(HHƿ`HEUHHH}HEHƿ`UHH}HE@LtHEH@H@(Hg]UHH H}HE@LuHEH_CH:HE@LALb+H_HƿX_HEH@H@PHtRHE@8HEH@H@PHHHIL.HHƿ^6HE@8AL2HHƿ^ELEAL˹6HHƿz^MHEH+BHEHE@L9ErLB:H/Hƿ(^UHHH}HuHUHEH 3HH^ u@HEH# IL0O@HHƿ]UHSH8H}HuHUdH%(HE1HE؋@LtzHEHP8HEH HH uXHEH@HXHHEHz HSILNOHHƿ ]HHUHEH HH uUHEH@HXHHEH HSIL|NUHHƿ\H?HEHxH LSHeHƿ>HEtDPtLu5UHHƸ=E%t(HEH@H@XH3HxHX [HEH@H@XH3tDjPatL65[HtHƸ%=HE@ u HEHHEHE@tHEH@HH@XHEHEH@HPHH}u HHTHRILlHɗHƿuHƿ,HE@HEH@hHtCHEH@H@HIL'9H߇Hƿ,HEH@H@XHtOHEH@HHt;HEH@HrH@H@%HtHEH@HPEԋMHUHuHEH u4LHH*Hƿ+HEHHHEHHEHH豫HH?u4LTMHHƿa+ZHEHHHEH@HH9siHUHEH`t EЃ@uFHEHH@HILp&RH&Hƿ*HEHH'HHEHHEHHHEH}uCHEHH@HIL7&YHHƿQ*MHUHEHH u1L^H]Hƿ *HUdH+%(t,)H]UHATSH`H}HuHUHMLELMHEHEHEHEdH%(HE1HUHMHEHH? u4LKrHHƿX)uHE@tHE:H} HEHH)@THEHEH@HHEHHHuHHEHHEHEHH9Es~HUHEHH%IHEHHEHH HHEH@HATSILq${HHƿ[(HHEHUHHEHHUHH? HUHEHHEHHEH#HEHEHHEH@HHEHHEHHEHHHEHHUdH+%(t'He[A\]UHHPH}HuHUdH%(HE14u \uHuHMHUHEIIHѺH5H>;F@u /EUHHHHHHEE9rHUHHHHHHDE9uQUHHHHHHDU9r-UHHHHHHD ЉXUHHHHHHwDHHPL L H~Hƿ*&HE}H}HEȺHaHEH}HEH@ HEHEt6L L!HHƿ%HEH@HEHEtqE`UHHHHHHaCHHEHHu+UHHHHHH(C Љ E}vHEH@HEH}ЉٳEUHHHHHHB!ЅUHHHHHHB}!Ѕu\UHHHHHHqBHH&RPL L HtHƿ $HE}@!HEHUdH+%(t##UHHH}HEH@0HHEHUHH H}HuEHHEH}uOEHHH,BHHIL#H~Hƿ5#PEHHHAHHEHP EHHHAHHPHEHP(EHHHAHEHPHEHfHUHB0EHHHA%Ht"HEH@0HtHEH@ HHEHPHUHEHHu1L'7H}Hƿ4"RHEH@(IL:9HL}Hƿ!E}[߰UHHH}HuHEHM HH$HEH HUHH}uE 2E?HEHEHHgEEm}uȐ]UHH0H}HuUHEHM HH#E 2E܃?H‹EpH HUHcƈL EE܃m}uHE@GUHH H}EE\EHEHUEHD HH.HEH}tHlHUH)‰E}yEE}~EUHH H}EHUEHD <0tXE}~E:JHHUEHD HHH%uE}~UHH H}HE HEHUHHEHUHH讂uiERHUEHHHH !B!HHHHH)HH)HH$ HUE EEH;ErUHHuYHH HHEHEHHɭHEHEuUHH H}uvEoHUEHHHvuJ}t=HUEHALHzHƿE}~UHHH}HEHBUHHH}HuHMHE HHUHH0H}HuHUHE<#u!HMHUHEHH H}&wBH}tHELHyHƿEEEHHH6HUEHH HEHHHEHHHHEEHHHEЉEHEHPHU-E}oHmHEUHH0H}HuUErHE<-uHE`}~7}t*LHxHƿ|HEHPHUUJM0HMHc@4HEu} t7}t*LvHcxHƿUHEHUHHH}HuHMHEHHUHHH}HuHMHEHHUHH H}HuHEHE(H HEH}u1L)8HwHƿQHMHE(HHu1LNH>wHƿ[HEUHHH}HEHƿTUHH}HuHEP$HE@$HEP$HEPPHE@PHEPP]UHH0H}HuHUHMLELMHUHEHHS UHH H}HuHU&u;u+HEH HHF.{uUHH H}HuHUHMHEHHHH)u1LAHuHƿUHHH}HEHUHH H}HWHEH}u1Lc]H_uHƿpcHEHHP HEHrHP(HEH@aHEH@(ILLcHtHƿ HEUHHH}HuHUH}tHEHӔt HEH@XH"uHEH@XH!t]H}u-HEH@XH%uHEH@XHt)HE@uHEH@X%HuUHH}HuHxHpLhDMdH%(HE1E HEH}u4LsHsHƿHxtIHxHEHH&! u/L]vHesHƿj_HptWHptIHpHEHH) u/LyHsHƿ HhtJHhHEH u/L|HrHƿ}tJUuHEH4, u/LXH`rHƿeZyat?HEH, u/LHrHƿ}(t?HEH u/L6HqHƿ}u:HEH u*LHqHƿ} u:HEH` u*LHNqHƿS} t}HEEHEPH"HMHUHEH5HǸuiEu E EtIHEHȻHH u/LnHpHƿHEH u,LKHSpHƿXPH}tCHUHEHH蘶 u,LH pHƿHEHEH虮 HUdH+%(t$UHH0H}HuHUHMHEH@HEHEH@HEHE@ HEH@H@XHHEH@HHHEH9mHHuHE@xHEHlHH{u`HEH@H@PHHHHJHEH}u4LHnHƿH}u\HEH@H@HpHUHR(HPILuHjnHƿoHHEH@H@X%@HHEH@(HUHHHEH@ H@@HtHEH@ HP@HEH҅u]HEH@H@H`oHUHR(HMPRILHmHƿHHEH@H tfHEHPHEHHMHH' u4L5H=mHƿBrHE@]HEH@H tfHEHPHEHHMHH u4LHlHƿHE@HEH@H tfHEHPHEHHMHH7 u4LCHKlHƿPHE@kHEH@H tfHEHPHEHHMHH u4LHkHƿHE@HEH@HtfHEHPHEHHMHH u4LQHYkHƿ^HE@yHEH@H*trHEHxHEHpHEHHMHUIHu4LHjHƿ HE@HEH@H$tcHEHPHEHHMHH0 u4LSH[jHƿ` HE@~HEH@H%t`HEHPHEHHMHH u1LHiHƿ HE@ HE@UHH}HEH@H@H t HEPLHEH@@)HE@(EHE@$+E]UHHH}HuHxHpLhDddH%(HE1EHEHEHptE EEE}HUHuEjMQdQM QAAHѺvH HEH}u4Lo&HwhHƿ| HhtEHEt;HEHI HEH}t$HUHhHH t HE}t]HxtSHEtIHxHEHHޯ uFL/HgHƿ Hxt HxHpHEHpH@H@H@PHEHEHEHpH@@ HEHHEHpH@HsHEHHEHpH@H@H@XH'tH}vHEHpH@H@H@XHtHpH@HHEHpH@H@H@XHtHpH@HHELEH}HMHUHuHEMIH HEHEH9EuHEH9Et H}t HEH9EtHEH}uHEHtHuHEHpHUH/u*LSHeHƿEHEHl EHUdH+%(tUHSHHhH`HXHPLHdH%(HE1DžxHEHEHEDž|H:eHh HEH}u4LHdHƿNHUHHHEHH u/LHdHƿDžtHEHHtHHHHHȋAtXH`HHHtPILH#dHƿ(HDžxtHE@9tixHE@(HEH@0AtKH`HILOHcHƿDžxHEH@0HHEH@0PHEAȉH!dHǸ: y/LHcHƿ$UHEйHHEH}u/LHbHƿHEH@0@HEH@0@HH HEH@0@H H%H HEHP(؃É؃P ЉÉ؃HuHhHcLHaHƿxuDž|"H`H@(H`H@(H % H`H@(H%jjjRAA LH HEH}u/LEHMaHƿRLEH}HMHUHuHEMIH誥 HEHEH9X0HEH9PHEHHEHHEH8HH$t/LH`HƿHEH`HHKHEH}tHEHtNHEH< t?HEHTHH HEH}t\HEHtHEH< u>H`Hg ILH_HƿH}Dž|H}t HEHV HEH |HUdH+%(tH]UHH`}udH%(HE1UMHEjjjRAAHƿH HEH}u1LH^Hƿ&HEH茝 EtEątHUdH+%(tUHH`H}dH%(HE1HEHEEHEH@(HEH@(H % HEH@(H%jjjRAA H HEH}u4LH]Hƿ8LEH}HMHUHuHEMIHI HEHEHHEHDHHHEHt3HEH}HuHMHUIIH5]HǸ3tlHEH@(HEH@(H % ЉHEH@(H%HRALH\HƿH,}u&UE։OuUE։H[HƿH7}uUE։ZtEH}HEHV EHUdH+%(tUHHpH}dH%(HE1HEHEHEEH[H HEH}u4L !H[HƿHEH@(HEH@(H % HEH@(H%jjjRAA vH HEH}u/Lo%HwZHƿ|LEH}HMHUHuHEMIHԞ HEHt%HEHMHUH5HǸtlHEH@(HEH@(H % ЉHEH@(H%HRAL>)HYHƿHDHEHJ E‹EjjjRAA ;H HEH}u/L41HGHƿCH HEH}u4LHFHƿUHEH; tUHEHQ u>UHEPAL HFHƿHHEH EHEH EUHH}uHUHEHURURjAAHƿH UHH0}܉uHUEUjjjEPAAH HEH}u1LHEHƿSHEH HEH}t&HEHaHHMHEHH{tEHEH EUHH0H}HuHUEjjjjAA H HEH}u1LHDHƿ^HUHMHEHHY u3ELWH_DHƿdHEH EUHHPH}HuHUȉMDEDMEHEHPHHEH@PHHEH@HMHT HEH}u4LHCHƿzHEH@HUHMHHDHEH}u/L_HgCHƿl HE HEHHtzHEHHMHHϐ uWHEILCHBHƿH}tHE0HEkDE}MHUHuHEHu uuEAHH E}u,LRHZBHƿ_HEH@HUHH觿 EUHH@H}HuHUHMHEHUHMHEHHdBHEH}u4LãHAHƿHUHEHH HEH}tfHEHʱ HEH}u;HEHBILHSAHƿXHEu HEHUHEHH荾 HEUHHHxHpHhH`dH%(HE1EHEHEHEHhHpHxHH AHEH}u4Lj Hr@HƿwHUHEjjjjAAHѺHƿ H HEH}u/LH?HƿrEu/LH?Hƿ0E̅HEHP~ HUHEjjjjAAHѺHƿ AH HEH}u/L:HB?HƿGEtE̅u,LH?Hƿ pLEH}HMHUHuHEMIHe HEHEHt5H`HHHEH`HHu EH}uHEH+} HUHxHHػ EHUdH+%(tUHATSHHhH`HXTdH%(HE1HEHEHDžxDžtHXH`HhHH;>HEH}u4L<H=HƿHUHEjjjjAAHѺHƿ -H HEH}u/L&?H.=Hƿ3oEu/LBH<Hƿ-EHEH{ HUHEjjjjAAHѺHƿ qH HEH}u/LjIHr<HƿwEtEu/L-LH5<Hƿ:jLxH}HMHUHuHEMIH菀 HEHtHEHgHH@t/LRH;HƿHxHt*HxHtH s<HHǸ\t/LMUHU;HƿZt9Tt HH2DtH`H}u}u%}u }uUEHH UHHHHH@H8H0D,L HEHHEHHE(HdH%(HE1Dž`HEHEHDžxH tH HHEHEDždDž\HDžpHDžh\HHHH@H0HH VHEH}u4LH7Hƿj,t%(,t  HH8H@HEjjjjAIHH HEH}u/LH6Hƿ|Eu/LH6Hƿ:Ht UHLxH}HMHUHuHEMIH{ HEH tqH HHEHHk HEH}uAH H7ILH6Hƿ HEHEHEHSHxHCHEH0HHt2HEH@ H@@HHEH@ HP@HEH҅HEH@ H@PHHEH@ LPPLxHHHHHHHHHHxLEH\HhVHpVHAHu/LH4Hƿsdt\HDžd:HhHp‹\HYHH}H tcH HHEHH~ HtAH H5ILH4Hƿ$dt?H} t,L̕H3HƿUHHHH@Hh6IL4H3HƿDž`HEHr ,tL'#t>HLH#3Hƿ(`HUdH+%(tJUHHPH}HuHUHMDELMHEHEHEHEdH%(HE1EH}HELE}HMHUHEHuVu VuuMAHH t EueHEH@HtQHEHpLE}HUHEHMQM QuuMAHHH.H t EuNH}tGLE}HUHuHEHMQM QuuMAHѺHH t/Lb(Hj1HƿoHUdH+%(tUHHHXHPdH%(HE1DžlHEHDžxHDžpHEHPH[HEHPHHEHEHXHHUHPHH 1HEH}u4Lj;Hr0HƿwHUHEjjjjAAHѺHƿ H HEH}u4L>H/Hƿ(Eu/LAH/HƿLpHxHMHUHuHEMIHt HEHPHHEHH HEH}uAHPH0ILHH*/Hƿ/GHEHEHxHHpHH}u/LRH.HƿHEH@H@ H@HHt_HEH@H@ L@HHpHXHHMHHAЅu-LNXHV.Hƿ[vH}HPHHEHHI Ht>HPH/ILe]H-Hƿ DžlHEHvl lHUdH+%(tUHH0H}HuUܾ@H.HƧ HEH}u4LNtHV-Hƿ[HE@HX HEH}u=LwH-Hƿ HEH# NHEHUHPHEHUHHEHUHP8HEU܉P0HEH@HE苀1 HEUHHH}HEHH譧 UH虽 ]UH½ ]UHH@H}HuHUEHEH@XHtHEHHtEHEHPtHEHFQHEHEHEHEHPHHEH@PHHEHH!v HEH}u4LH+HƿHEHHMHH+HEH}u1L,H4+Hƿ9rHUHuHEHMQjuAAH VHH u1LH*HƿUHHPH}HuЉUHMLEHEHMH@H@(HEHEHHEHEHPHHEH@PHHEHHMHt HEH}u4L H*HƿHEHHUHMHHS*HEH}u4LH)HƿHEHuILcHx)Hƿ}HLEЋ}HMHUHuHEHjuuMAHCH u1L H)HƿUHSHHXHPHHH@dH%(HE1DžlHEHDžxHPHHEH@HXH H葬 HHHHHHHu4L)H1(Hƿ6HXHHUHPHHk(HEH}u4LʉH'Hƿ;HUHEjjjjAAHѺHƿ ]H HEH}u4LVH^'HƿcUH@H@HPH(ILH&HƿHxHuHMHUHEIIHYk HEHtHEH'HH tUHEHtHEHHPL &LHb&HƿgHHxHXHHpHHS u,LH&Hƿ gHHHHXHHHHHHpHPHpHPHpH@HHHHH{ CDžlHEH7d lHUdH+%(tH]UHH@H}HuHUEHEH|HEHEH@XHH!HuCHEH&ILd-H$HƿCHEHHH)HEH%HH HEHDHHHEH}HHtoHEHHHtUHEHCHHt;HEIL9H$Hƿ`HEHHUHMHHN$HEH}u4L>H#HƿHEjjjjAAHBH HEH}u4L;AHC#HƿHHUHEHHv u,LDH"HƿCHEH u,LGH"HƿEHEHKa EUHH@H}HuHUEHEHyHEHEH@X%HuCHEH#ILZH("Hƿ-`HEHHUHMHHh"HEH}u4Lǃ`H!HƿHEjjjjAAH\H HEH}u4LUcH]!HƿbHUHEHHt u,L fH!HƿCHEH+ u,L΂iH HƿEHEHe_ EUHSHHhH`HXHPdH%(HE1DžtHEHEHPH`HwHHhHH`HH HEH}u4LHHƿjHUHEjjjjAAHѺHƿ 肫H HEH}u4L{HHƿUHPHPH`H IL3H Hƿ%H}HuHMHUHEIIHc HEHtHEHHH2tUHEHtHEH?HPL LHHƿHHMHhHHxHH u/L+H3Hƿ8HhH H4 HXHHXHHu/LHHƿ:HXHHhHHHXHHxHPHxuHxt6HXHBHXHRPHXH@BHxHP0HxH@ HXHHH CHxHPHxH@HXHHH CHxH@ Ht#HxHP HxH@(HH HXHBDžtHEH-[ tHUdH+%(t跾H]UHSHHhH`\HPLHdH%(HE1HEHDžxDžtHHHhHH HPHHPHHu4L}HHƿ詾 H`HsHHhHH`HHHEH}u4L/}H7Hƿ<HUHEj\QjjAAHѺHƿ 车H HEH}u4L|HHƿý'UHHHHH`HILH[Hƿ`HxHuHMHUHEIIH^ HEHtHEHHHHjtUHEHtHEHwHPL LHHƿǼHHxHhHHUHH{ u/Lc{HkHƿpHPHHhHHHPHHUHPHE@8uHE@8t#HPH@HPH@BPHEHP HEH@HPHHH CHEHPHEH@HPHHH{ CDžtHEH7W tHUdH+%(tH]UHATSHHXHPLH@L8dH%(HE1HDžxHDžpDžlH8HXHH H@HH@HHu4LyHHƿ论HPHoHHXHHPHHHEH}u4L4yH<HƿAZHUHEjLQjjAAHѺHƿ ¢H HEH}u4LxHHƿȹUH8H8HPHILþ H`HƿeHpHxHMHUHEIIHZ HxHtHxH BHHft[HxHt HxHmHPL ALHHƿ轸HHpHXHHUHHM u/LYwHaHƿfrH@HHXHHH@HHUHPHE@tH@H@HPH8HH 8@THEHPHHEHHHuHHEHHEHEHH9EHXH@HUHHIHEHHXH@HHHHPHATSILD%H)Hƿ.HHEHUHHEHH@HHUHH CDžlHEHR lHUdH+%(t He[A\]UHHHxHpHhH`dH%(HE1HEHpHjHEEH`HpH@XHtRHpHHt?HpH@PHHpAAHuHEHxHHUHpHH.HEH}u4LtMHHƿ蚵?HUHEjjjjAAHѺHƿ H HEH}u4LtPH!Hƿ&UH`H`HpHfILUHHƿôH}HuHMHUHEIIHV HtAHpHILٹZHVHƿ[HEHtHEH/=HH芳tNHpHHUHPIL`HHƿHHEHt'HEHhH HHǸ荰tKHpHHUHPILFfHkHƿpH EHEHN EHUdH+%(t耲UHHHxHplH`LXdH%(HE1HEHEHEEHXHxH0HГ H`HH`HHu4LhqHpHƿuHpHfHHxHHpHHHEH}u4LpHHƿBHUHEjlQjjAAHѺHƿ 艚H HEH}u4LpHHƿ菱UHXHXHpHIL2H'Hƿ,H}HuHMHUHEIIHR HtAHpHgILBH HƿİHEHtHEH0HHtRHEHtHEHHPL 0LHK HƿPHH`H8HUHxHHMHpIHtu,LnH Hƿ!H`HHxHHEHEH^K EHUdH+%(tUHH H}HEHPHHEH@PHHEH@PHH@HV HEH}u1L!nH) Hƿ.HUHEHHӤUHHH}HEH,UHHH}HEH/tLHEH@XH H!Ht+HEH@XH%tHEH.HHuUHHpH}dH%(HE1EHEHPHHEH@PHHEH@PHH@HU HEH}u4LlH HƿHUHEjjjjAAHƿ|H HEH}u4LulH} Hƿ肭EtrHEHquQEtjHEH}u:HEHKu*HEH_ uHEH@XHH!Ht HEH^EHEHEHEHH EHUdH+%(tUHHpdH%(HE1HEPHCtMHuHMHUHEIH5HǸGu!Eu Ew EvHUdH+%(txUHH H}HEHHEHE@HIL nHyHƿ~< HpjjjRAAHƿH H`H`u4LgtHHƿpH`H H@H`H赳 HhDe]HHhATS@IL#zH`HƿeH HXH@HPHHtuHXH@HH@PHHhH@ HHH@H HHx HH@HEAHH?S HH@PHUHH$HHHHuTHH@PHHhHPIL4HIHƿNHDHHH0$tHHHh)HHHHHHHHqHSILHHƿɦHHuVHHH H(HLZeHbHƿgdHHHH H(AH:Ru,LeHHƿ Dž8H`HA 8HUdH+%(tHe[A\]UHHH $H`HHHHLdH%(HE1 HDžHHHHAHHHǸ E y4L(HHƿ HHHHzqHt HݍHLHHRHDRPILJqHiHƿnH (HHH /HHquoHL@HxHHHHMAHu,LbHHƿͣ.HHHHGDžHHѤtL(PH#PL LnH=HƿBHHUdH+%(tgUHAVAUATSHHHH@H8H0dH%(HE1H8HPHH8H@PHHHHH0HJ H`H`u4LcaHkHƿpHH@,tHHH@HG HHHH0H8HHHhHhu4L`HHƿ-HHH@ HHH@HHHHH@HHXHhHH&L u>H`ILH<HƿAHX@HX@f)E)E)EEUEUEH`HRPhILHHƿ辠H {HHH@HhH`HjjHMQAAHƲH u4L:_HBHƿGH0BH8@t/H8@xEtUH8@x9tnDuDmH8D`xH8XtH8H;AVAUATSILHHƿ葟H EH8@xH8@tHpH‰t^ptTH8@xH8RtHPALHHƿH>EH0H8HHAAH2ȋUuH@H uFEUHPAL> H[Hƿ`HEHH@,H8HHhIL HHƿHHHH@HGHHH@HGHhHHu4Lz\ HHƿ臝EH8H@X% HH8H@H_HHH8H@HH (HHIu^HMH8H@HHIȹHu1L[ HHƿ軜HUdH+%(tޛHe[A\A]A^]UHHHH DdH%(HE1HHPHHXHDž`HDžpHDžxHEHEHEHEHEHEHEHEHEHEHEHEHEHEDž,H@HPHHѺHH0H0u9HPILM= H)Hƿ.H0HpHqH0H H$H(HpIH5cHǸ襗(9 r8(9 u4$9r$9u ;r Dž,Hp HH8H8t H8,t HHHPHRR RPHpPIL J HHƿۙH0DHPHpHPILM HHƿ蕙HH@H,HUdH+%(t諘UHSHXHHdH%(HE1DžHHHH@HHHHHHH@PHHDžHPHHHHHHoHPHPu tHH@XH4HHHHHHHUHHHHIL|k HHƿHHHHHH}SHHuFHHILFq HkHƿpcHHHmB HILy HHƿH@HHǸ襒y聕xHHt HH>HHRHBRPILNc} HmHƿrH aH@HΉ[H?ܔӑHHt H<H >HHRHixRPILb HHƿ͕H OtuVMHHt H~H=HHRHdRPIL#b HBHƿGH 6DžHHHu~苋tu蒓艐HHt H}H<HHRHcRPIL_a H~Hƿ胔H u>HILX H=HƿB5HHHHHHu4L3 HHƿݓHH@ HHtBHH@(IL HqHƿviHHPHHPHH@HHt eu>HPIL HHƿHHHPHHPHH襬~u>HPILF HCHƿH;H@uH@ uH@$tyHx$HH HPHPHAHOu>HPIL HHƿ襑uMHHHSIL HFHƿKH HYHƿ^PHEHHEHUHhHH9FHx@0Hx@,HhHHEHEH@H@H@XH2t|Hx@,HEH@HPdHpHxHu4Ll= HtHƿy~kHx@,HEHHEHUHhHH9DHhHHEHEHHtlHx@(t^HEHHpHxHu4L< HHƿ}HEHHt^HEHHpHxHu4L8< H@HƿE}7HEHHt^HEHHpHxH4u4L; HHƿ|HEHhHHEH@H@H$tsHx@ tdHUHhHpHxu4L,; H4Hƿ9|+HEHHHEH@H@H%tsHx@ tdHUHHpHxu4L: HHƿ{HEHHHEHH@XH-u(HEHH@XH4uHx@(tsHx@ tdHUHHpHx/u4L9 HHƿzE HEHUHHHHHȋHEHUHHHHHH@HHx@,t!HhH@XHH!HHEHUHHHHHH@H@XHHEHUHHHHHHPHpHxHu4L8 HHƿyHEH@H@H HEH@H@%HHEHHHEHUHHHHHH@HtuHEHUHHHHHHPHpHxHu4L7 HHƿxEHE@L9EHx@ teHEH@hHtXHEHPhHpHxHu1L(7 H0Hƿ5x*HEHHEHUHhHH9HUdH+%(t3wUHH0H}HuUA6 HEH}uCHEH1IL, HHƿwHEH|~HHG? HEH\ HEHH}MMDH聇tHUHEH u1L# HHƿdH0[A\A]A^]UHH0H}HuHUHEHHMHQ$HHHEH}u1L# H'Hƿ,dXHEHHUHEHH u1L" HHƿcUHH@H}HuHUHEHHEHEH@X%HtHEHHuCHEHILp HCHƿHcHEHHMH#HHHEH}u4L! HHƿb&HEHHpHEHHHH HEH}u4L! HHƿbHEHHpHEHHH¿HEH}u1L!! H)Hƿ.bkHED@THEHH}HMHUHEEIH u1L  HþHƿaUHH@H}HuHUHMHEHHEH}uCHEHILu4L H HƿXEHEHUHHHHHȋ`HEHUHHHHHH@H@XH"t4HEHUHHHHHH@H@X%HHEȋ@,tHEH@H@% HHEHUHHHHHH@H@XHt/HEHUHHHHHH@H_ HHEHUHHHHHHPHMHuHEIHu4Lo HwHƿ|VhHEH@H@H .HEH@H@%HHEHHHEHUHHHHHH@HHEHUHHHHHH@H@XH"t0HEHUHHHHHH@H@X%HttHEHUHHHHHHPHMHuHEAH`u4L& H.Hƿ3UEHE@L9EHEȋ@,HEH@HlILc HıHƿTHEH@H@PHEHGHHHEHH u~LV H^HƿcTRHMHUHuHEHu1L  HHƿTHe[A\]UHATSHHHHxHpLhdH%(HE1DžHx@pDžH@,DžHHH, HHuTHxH辱HhILa H HƿSHtHHxHHpH@(H9xHPHhHuHHht L%#L%HxH SATIL2 H_HƿdRHHxH@XH2t4HHHxHHlHu HxH@XH- HxHH HxHHHPHpHHAHu4Lg HoHƿtQHxHrHHpHHAH0u4L HHƿQj`HxH@XH0 HxHHH@XHH!H HxHHHHxHHHxH@PHHxHhH HHxHKH0HHp@ Hp@HhHxHAAHffHH@H@XH2tH@,HxH@HHHRHHPIL^& HlHƿqOHHHHHpHHHIH3u4L]) HHƿOmHEHH)EHPHHEHHHhHHQHEHUHAHQHEHUHH8Hu HH HHXHMH]HPH@HEHUHHHhHHQHPHXHAHQH`HhHH@Hu HH HHXHpHxHPH@HEHUHHHUH SH5DH HHu4L 5 HHƿMHHHPH H5H HHu4L 7 HHƿ"MHHPHHHHHH iH? HHu4L : HHƿLHHPHHHHHH H HHu4L' < H/Hƿ4LHHHHHhHHu4L ? HɨHƿK5DHxH@PH@`% HHp@H HHhHpHxHHi3HHHHATSAAH- H H H u4L J HHƿJ[H@,HxH?ILYM HHƿJHH HH ,LD O HLHƿQJHxL@HHxH@PHHxH@PHHxH@PHH MIHelu4LW HHƿIHH H u4LL[ HTHƿYIDHxH@PH@`% HHp@H HHhHpHxHH0HHHHATSAAHD+ H H(H(u4Lrg HzHƿHH@,HxHʦILUWj H"Hƿ'HHH(HHC .Ll HפHƿGCHxL@HHxH@PHHxH@PHHxH@PHH(MIHiu4L/t H7HƿO Hp@HxH@XHHxHHHxHHPpHpHHLHcu4L) H1Hƿ6> HxHHHHHAL H՚Hƿ=A HxHHHHHu4Lu H}Hƿ=HxHH{HHxHPpHpHHAH.u4LHHƿ=hHHHHxHH9kHxH貹HhHpHxHHLHvu4L<HDHƿI<HpHxHHHHaLHHƿ;PHhFHxH@XH%t8HxH@XH H!HtFHxH覻HHu+HxH@XHuHxHxHHHpHxHHIHu4L HHƿ:XHxHHHHHLHHƿ:HxHHLhHpHHHHHMIHu4LHHƿ :rHP8H@L9sHP8H@L‰HHHHHxHH9&HhunHxH@XHtXHxHHHHHMu4LH$Hƿ)9HxH@XH%tbHhtXHxHHHHHu4L!HHƿ8HxH@XH0HxH蕸HH@XHH!HHhuHxHHHxHCHH4HHHHHRHuXHxHHHHHu4L)HHƿ7 HxH@XH0HxH艷HH@XHH!HtvHhuHxHHuXHxHHHHH.u4L/HHƿ6PHxH@X% HHxH@HH aHH.HxH@H_H74HHHHxHHQH0H0tfH0HpHxHHIHHu4L:HHƿ5Pu;uHHxHHDžHHH H@0HxH@XH HxHHxHH@HPHpHHAHu1LKHԑHƿ4CHHHHHxHH9kHP,HUdH+%(t3He[A\]UHHpH}HudH%(HE1HEEHEH@H>-HEHQ HEH}HEH HEH}5HEH@H$HEH@HEHPHEHH2HEHpHEHH}HMHUIH u?HEH@ILGDrH<HƿA3HEHH}HMHUHuIH u;HEIL&DvHۏHƿ2HMHUHEHHuH)ubEYHEHH諃u HE@tHEHHۂu+E"HEHHSuEHMHEغHHJ HEH}EHUdH+%(tV1UHHPH}HudH%(HE1HEEHEH@H蜅HEH HHEHH}HMHUIH u EIHEt:HEu2HEH@HUHEHuHvHHH'HMHEHH3 HEH}VEHUdH+%(t?0UHHpH}HuHUdH%(HE1HEHEH HEH}oHEH HEH}WHEHH}HMHUHuIH u;HEILAH4Hƿ90mHEH}tHUHEHHY/HEH@HGHUHH  HEH}u4LaAHHƿ/HEH@HGHEH@HGHUHH胣u>L9HAHƿF/zHMHEкHH+ HEH}EHEH@HGH h &8' B''HEHS HEH@HGHEHEH@ILeHtHƿy.HEH@H\(HHEHHHEHH7 u1LHHƿ!.XHEHHEHUHEH@HGH9FHEH@HGH`e HEH@HGH HUdH+%(t,UHHPH}HuHUMHE$E}wwHEHHHE@t H>HMMHHHHH %HVRILHHƿ -HHEH@XH-tYHEHHe uCHEHFIL>HHƿ,@}t}uHEȉP }t}uHEȉP$HE@(HEH@EHEH@H@H@HH!Ht}uHEH@ HEPHMHEHHHEH}u4LHHƿ+?HEHPE܃ ȈHEH HEH}u/L3= H Hƿ%+$HEH HE@tHEHfHHEHHMHH3HEH}u/LHHƿ*}EHH"HH"H>uvt HEHa HE@tHEHuHMHH4LHHƿ)|vt HEH HUHMHEHH'3 u/L#HHƿ)HUHEHHtHEHILr;%H?HƿD)HEH HEȋ@u HEH HUHMHEHH2 wL/H΅Hƿ(SHEH蜥t HE@uGHE@t5HEH@XH%uHEH@XHtHEHHJHMHUHuH}ILu/L:HHƿ(HUHMHEHH͘ u/L>HЄHƿ'UHEH y HE@OHEH@XHH!Hu5HEH@XH H!HuHEH t HE@}HUHMHEHH7 u/LKHHƿ'HUHEHHuvHEHcIL.9MHHƿ&;EAL$9SHHƿ&EHEH lHEH EUHH H}HuHUHUHuHEHzu1LfHHƿ%SHUHuHEH,u1LiHHƿ%UHH H}HuHUHMHEHEPHUHuHEHu1LuH'Hƿ,%HEPHEUHHPH}HudH%(HE1f)E)E)EHUHuHEHu1LHHƿ$HUdH+%(t#UHH H}HuHUMDEHEUP}tHUHuHEHzu1LHHƿ#UHATSH`H}HudH%(HE1E' HEH}u2LQ6H~Hƿ#EHEHs*HH> HEH@(HEH@(H % HEH@(H%HEHU uyHEH@(HEH@(H % AHEH@(H%HEH8*ATSIL5HHƿ"HHEH HHq%HEHHhHEH HHQ%HEH HEH}u,L14HHƿ#"OHMHE$HH荘 t,LH~Hƿ!EHEH EHUdH+%(t He[A\]UHH H}HuHUHEIHHoH¾HѱHǸI u4LP4,HOHƿ2!8HHOt L gL4HHƿ @H1H9 #EHH($;2Ht H HlHRHRPL L9HOHƿ2 H E"8 E"8 UHHH}HuHUHEIHHH¾HHǸ葿 u1L2JH~HƿzkHϿH,NtSHH t@L Lt~PH9~HƿHxHUHHH8dH%(HE1H8HHHHH[RH8PHGPIL2`H}HƿrHHPHHXHXHHH_HXH HHp>HXH8IHH#H¾HNHǸƽ u9HXIL}kH|HƿH`HHHJx%=`L L|rHU|Hƿ8HHyRPHrPL jLtH{HƿHHHH HPHPFHHHtO:1H8PH.PILyHn{HƿQHHEdH+%(t|UHH`HHHHDdH%(HE1HHIHHH¾H/HǸ觻 u>HIL.HzHƿHIHHHU!H¾HHǸ- u>HIL.H)zHƿ kY HIHH H¾H=HǸ赺 u>HILZ.HyHƿHHHyH¾H HǸE u>HIL2.HAyHƿ$H`HHl Hx%= t6L C L-HxHƿH HL LxHxHƿqH HyLPHPL LH3xHƿHH`HHdHx%=tMx%=`t;L )L -HwHƿz ndHHHHeujH`HHHHuMHHEH9u L sL,HwHƿ1L @L,HvHƿL L wHvHƿHH Ht HlH:HRH RPL LHvHƿH [0y tCbt:t1L 3LD,HuHƿHHPL L vHuHƿiHHH2/ HHHH H{t H1HHRHuRPL RLHtHƿH . }. HUdH+%(tUHHHXHPHHDdH%(HE1HHHPHXIIHHD H¾HwHǸ u4L*HsHƿH`HH HxKu 5,Ht HHfHRHyRPL LHIsHƿ,H X\v tC_t:Dt1L _L*HrHƿx%=t;L L5*HrHƿL L sHqrHƿTHH yvHt HBHHRHlRPL cLHqHƿH HUdH+%(tUHH0}HuHUHMLELMЃ}}}t }tvyHUHEHHt&}HMHUHuHEAH8LHqHƿ MHUHuHEH_tHUHEHHLHpHƿH}tEMHUHuHEHu*L4!H^pHƿA}HMHUHuHEAHu0L$HpHƿUHSH(H}HuHUHEHHUHHlHEHHEHHEHHEHH HHHEHH]UHHH}HEpHHHHH{ HEHH HEH UH}E,E;Et EHH/tE}vθ]UHH}}tq tr tUHSHh}HuHUHMLELMdH%(HE1HEHT HHEHE HHEH6 HHEH' HHEH HHHE؃}EHJHEHEHHEkHEHEHEHP(HEHHu5HEHP HEHH uHEHEpt%HEHEHEHHEHH9Euga}ElHHEHEHHEoHEHEHE@uHHEHP(HEHHI u-HEHP HEHH. uHEHLHEHEHEHHEHH9Eu}EHHEHEHHE]HEHEHEHP(HEHH u'HEHP HEHH u HEHHEHEHEHHEH[H9EuHEH@H5HEH}u4L#HkHƿ HEH@HEHEUPHEUPHEHHHUHEHHHEHH HUHEHHuHEHH(HUHEHHZHEHH0HUHEHH?HEHH8HUHEHH$EHH5HEHH HEHH$HuC HUdH+%(t H]UHH HHEHEHHEmHEHEHExHELH8HEL@0HEHH(HEHP HEHpHE@HWHHEHHEHEHEHHEHeH9Eu5UHH0}HuHUHMLELMKtfLMLEHMHUHuEH}W Hu1LnHiHƿ{ 1*LMLEHMHUHuEH}WHUHHH}HuHEH@PHHEHPHHEH@PHHuHvPH6HHH}HQL ޱIHH¿HUHHH}HEH@PHHEHPHHEH@PHHuHvPH6HHHQL oLhHH¿^HUHH H}HuHUMHMHUHEHuVL LHƿHUHH H}HuHUHMHEH@PHHEHH HEH@PHHEH@PHHHHUHEHQL LHH¿xHtlHEH@PHHEHPHHEH@PHHuHvPH6HHH}HQL IHH¿HthaHEH@PHHEHPHHEH@PHHuHvPH6HHLEH}HQMIHH¿HUHuyL(gH{fHƿ^} u*LH@fHƿ#H4e]UH-]UH}E]UH]UHut]UHHH}HuHE(HHUHMHHe UHHH}HuHE(HHUHMHH UHSHHH}HudH%(HE1f)E)EfEH(HEHEHuHHEH HEEHUHH(HHMH]HHXHMH]HHHXHMHH HArH0HEdH+%(tHEH]UH}E]UHH}HEH]UHH0dH%(HE1HHEHHHEHUHjHkHEHhRxI\u?>ALAHldHƿTLDH6dHƿhLEH dHƿ>HEdH+%(tlUH|t HyHu ^]UHNt>HHHHDHEHHQH?HA/|H  UHH}}e}e}d}d}ty}}t }t4LaHbHƿ LdHbHƿLgHbHƿL lHabHƿLoH7bHƿi*L rH bHƿ=NtLuHaHƸUHSHH HHEHUHHQHE HU(HAHQHHHcH>H HHHHuuH HHEHUHHQHE HU(HAHQHAaHH?aHH ILu{H`Hƿ'H HHEHUHHQHE HU(HAHQHHHNbHmH HH\HHuuH HHEHUHHQHE HU(HAHQHp`HHn`HH IL~H$`HƿVH HHEHUHHQHE HU(HAHQH_HH_HH HH HHEHUHHQHE HU(HAHQH_HH7aHVH HSILHd_HƿH[KtLQH!_HƸXH]UHSHHxtdH%(HE1HHyHEHEEEEEEHEH^HH4xHxHHHHEHUHHQHEHAH^HǸyH u/LH3^HƿettxtHHHHEHUHHQHEHAH!^HǸGyH u/LH]Hƿ H}tvHuHHHHEHUHHQHEHAH]HǸxH u/LH5]HƿgHuHHHEHUHHQHEHAHHH H HHQH HAHpH0EtH]EHSIL H\HƿHH HHEHUHHQHEHUHAHQHHH]H H HH\HHuEEEEFH HHEHUHHQHEHUHAHQHHHu]HH HHPHHDH HHEHUHHQHEHUHAHQHHH[H4H HH[HHuCH HHEHUHHQHEHUHAHQH,HH ECH HHEHUHHQHEHUHAHQHHHlH EEEH HHEHUHHQHEHUHAHQHƢHH$\HCH HHZHHu@HxILH6ZHƿhEEYH HHEHUHHQHEHUHAHQ1H LHYHƿH HHEHUHHQHEHUHAHQoH HHHHEHUHHQHEHAuH HEHEEEHEMHHMdH+ %(tH]UHSHHxHpHhH`dH%(HE1HHHEE [HEH}uEyH`HEH3U HǸ@ ~5LdH|XHƿHEH HEHpHHqHxH@HhLBHhH:HhHrjPHXPuHXPHHHEHUHHQHEHAMLWXHHYXHHXHǸ4sH@u9HpILPXHWHƿH`@H`@HHHHEHUHHQHEHAHtWHǸrH u9HpILWHVHƿ-bHxHxHHHHEHUHHQHEHAHMWHǸqH u9HpIL WHOVHƿH}HuHHHHEHUHHQHEHAHIVHǸcqH u9HpILVHUHƿ+H`@0H`Hp0HHHHEHUHHQHEHAHAVHǸpH u9HpILUH*UHƿ\HuHHHEHUHHQHEHAHHHHHHQHHAHhH0EtH]EHSILHTHƿHH HHEHUHHQHEHUHAHQHHHUHH HHUHHu EYH HHEHUHHQHEHUHAHQ#H L HSHƿH HHEHUHHQHEHUHAHQiH HHHHEHUHHQHEHAoH HEHrEHUdH+%(tH]UHH0H}HuHUEHEH@Hu4LHRHƿHEHHu4L $HRHƿHEH@Hu4L )HiRHƿxHEH@ % HHEHHHEHHE؋@t H SHLQRIL .HQHƿ"HHMHUHEH5}HEHEH@ %@HthHEH@HUHHPIL^ 2HvQHƿHHMHUHEH5U2HEeHEH@ %H%HEH@ %HthHEH@HUHHPIL 7HPHƿHHMHUHEH5hHEHEH@ HH!HteHEH@HUHHPIL <HdPHƿHHMHUHEH5HEVL AHPHƿH*L DHOHƿEUHH0H}HuHUEHEHEH@Hu4Le QHOHƿRHEH@HUHHPILR UH:OHƿlHHEPHEH@HHEE ЉEEHE؉Et4L[HNHƿEtEt2EAL _H{NHƿMEt E:L dHHƿ'HHEHmHEHHUHMHcHHHuPILdH=HƿHEHEU؉PHEHHEHUHEHH9H]UHSHH}HuHUHMLELMHEHxHEHpHE HhHE(H`HE0HXHE8HPHE@HHdH%(HE1%HE0EHPHHHhHP HH u YVu EFu 1H}t HEu HJHEH}H}HpHuH5IHMHuH IHUHuHIH`HuHI}LcH}H]LXLUjVH5<VQH =QRH =RxH=RuH=RuH=RPH=PhH=PAPL <IH<HLLָHĐHHHPH HHEHUHHQHEHUHAHQH [HHHPHMHRPuuhILH:HƿH0H}tHMHuH HHHUHuH8HH`HuH%HuLcH L]LXHujQH ;QRH;RuH;RPH;PhH;PAPL /;MH/;HLҸbH`H H(HEHUH0H8HEHUHHHPH HHEHUHHQHEHUHAHQtH HHHPHMRPuhILoH39HƿQH HHUHuHFH`HuHFMHcH LELXHujRH7:RPHg:PhHc:PQL 9H9HLҸH@H H(HEHUH0H8HEHUHHHPH HHEHUHHQHEHUHAHQ(H HHHPHMHRPhIL9H7HƿH H HHEHUHHQHEHUHAHQLH zHEHhILHj7HƿHH HHEHUHHQHEHUHAHQ.LH HUdH+%(tH]UHHHHHdH%(HE1H08HHDž8Dž@DžDDždHHHxHHDžHHHHDž Dž8H  $$PPALEH5HƿHH0HHH HHHkHHOHHHu4L` HO5HƿmH0HHH H(H(uRHHHHPILH4HƿHHH(H`HUdH+%(tUHHH}HuHEH`HuWHEH`H@HHUHHPILH"4Hƿ@H/L5 H3Hƿ UHSHH $H(HHdH%(HE1HH`HH0HHDždDžt HH‹ЉHHH H HHHRPIL=H2HƿH HHHH0HHHukHHHH2HHH/HSILuFH!2Hƿ?HHH#uFHH/IL@LH1HƿYHHH HHHPHHH@PHHH@PHH@Hw H H u4L;SH*1HƿHL HH HIHHHǸo yFHHl.ILWVH0Hƿ@HH‰)AL>[HR0HƿpHALG`H0Hƿ9HHHHH(H(uFHHq-ILcH/HƿEH(H^uFHH-ILhHW/HƿuHDžHHHHH H(HHittHHHHHHHr,HSILpnH.HƿHH(HX1HHH98H(HWHUdH+%(tH]UHHH}HuHEH`H?uCHEH`H@HIL/~H-HƿUHSHXH}HudH%(HE1yu Oiu ;HEHE}u HUHEHHu HEHHcHEjSL .IH0.HѺH5.HǸaHH}H HHEHUHHQHEHUHAHQH u EEEEuUHMHEHHEH HHEHUHHQHEHUHAHQEAH EHUdH+%(tH]UHHH}HuHEH`HEHHWuWHEH`H@HHUHHPILH+HƿHUHHH}HuHEH`HEHHCXuWHEH`H@HHUHHPIL?H#+HƿAHUHSHxH}HuHUdH%(HE1HEu cu OHEH HcHEjuH+RSL ,IH+HѺH5s,HǸH H}H HHEHUHHQHEHUHAHQH uEE(EEEJ{i=,t[=,W=(t =*tDHEHILHu)HƿNHEHILH8)HƿVHEHHuILH(HƿHHEHHuILH(HƿHHEHILHk(HƿGEHUHHPILS*H)(HƿGH}{H HHEHUHHQHEHUHAHQHHH HEH}uDHEHIL H'HƿEHEH@HUHH迦 HEH}uDHEHILH1'HƿOEHEHUHHEHUHHEHjtHEHhuAHEHILkH&HƿE EH HHEHUHHQHEHUHAHQd;H EHUdH+%(tH]UHHH}HuHMHEHi,HHUHHH}HuHMHEHL,HHUHAUATSHHhH`\dH%(HE1HEHEEEfu 9Vu %H`HHERHEH@H@@H|HMHH lt E=t |=u EHEHHEHUH`HH9u}uEEALOH$Hƿ}t }t ECE:EAL&UHd$Hƿ \t)}u \E}u \EUH`HhH)Hu4L0&lH#HƿH]HuHx1H`H`LhHH`LHcHEjSH%RAUH$RH)RH$RATL $IHy$HѺH5J%HǸH@HxH HHEHUHHQHEHUHAHQH uEDžx(xExv0dR@=,tw=,.=*&=*=$=(H`HILVH"Hƿ0H`HILH!HƿH`HH`HH&RPILH{!HƿHLHM!HƿkJH`HILH !Hƿ+ H`HILH HƿH`HILH Hƿ諿H`HILiHM HƿkMxH`HHPIL/"H Hƿ#H}H HHEHUHHQHEHUHAHQH HH HEH}uGH`HILHpHƿ莾ENHhH@HUHH蕞 HEH}uGH`HILHHƿ"EH`H`HH`H`HPXH`H`HH HPXH`H$HH`HUHH`HtH`HuDH`HILH)HƿGE E}@B賸H`HhHHHH`HhHH7H`H0tH`H+u*L{HHƿ螼H HHEHUHHQHEHUHAHQH2H EHUdH+%(t蛻He[A\A]]UHAUATSHXH}HudH%(HE1Eu Zu FHELHELHEHHcHEjAUHRATHRSL IHHѺH5HǸH0HuH}H HHEHUHHQHEHUHAHQH u EEE}uEUHEHRPL L6HHƿHH HHEHUHHQHEHUHAHQ0H HUdH+%(t߹He[A\A]]UHHH}HuHUHEHHUHHH}HuHUHEHHUHAUATSHXH}HudH%(HE1Eu u HELHELHEHHcHEjAUHRATHRSL IHHѺH5HǸH0HuH}H HHEHUHHQHEHUHAHQ H u EEEEu:HEHILWHHƿN}uGUHEHRPL EL"HzHƿ蘸HH HHEHUHHQHEHUHAHQ;.H EHUdH+%(t获He[A\A]]UHHH}HuHUHEHHUHHH}HuHUHEHHUHAUATSHXH}HudH%(HE1Elu \u HEt4LKH=Hƿ[cHEHHtHEHuBHEHILQHHƿHELHELHEH HcHEjAUHRATHRSL IHHѺH5HǸH0HuH}H HHEHUHHQHEHUHAHQH u EEEEu=HEHIL\hHHƿ}u5EALmHHƿ諵EtLHEHIL}HFHƿdHE@BٰHUHEHHtHUHEHHiH HHEHUHHQHEHUHAHQ*H EHUdH+%(tHe[A\A]]UHH H}HuHUMHEHwsHHŭHHH>xqHUHEHH\UHMHEHH9DHUHEHH/LnHHƿUHH H}HuHEHHEHEH@HSHEHpHEH Hz7uWHEH@H@HHUHHPILH4HƿRHHEHpHEHH6uUHEH@H@HHUHHPILRHHƿײH(HEHHEHUHEHH9UHH0H}HuUHEHHE}t }t}u_}tYHUHEHHKuBHEHILHHƿ}EHH/HH#H>HEH`HtHUHEHHunHUHEHHRYHUHEHHDHUHEHHQ/LHHƿ<UHHH}HuHEHHRt4Dtk:y]/u*HUHEHHFBHUHEHHZ-LHxHƿ薰UHAWAVAUATSHH8H0,H dH%(HE1DžDDžHHE@HgH0Hu uEH0HIL HHƿ¯iiuEH0HILy$HUHƿsH0HHtH0HHRH0H,RPIL2(HHƿHH0HHhHE@HHBu4Lm,HHƿ諮RH0HHtjH0HHHHuFH0H8HHu H8HHH0HH@HHW9HPH0HH,t L-FL-fHHHH0@(HEtLeL%/H0HHuHH0LH0L蛦HcH`HPjAUH QH QH QATH QSH 3QAWH ;QAVL ]IH H5fHǸ)HpHPHE,t L-&L-FHHHH0@(HEtLeL%H0HHuHH0LH0L{HcHjAUHRHRHRATHRSHRAWH"RAVL DIH HѺH5EHǸHpHHH`HhHHHpHxHDH@H HH`HhHHQHpHxHAHQH uDžLDž@(@LDtH8@tk=-<=(HHHHݣH>EH0HH0LtHSML iH HƸHwH0HIL*lH Hƿ̩7H0HILoHn Hƿ茩DžLH0HILsH$ HƿBH t H DžLH0HH0HHPILyH HƿΨH5H0HIL|Hl Hƿ芨H0HH0HHPILH Hƿ7HH0HH0HHPILnHHƿHJ@H0HHPIL HvHƿ蔧HH HH`HhHHQHpHxHAHQ.H LHUdH+%(t~He[A\A]A^A_]UHSHXH}HudH%(HE1HEHu eu Qu =HEHHt HEHHHUHHPILk HGHƿeHHEH蔟HcHEjSL IH7HѺH5( HǸhHH}H HHEHUHHQHEHUHAHQ諼H u EEEE=.u EEu=HEHILCHOHƿm}uFEHUHHPILN HHƿ"HaHEHH HHRu?LHHƿѤHUHEHHH HHEHUHHQHEHUHAHQeH EHUdH+%(t踣H]UHHPH}dH%(HE1u gu SfHcHEAIH HѺH5HǸ>H}H HHEHUHHQHEHUHAHQ腺H u EEẼ}u*LHOHƿmH HHEHUHHQHEHUHAHQH HEtTL8HHƿLVHHƿآEHUdH+%(tUHH@H}HuHUdH%(HE1HEE6uUHEH֣u HEIL/HHƿ4HHEILX3HHƿH}uHEHEH}t4L/8HHƿ趡HUHEHHMQHMQjjujjAAHѺH5HH@u4L4AHHƿ6JEu_HEغHy9E}DHEILnGHHƿؠћEE=.HEH\HHu EEHEHsHH负HEH记t^LUHHƿLsHHƿ tLZHHƸ豟HEHHHu,L)HEHƿc*LMHHƿ7Et*LYHHƿEE=-u/LPHHƿ躞Eu,LIHeHƿ胞kEu3HEIL6H*HƿH0EALHHƿ-HEHEʀHUdH+%(tUHH@H}HudH%(HE1HEHEE?u XHEtUH}tNHEHHH袜u4LO HHƿ!HEt H}t*HEHHH1uHHEH}uHEHEH}u4LHlHƿ芜ZHEHHH轛uHEt $HEHHH臛u(HEtHEHEIL'HHƿ֛HEHHURHURjuujjAAH5HH@HEH,HHĚu =HEHHH蠚u/L4HHƿL8HHƿE܃u_HEȺH39E}DHEIL(>HtHƿ蒚苕ExE܃u;HEILLH(HƿFHEHHHyu E=.u4Et*L0cHHƿڙE=.t"E=-tE='tE=&HEH HHE=-u/L:nH>Hƿ\E=.u/L1pHHƿ#E=&u,L8rHHƿfE='u,L:tHHƿ贘0EALMvHdHƿ肘RE=-u/LH&HƿDE=&t E='uLE=&u H"sH>eILHHƿEt9Et/LHHƿ街CEu Et/LH@Hƿ^EALH Hƿ)EtDHEHHHRt*LgHHƿіE܅ypE܃u1L^HzHƿ蘖kEAL^HCHƿa4HEHHH薕uHEʀHUdH+%(tUUHH`H}HuHUMLEdH%(HE1HEHEEEHEHEH~u HEtnH}tHEHHHʔtH}uFHEu4L^HHƿ0HEt jH}t;HEHHH@u!EH3EEԅtK4=-t=.u&HEHE'HEHEHE HEEԅu EE=%u=HEILgHhHƿ膒EE=-HEHHH詑u ENHEHHH胑u=HEILvHHƿEHEILzHHƿ辑EE='tE=&E=&u HlH^HEHEH!HH蹐u E^HEHHH蓐uHHEHuIL2HHƿHEHEHuIL"HHƿ輐HEEԃHEHEHHݏu EHEHվHH跏u=HEILHHƿ/E+HEILHHƿEE=.u EEԅHEHjHHu EHEHHH܎uFEHUHPILH.HƿLHEGEHUHPILHHƿHEE؃tKHEHHH+t1HEILHHƿ裎EHUdH+%(tύUHATSHPH}dH%(HE1HEHGu  u u HE@(AHEHOHcHEjATHRSL UIHHѺH5ZHǸH H}H HHEHUHHQHEHUHAHQ\H u EEEH HHEHUHHQHEHUHAHQH EHUdH+%(tqHe[A\]UHAWAVAUATSHHxHpHhH`LXLPHEHHdH%(HE1HEHpHHhIL+ H^Hƿ|HLXMuL%HpLHpLHpLH]HuHiHcHEjATH(RAWH0RAVH8R`H<RhH;RAUH>RSL BIHHѺH5YHǸHpH}H HHEHUHHQHEHUHAHQH u DžlhlhuNHPHHHIL[ HHƿsHhuNHPHHHIL* HHƿsH+lu8hAL  HAHƿ_sH HHEHUHHQHEHUHAHQHmHH HxHxu6LV HHƿrDžleHXH@HxHHR HpHpu6LS! H_Hƿ}rDžlH HHEHUHHQHEHUHAHQH H8HpHlHUdH+%(tYqHe[A\]UHAVAUATSHHXHPHHH@L8dH%(HE1ru bu HMH@@HHSu4LG09 H6HƿTqH8HuHHPLHPLHPLKjHcHpjSHRAVHRAUHRHURHRHHRATL IHHѺH5HǸH`HhH HHpHxHHQHEHUHAHQH u Džlhllu3hALL HHƿoH HHpHxHHQHEHUHAHQH lHUdH+%(tnHe[A\A]A^]UHH0H}HuHUHMLEHEHpHHnu)HEHH HEHPHH}HuHEIH,UHH@H}HuHUHMHEHH?E}}y"EwuJ>Lw HHƿn;u HE@Du HEHH@HtHEHǀgHEHH@%HPHEBHEH@XHu4L HHƿmHEHPXHEHH>HEH}uSHEH@XHUHHPIL H9HƿWmHHuHEعHHuSHEH@XHUHHPILZ HHƿlHHEHǀHEHH@%HHEHH@H t HE@t+HEHH@%HHEHEHP`HEHHHEH}uSHEH@`HUHHPIL HHƿkHHEHpHEعH)HuSHEH@`HUHHPIL( HTHƿrkHHEHǀHEHH@H tMHE@tBHEHILĠ HHƿj!HEHH@%HuHE@WL HtHƿjHEHH@H)HEHP`HEHHHEH}uSHEH@`HUHHPIL HHƿjH2HEHpHEعHCHuSHEH@`HUHHPIL] HnHƿiHHEHǀHEHHZHHhuHEHt*HhHEHH<HHfhuHEH"H3HEHHHH1huHEHHUHH0H}HuHUHMLEHEHHy @w8^H}uPH}HMHUHuHEIH8/LW HHƿhUHAUATSHXH}HudH%(HE1HEHiu }xu mxu ~HEHNt4Lԝ, HPHƿng:HUHEHHRuBHEHIL2 HHƿgHELHELHEH(`HcHEjAUHRATHRSL $IHHѺH5sHǸH0H}H HHEHUHHQHEHUHAHQ+}H u EEEH HHEHUHHQHEHUHAHQH EuBHEHILJM HHƿe}u7EALJR HvHƿecHEHHHHdu=L(W H$HƿBeHUHEHHpHUdH+%(tYdHe[A\A]]UHAUATSHhH}HuUdH%(HE1HEHfu csuu Ocuu ;}u`HuHEHu8HEHILXq H$HƿBdHEHH-HHncUHUHEHH豘u HELHELHEH]HcHEjAUHRATHRSL IHHѺH5kHǸ|H0H}H HHEHUHHQHEHUHAHQzH u EEEH HHEHUHHQHEHUHAHQH }u7EAL HHƿb[HuHEHu8HEHIL֙ HJHƿhbHUdH+%(taHe[A\A]]UHHPH}HudH%(HE1HEru ru /[HcHEAIHHѺH5HǸ{H}H HHEHUHHQHEHUHAHQNxH u/L H5HƿSa(Eăt9tetHEL HHƿ`HHEL HyHƿ`HHEdL HBHƿ``HHE-L H Hƿ)`H HHEHUHHQHEHUHAHQH HEHUdH+%(t"_UHHH}HEH@XH$t HEH@XH&t HEH@XH't HEH@XH(t HEH@XHt iHEH@XH?t LHEH@XH4t /HEH@XH-t HEH@XH.t HEH@XH/t HEHt HEH@XH t HEH@XH7t HEH@XHtjHEH@XHtPHEH@XH"t6HEH@XH!tHEHuUHH`H}HudH%(HE1HEHHEHEHHEH}tH}u HEIL- H)HƿG]VHcHEjuHoRuHnRHRL IH HѺH50HǸHUHMHEHHk uHEHS!EtHE HEHUdH+%(tZUHHH}E}t HZHPHUHPIL;HHƿZZHUHH}H]UHHH}HEH=HXUHH@H}HuHUdH%(HE1HEHYHHw t&HEкH :HHD HEH}uHHHEH@H@PHUHHHEH}u;HEILבWHHƿAYHUHEH HH uHHiwMHUHEA@Hyu1L_H4HƿX$HEH@HPXHEH@H HPXHUdH+%(tWUHHH}HuHEH@H@HH!Hu4LݐjHHƿXHEHH@HPHHEH HHǸ su1LnH1HƿWcHEHPHEH 5HHǸru1LNoHӾHƿ[WUHHH}HEHҝHHzVUHH@H}HuHUHMLELMHEHH@HT HHEHHHHEHH HEH}u4LHHƿV,HEH@L@HHEH@H@PHHEHEH@H@PHuHEMIHxu4LHqHƿUHEHH@H\HEH@H@PHEH@HHHUHEH u1LUHڼHƿbUUHH}Hq|]UHH H}HEH@H@PHHEHEHHEHEH'HHEHH^ILH;HƿTHE苀\HEHHIL\HHƿ{THE@8H7HHE@9H(HHE@:HHlHEHEHH~ILH[HƿSHE@H HHEHH0ILǻH HƿSHE@ALHٺHƿaSHE@;HHHE@H HHEHH蒴ILhHoHƿRHE@H HHEHHDIL1H!HƿRHE@AL HHƿuRHE@ ALHHƿARHE@$AL˺HHƿ RHE@(ALHQHƿQHE@,ALHHƿQHE@0ALmHHƿqQHE@4ALPHHƿ=QHE@AL4HHƿ QHE@HͮHƿUGHE HEH HHǸGbu4L@HoHƿF8HEPHE@H HHEHHǸ^u4LBHHƿFHEPHEH OHHǸau4L%DHHƿ2FsHE@;tSHEH HHǸ#au4LGHKHƿEHEPHE@H HHEHHǸ]u4L[IHHƿhEHEPHEH tHHǸ^`u4LLHHƿEOHEPHE@H HHEHHǸ\u4LOHHƿDHEPHEH ҮHHǸ_u4L<QHHƿIDHEP HEH HHǸ?_u4LRHgHƿC0HEP$HEH @HHǸ^u4LSH HƿCHEP(HEH HHǸ^u4L.THHƿ;C|HEP,HEH HHǸ1^u4LUHYHƿB"HEP0HEH lHHǸ]u4LzVHHƿBHEP4HEH 'HHǸ}]u1L WHHƿ-BqHE@H FHEHiHHƹHEH}t4HEH@ H@XHt#HEH@ HHXHEHхuHHEH ЄHHStHEH HHRu NEeUHHHHHH\E9UHHHHHH\E9u$UHHHHHH\E9rlUHHHHHH[\E9uuUHHHHHH;\E9uQUHHHHHH\U9r-UHHHHHH[M ЉMXUHHHHHH[HHPL ;6L HHƿHHHHHTH 9|HHUdH+%(t$,UHH H}EhEEHcHHHHHH@zH EHcHHHHHHzHHH+~XEHcHHHHHHyHILIaHHƿ ,sE}CEEHHi HHEHHi H ڇHHH*~NEHHi HHIL`!HXHƿ`+EEHHi HbHHNEggE|E+E‹EЉEEHHi HHHUHH/*E}y EE)}~ EEEHHi HdžHE;ExUHHH}$HHEHHH%u HEHbUHH H}HEHHEH}t HEHUHHH}HE<-uHEH<-uPHE<-u@HEH<-t1HEIL"_NHHƿ)UHHH}HEL HHHHH>HEHHEEHcHHH)HHH},HE؉ EHE苀49E|}~?HE苀4HHU艊4HMHHPHHHHHHPE}uEHHHEHHHEкHHEEEHHHEHHH HHuuHEЋ@0HEЉP0HEЋ4EEHHHEHHHMHEHHHEЋ4+EHEЉ4HEЋU4}t0EHHHEHHHEкHH}~EHHHPHEHHH}~ HHMHcH4HMHH uHPRQALNBH@HƿH H HEЋ@0HEЉP0EE;EZHEdH+%(tN UHHH}HuHEHnHHHtHE@0HEP0HEHQHHtHtHE@0HEP0UHH@HHHdH%(HE1HHH HGHH4Ht,HHHHH? HH4*HHHHH HH4HEdH+%(t UHSHhHHHdH%(HE1DžH5 uHL@H?HƿG H@0HP0H5HH5HHH,HHHHHHH HDž HHHHHHHuH@0DžHHHHuH@0DžyHH HHCRHH }HHHHHHHHj HHHHHuHL=HmHƿuH@0HP0HHH~HH@HHHH HHBHH@HuHLHíHƿH@0HP0HH@HtLHHpH@8HHJ8HHHHHHHHH0H@4HHJ4HHHHHHHQ;HH HHu~HHHHt+6HHR H HHP HHRH HHPHH HHeuyHHHHt(}HHR(H HHP()UHHRH HHP9HEdH+%(tH]UH}E0EHcHHHHHH,)9EuEQ9E|Ÿ]UHH EEHHi HkE}EHHi5HaHHEEHHi H_HHEHHHu1EHHi HJkHEHHi H1k E}vEEEHHi5HaHHEEHHi HA_HHEHHH[[HE4uHE4tEHHi HjHE4tEHHi HhjHE4tEHHi HDjHE4tEHHi H jEHMEHHPHHHHHHHUHcHiHHHH#^HMEHHPHHHHHH=utNHEHeHH$t4HEHqeHH tHEHlHHuUHH H}HuHEHEHEHEHEHH@HPHEHH@HHHUHHE;EHcHHH)HHH EHHHH E}~HQHHHsUHH0H}uHUHE؋EEEHcHEHEHcHEH‹EHH )EEEHH< uEE9Et벐HE؋UUHSHH $HxHHdH%(HE1HDžDžDžDžDžDžDžHt(HHHHu HDž0< HHHHxHHHHqWH HHHt HHHHHHHHH HHHMHHm~ HHi5H.ZHHHPHHHHH; HHHHHu4LHâHƿ)HtJHHHHt-DžDžDžDžDžHǀ5HHHHHHHHHUHHvHhHH@HHH@HHHHHHHHHHHH' HHu4L-H2Hƿ:HHPHHHIHH)HǸYHHHP&HHHHH HHBHH@HLmHrHƿzHH)t8u/Ht%HHHHHpHHt1u(HtHHHH,HHt8u/Ht%HHHHHHHtyHtoHHHHH HHBHH@HL8H HƿrHH|tHEH{HHbt$HEH{HHHt EEHEH{HH$t9HEH{HH tHExH8u EEHE-H8t EEHEH#{HHtHEH%HHHE HT8t;HEIL5HzHƿ& HE1H8uHE,H7HEHmzHHu}LH9zHƿ{HECH7t5LHyHƿ2aHEHPHEHH u ;HE`H7HE`H$?HHEHHB2HEH}tHUHEHHuMHE`H>IL@yHyHƿWHECHd6u4HEH#HHutHEHxHH[ulHEH H@HtXHEH HUHEHHuELHbxHƿEUHEH HEHEHEHEH5t|HUHEHHmt/L/xHwHƿ+LxHwHƿEHEHدHH-tHEH4E HEH4t4LH5wHƿwHEH4t4LHvHƿ.]HEH;4LoHvHƿHEHo!HHu\EHMHUHEHHELYH$vHƿfHEHvHHu\EHMHUHEHH&*ELHuHƿHEHmoHH(u\EHMHUHEHHELmH8uHƿz2HEHHHu EXHEHuHHu\E HMHUHEHHELъHtHƿHEH6HHu)HEtH1tEHEHtHHu E|HEHtHHu EYHEHxtHHu E6L 'HsHƿEHEH1uHEH0t EEHEH0t E EHEH0t EEHEH0t E@EHEH}0t EEHEH^0t EEHEH?0t EȀEHEHt HEHHEEtTE tLHEH&HEHEHu3ELJHYrHƿVHEH}MHUHuIHu3L@NH rHƿMEHEHt-HUHEH9t HUHEH H9t HEH BHEHt"HEH HEH9tHEHAH}tHEHyEHUdH+%(tUHH H}uHUHUMHEH UHH H}uHUHUMHEHUHH H}uHUHEHPcUH}}t }t]UHHH}HuHEH`&HH}t HoHoHEHuHoQRIL  HpHƿHHEH@PHΉtHEH@PHȗu\HEH%HHEHuHAoHRIL #HmpHƿHUHSHhH}HuHUdH%(HE1HEH7EE%HHEH@X%HHUHuHEAAHѺH&trEtkEԅudHEH$HtIL 7HhoHƸHUHEHHHEHf$IL ;HoHƿE%HHEH@X%HHUHuHEAAHѺHtrEtkEԅtdHEH#HtILM CH`nHƸ HUHEHH HEH^#ILI HHnHƿE%HtQHEH@XHHEHPXHEH"IL OHmHƿUOHEH@XHHEHPXHEH"ILSH]mHƿHEHEHUdH+%(tH]UHSH8H}HuHUEHEؾ%H)HEغ%H3EHEHC9E}tHEHlCuKHEHYt;HEH!ILkHZlHƿjHEH CU艐EOE{HHEHA!HSILrHkHƿHHEؾH(HEغH2tEHEH^B9EtHEHGBU쉐EX}t HjH]kHEHu HSILK|H&kHƿH}uHEȋHEȉH]UHH@H}HudH%(HE1HEH@XH%uHEH@XHtHUHuHEAAHщHtEЅuCHEHILH;jHƿ  t;HEH+ILjHiHƿ9HEHILiHiHƿMm HuHEȉѺH- u1L~HZiHƿHUdH+%(t$UHHH}HuHEHu@HEH%IL0HhHƿ肿Zk tLHEHILhHhHƿ9HUHEHH UHH H}HuHEHP/EHEH@PHHHEH@PHHEHHt}HEHtkHEHHEH@PHHH̽tBE@t4LHgHƿ=HEHJ$‹MHEH9Ct [HEH:t*HEH*@H@X%HuHEH@HE}u!HUHEHHu }u.HEH@XHuHEH@PH@`Ht UHMHEHHbu1L|HfHƿ({tmEt_HEH@XH u9HEH@XHu&HEH@XHuHEH@XHtHUHEHHE UHH H}HuHEH@H@H t HE@LHEHHE}u4L{HeHƿ)UHHHHHHEH@H@PH@HH裔 HEH}u4LzHeHƿ輻uHEH@H@H .HEH@H@%HEHEHUHHHHHH@Hu4LzHydHƿ HEHUHHHHHUHHHHHHEHHAHBUHHHHHHEHH@HUHHHHHHEHHHEHH0 EHE@L9E,HEH0HUHBHUHEHH UHH H}HuHEH@H@H t9HEHHEHEH@HHEHHEHEH9Eu۸dHEHHEHEH9EHEHPHEHH0u1LrxHbHƿUHH H}uUHEH@PHHE}uHUHEHHEUHAUATSHXH}HudH%(HE1EEHEH8HEHEHZ HEHHEH,uCHEHILtAHaHƿvHEHujHEHHHDHǸVH,GHƿӝEHHHEH@HH[v HEH}u4Lg\EHFHƿtHEH@@HEHEHhH HEHhH HEH}u4L[MHFFHƿHEHPEHMHH HEHHEHH| HHHu5Lo[PHEHƿ|HEHHEHUHEH@H9HEH@HMUHuAHoHEH}u1LZUHTEHƿHUHEHH H]UHSHhH}HuEHEH@PHHEHEHHEHEHutHEHHHEHt H3HHSILqHDHƿ*HHEH3tHEHL HUȉBHƿ9EHEȋ@L9EoEE;EEE@HEHUHHHHHH@H@XHH!HtEEHEȋ@L9ErHEȋ@L9EuXHEH HHEH5HSIL+H=HƿUHHEHEH]UHH H}HuHEH@PHHEHEHHEHEHHt!HEHH+HEP@HE>Ht!HE>HHEPDHE@DtCHEPDHE@@9s1LVH<HƿHHEHEUHH0H}HuHEH@hHtHEH@hH@HL=HEHEH@PH!HtH%=HEHEH@hHEH@PHEHt#HEH@PHEHHE!HEH@PH`HHEHEH@PHHMHHHEH}u1LPH\;HƿeHEHUHPhHEHZuuILH ;Hƿ豑HHEЋHEЉUHSH(H}HuHEH@PHH-EUHEؾH}t HfHfHEHHSILvHQ:HƿHHEЋHEЉH]UHSH(H}HuHEH@PH HpEHEH@XE}t}u }u}u }tHEH@XHHHEHPXHEH@XHHHEHPX}t H3HHEHHSIL*H:9HƿHHEЋHEЉH]UHSH8H}HuHEH@PHHEHEHEHEHHEHEH@XHtHEHH@HaHEUHEH@X%@HuCHEHIL<HR8HƿHET9Eu[}tynHEH4HSILBH7Hƿ茎H'}HETHEHEH]UHSH8H}HuHEH@PHHEHEHuEHEH"HEHEH@XHtHEHH@H HEUHEH@X%@HuCHEH/ILXH6Hƿ茍HEU9Eu[}tynHEHHSIL^Hx6HƿH'}HEUHEHEH]UHHH}uEtAHEHouWLKpH5Hƿ萌+EtHEHduUH}HuE&EHHHEHЋ9Eu$EEHHHEHЋu]UHHp}dH%(HE1EE EEEE(EEEE EȜE̛EHE>E`EEE!EE EHUEH։HUdH+%(tpUHH@}dH%(HE1E%EEE܈EEEHUЋEH։oHUdH+%(tUHSHXH}HuHUdH%(HE1EEEEEEE\HEHH(EHHPHHHHHHEUHEHDEt EHEH@PH言u4LHH3Hƿ迉}6}b}}H}}.} }}}}`<}E]HH~7HHr7H>E-EHUHMHEHHEEHUHMHEHH`EEHUHMHEHHEsEHUHMHEHHEPEHUHMHEHHE-EHMȋUHuHEH~E EHUHEHHEEHUHEHHEEHUHEHHEEHUHEHHEEHUHEHHErEHUHEHHEVEHUHEHHE:E IL6H[0HƿEHEH@(4HEH@(49E}}EЉEE}HEHHmtIL0BH/HƸgEUHEHhu4LEGHz/Hƿ!FE;Et4LDLH>/Hƿ HEH@PH:}u4LDRH.Hƿ虅E1HEHH(EHHPHHHHHHEUHEHpE:HEH@PH{u4LCaHI.HƿE}t=}}tg}~}u}},}t&}%u`EHUHMHEHHEwEHUHMHEHHgEWEHUHMHEHHE7E ILxH[-Hƿ}tY}tSHEH`HtIL-.~H,HƸ誃EUHEHu8LWBH,HƿdEHEH@(4HEH@(49EEEԃ}tE;Et1LAHF,HƿHEH@PHHUdH+%(tH]UHH H}HuHUMHEHkuzHEH@XH&teHEH@XH?tK}t9HEHILHr+HƿUHH0H}uHUHE t4LH+Hƿ踁:HE~HuHEZHMiHEHU؋uHEHH QH QjAAHoH E}tEHE辪H)tDL1H,*HƿӀHU؋MHEH#EBHELHuHEZHtHU؋MHEHEEUHSHHHH@H8dH%(HE1H@H)t9H@HaHXHXH@X%HtHXH@H@HCH@HHXHXw ƅ`jHXPH`H *HǸ` y4L*H(HƿJHHHTHXHHH@HyHH`HHHwHǸH>HƿoKUHEHu1L.AHHƿoHUdH+%(tnUHH H}HuHUMHEH1uF}t9HEHILMHlHƿoUHH0H}uHUHE~HuHEZH詵HEHU؋uHEHH QH QjAAH]H E}tEHE辪HitDLqcHlHƿnHU؋MHEHcEBHELHuHEZHtHU؋MHEHVEEUHH H}uHUHEH@(H@HUHR(RHPALoHHƿRmHUHHH}uHE@t@HEPHEPALZeHHƿlHHEUPUHHH}HEH7HHltHEH#HHkuUHHH}HuHEHuIHEHHHkt/HEH HH^duHEH@uUHHH}HEHHH6kUHHH}HEHHHktHEHtUHH H}HuHEHmHHEHEHUHPHEH@u HEHHHyjHEH9HEH NHH"cHEH8HH$jthHEH:6HH jtNHEH[HHit4HEHHHitHEHaHHiu6HEILӻHHƿ-jUHH H}HudH%(HE1HEHUHEHHWu4L(HHƿiHE辮Hu HE@XHE辝Ht HE@ HEIHtJHE@ t4LHHƿ&iHE@HE辁H(t HE@HEvHHEHHUHB@HEH@@HtSHEHP@HMHEHHu4LW'H+HƿdhMHEHPHEHHt4LHHƿhHEH"u?HE@u4LHHƿgHEHHUHB@HEH@@HtSHEHP@HMHEHHu4L6&H HƿCg,HEHEHHEvHcHUBhHE@lHE较H u^HEH@uOHE@uDHE@ u9HE{HuHEHtHEHfHPHE{HuHEHHEHPHEHHuqHEH@HQu]HEH@H;uIHE辀H)u4LaHHƿeHEHtEHE@HEHHUBhHEHHUBlHE HHUHE@HEHMt*HEHfHUB`HE@dHEHlHUB`HE@dHEHPHEHH9uHE@uHE@ HE辱Ht4LH,HƿedNHEHrt4LzHHƿdHE@HE@hHEHHPHEH@HuHEH@HtrHEjhAIAH5HǸHt5LD"HHƿQc=HE辺HHEP(HEHHEP,HUdH+%(t2 HEH}u4LHHƿWYHEHÐ HEHHEHEH@HHEH@tyHEH@(H: HEH}u1LHHƿXOHEHPHEHPHUHEHH; HEHHEHUHEHH9:HEUHH}HuHEH@XH]UHHH}HEHEHEHEHEHĄHEH}uHEUHH@H}؉uԉUHMLEHEؾHwEHEؾHcEHEؾHҽtqHEغH HEHEغHHEHEH{HHVHUHEHt{HHVHUȉ}tHEHEHEȉoHEHEHEȉ}uR}t"HaHǸHHƸ:@HH}HMЋUuHEIHE̅u UE)EHUBhHE@huEEЅu UE)E܉EHEPhHEPAL)VHZHƿ?HHEHh}HUHuHEHuAAȹHHuAHE@hvHE@hPHEPh }tmE̅TEЅIE̅tgHEHkm9EtVHEHdHHEHKmU)SEPALvcHoHƿ>HEЅtgHEH9EtVHEHHHEHU)SEPALHgHHƿ:>HHUdH+%(t`=H]UHSHH}HuHEH@XH H!Hu$HEH@XHH!Hu 'HEH@ HX(HEH"HHEH@XH%t H'bHSRILxHHƿW=HHEH@XH$t HEHAHH@H荛ILpHHƿHƿw2K HEHP HEH@HHuHE@] HEH@H@HtHE@; HEH@H@HtHE@LuHE@ HE@uHEHEH;EHE@luHEPhEЉE*HE@luUHE@h)‰U HE@hEHEHl;U9Eȃ}QHEt HHILaPHHƿ1 HE@tOHE@htCHEH\IL7WHHƿ0 HEH@u|HEH(HPHEH@PHHHH軫HUHB HEH@ Hu4L(_HHƿ50 EHE@ u HE@tRHEH@H[HHG/t4LeHHƿ/HE@t%HEHHEH,HEHjHEt1HEHMHEHP@HEp,HEIH/HE@HEH@H@Ht HE@LtHEH@H@H,HEH@thHEH@HzHH/.tJHEH@HiuHH.t,HEH@HHH-}}@~XHEHHUHR HR(PRA@LLtHHƿ>.HHEH@H@%HuDHEH袷t4L&yHHƿ-HELHE@duHEu HE@` HEUHMq,H}_u4LOH#Hƿ\-0HEHڶ}HEHUHEHHeu4LHHƿ,HEHHuHEH蟢u4LHZHƿ,gHEHHCxtILHHƸ=,HEH@H@Ht HE@LtDHEH@H@Hu.HEH@H@HuHEH@XH HEH@HHEH@HEH@H@% HuHEH@ H@% HtEHEu4LH HƿB+HUHEHH.u4LHHƿ*HEH@H@HuHEH@ H@HtEHEu4LbHKHƿ*XHEHt4LFHHƿ@*HEؾ{HMu HE@p}u!HEؾH'u HEH@ HEؾHu HE@`HELHED@`HExtHEDX|HEDPpHEH(HEP,HEHp HEHAQAPWEEHuH u4L5H HƿB)HEH袇HttILmHHƸ( HEH]t4LHbHƿ(oHUHEHHu NHEؾ{H臎u HE@p}u!HEؾHau HEH@ HELHE@duHEu HE@` HEHUDBtHUDZ|HUDRpHUJ(HUR,HuHv H}HAQPAPEE(tH u1LmHAHƿz'QHEH݅H-stILHHƸ''HUdH+%(tQ&H]UHH H}HuHUHUHMHEHH UHH H}HuHUHUHMHEHHUHH H}HuHUHUHMHEHHUHH H}HuHUHUHMHEHHUHH H}HuHUHUHEHH8UHH H}HuHUHUHEHH UHH H}HuHUHUHEHHUHH H}HuHUHUHEHHUHH H}HuHUHUHEHHUHH H}HuHUHUHEHHWUHH H}HuHUHUHEHH*UHH H}HuHUHUHMHEHH!UHH H}HuHUHUHEHHUHH H}HuHUHEH誊tHUHMHEHH_HEvHytHUHMHEHH_HEIHHuHEH3tHUHMHEHHJHEH@HҷtHUHMHEHHKnHEH@ H@H tHUHMHEHHL>HEHILHHƿU#UHH H}HuHUHEHMtHUHMHEHH9HEvHtHUHMHEHHHEH@ H@H tHUHMHEHHHEH@ H@HtHUHMHEHHHEH@H>HH!uHUHMHEHHkHEH@HtHUHMHEHH>HEHtIL?HHƿ!UHH0H}HuHUHEH,JHEHEH@t*HEH@H ~HHuE}HEH@HHH uHUHMHEHH(HEH*t=H}t6HEHHHH4 uHUHMHEHHHEH؆t=H}t6HEH-HHuHUHMHEHHHEH@ H@HuHEH@ H@H tHUHMHEHHS>HEH~ILHHƿUHH0H}HuHUHEHܟHEEHuHEH 9Hyu4LcH7Hƿp)HEH@uHEHPHEHP [HEHPHEHHuHUHB HEH@ Hu/LHHƿHEH@H7HH#uPHE؋@uEHEH@H@%Hu/LGHHHƿ-+HEH@ H@ H@XHtkHEH@ H@ HHXHEHHEHхu>HEH@ H@(IL2r HHƿHEHPHEHHOuBHEH@Hu.HEH@HױuHE؋@uHE؋@ HE较H詃uHEH舝HPHEHP HEL@|HEHxxHEHHtHEHPpHEHp HEMIHctu/LHHƿHEH@H uHEH@Ht HE{Hu HE@pHEH@XH0tHEH訜HH@HEHEH@XHt/HEHzHHHHUHEHH\HEH@XH1tHUHMHEHHkEHEH@XH tHUHMHEHHEHEH@H@Hu"HEH@H@(HSbHHuHUHMHEHHE9HEHyILHHƿO}tUHSH(H}HuHEH@PHEHEHyHEHEHu;HEIL{'HHƿHEHH@X%Ht;HEIL{,H;Hƿt6HEHItBHEHIL{2HHƿ"HEH;\HEоHl9u4L8HHƿHEؾHOHEؾH6HEHXtzHEH[tjHEHwHHzHǸ'H8HsIL H@HƿyWH`H8HHHYu1LHHƿ'dH@H@PH^tH@H@PHUu1LHHƿHUdH+%(tH]UHH H}HuHUHUHMHEHHEu1L8H HƿESHMHEHH-t1LHHƿUHATSHHXHPHHdH%(HE1HPH@PH[ u4LeH9HƿrwHPHpHHHHpHSILuHܼHƿHHPH@PHt4LnuHHƿHPH00u4L|HPHƿHHHHHH`H-HHqu>HHHoIL HHƿZH`HHHXHu4LHHƿHPH@PHtHPH@PHu1LZH.HƿgoHHHnHHPHnI\tHSMLsHHƸHHUdH+%(t He[A\]UHSH8H}HuHUHEHƏHEHEHH@H@XHtNHEHH@HmILwsHHƿIHEHEHEHHEHEHH4HH@H@X%HtSHEHHHH@HTmILsHxHƿHEHH赎HH@X%HtOHEHH荎HHlILrHHƿ:HEH@XHyHEHH'LHEؾHsumLHHƿ HEH,lILgrHPHƿ ~HEHkHHEHHtLHSILzHHHtHu4LEe9 HHƿ HH@PHXHHH@PHH裪u4LUA H)Hƿbq HH@PHXH9t{HH@PH{tHH@PHru4LطE HHƿ HH@PHXHHHPHHH@PHHH@H HHt8HHHIHHNHǸ0 y4LcL HHƿ) HHPHHH@PHHH@H4 HHt8HHHIHHHǸ~ y4L>cS H/Hƿhw HH3HHu4LcX HѡHƿ  HH@ HvHt4L c^ H{Hƿ HHPHH@HH@HHt s ~4Lbf HHƿ,; HH@HH H@HHH@HHСH@HHH@HHDŽ@HHCt4L br H HƿDSHHHHЁuBHH@HILaw HHƿHHHHqu=HH@HILa} HMHƿHH@HHjuPHHRHSILoa HОHƿ H4HHtHHHHH@HHHHDžPH0H@HHѺH#H H uIHHHPIL` HHƿ2H]H HHqH'HHHHH(H(H(HH HHH:NHHϸ~HHrHHH9HHXHHyrHH9txLHL`HHH@PHHH:rHHPAUATSIL_ HHƿH H0H`HHHHeuHHHPIL_ H:HƿsDžHHHH~uFHHOIL_ HԛHƿ Džu HH@PHXH9uHHH@PHǀXHH@XHH!HHPXHHHH@PHH{u*L- HHƿ:HHPHHHH=HǸ yBHH@HIL^ HHƿHH@PHHHU Hu>HILE^ H.HƿgvHHeoHHHH HYHƿH HHHsuBH H@HIL9SC HHƿ3RHHHHru=HH@HILVI HHƿ>HHPHHuMHHCHSILVO HHƿWHHHuFHHCIL Y HȏHƿ HHHHruHHHACIL,V_ HeHƿDžHHuFH HBIL( f H HƿBaH HHHquFH HBIL]Rl HHƿDžu HH@PHXH9 uHHH@PHǀXH H@XHH!H HPXH Hg HH@PHHMu*L| HӍHƿ HHPHHHHHǸƂ yBHH@HILXQ HiHƿHH@PHHH'Hu>HILQ HHƿ9XH8H7bHHHHku4LР HHƿHH HHHu4Lx HLHƿH8HaHH HHiu4L HHƿ)HHHHH趣u4LŸ HHƿHH@PHtHH@PHu4L` H4HƿmHH>ILQ HHƿ'H8H/`HH>ILQ HHƿHUdH+%(tH]UHATSHHHHdH%(HE1HH@PHH 8HHDž0Dž4DžTddHH@HHDžHHHHHDžDž Dž(HH(u4L HXHƿHH;uFHHHIL-" HxHƿtH HtptH(H_=tHHdH HHH HH(H@HHc HH HPHH(H@HH; HH HH HHQH@HHHAHQHPHXt HH~{H HRHHIHHH¾ol xNt HHH HRHH`IHH=H¾!l y4L@ HvHƿ H H(HMHOu uH(]H :HHHHHHH(HHSu>HILw! H vHƿBHHHHHHHu>HILw& HuHƿtHHHHHHHH(H@HH諪 HHHPHH(H@HH胪 HHHH HHQH H(HAHQH0H8HH; uFHHp(IL{?2 HtHƿgHH;uFHH(IL]?8 H>tHƿwHH9JuFHH'IL> HsHƿHH@XHtFHHe'IL'uD HsHƿ\HH@XH1tuL>J H?sHƿxAtL ^L>K HrHƸ7HH@XHH!HHH@XHHH@XHH!HHHDuvHH}IucHHvDuPHH@XHtHHHu'HuHH@XHtFHH%IL:W HqHƿ HH(HNHJu vL8LPH@HHH(HH4WHHu/LUd H)qHƿbtkLHHDHHHPH(MIHuu/Lh HpHƿlHtHTDHHt.HHH(HH'T DžTH DDXHHHpXHH(HPWHLWHTWHH LՃ~ HoHƿ`H DDXHHHpXHH(HH4WH8WHPWHLWH1xH( H1|DTDdxHH |WHlHHHL1 HkHƿ> HH(HHMuAHHIL65 HjHƿ^ tdHH@XHH HHPXHH(HHALu/L6 H+jHƿd HH@XHH!HHPXf))DžH(H$H(H$DžHH HHHHHQHHHAHQH3H u/L6 H6iHƿo HH(HHLu/L5 HhHƿ# H H(HHKuAH HhIL5 HhHƿŽC H HH H@HHH`HH(H7u/LC| HhHƿP t H@ H@ HHIйH¾HHu/Li HgHƿμL HHHxXHHHHjjjjjQjjjIAѺHHPHHu/L{( HfHƿ*HHH°HH HHHHHHHHHHEu/L{z0 HOfHƿ舻HH_t)HHǀHHǀHHǀHHǀHHH"HHIuHH|HtHHH!HHuHH!H9HHH!HHӹuHH!HtlLHDHPHMIHLxL HdHƿuHHǀ&tH`HSIL4b H_HƸHHHH@HHH(HjL IH0+HuIHHHILx- HA_HƿzHHH@HHH(IHKHHH HHH(HjL IHh*HuIHHHIL, Hy^Hƿ貳HHH HHH(IHJHHtHHb,lHUdH+%(t苲He[A\]UHH HHHdH%(HE1HH@PH@DžHDž(HDžHDž0HDž8DžHHu4Lpq HD]Hƿ}LH HH HHMIH u/Lq H\Hƿ gH@HHHHHHHH@HH H0HHPHHH@HH軑 H8HHH HHQHPHXHAHQH`HhHHPHHpHHP^HǸ Q yAHHIL1* H[Hƿ=HpHHHusu/Lo HU[Hƿ莰HH@XHH HHPXHHHHHHHHu/Lo HZHƿlH^H!t H^H H(LL D DH(HHHHHAQAPWEEHH u/LAn HZHƿNL HYHƿL HYHƿHHwuGHHǸLHEH'IL"HKKHƿ脠UHH`H}uHUdH%(HE1f)EfEHEHH HEH-HEH}u4L2HJHƿHEHUHPEȿHEHEHPXHEHH ;QjuAAHH EċEȉwEtiHEHENHEHnHEHpHEAH>E̋E;E~ẺEHEHHEHUHEHH9uHUHEHHx/EHUdH+%(tUHSHXH}HuHUHE@T~sHEH@XHHHE@TPHEHpPHEH@AH_qHEH}uFL1]^HIHƿ>HEH@PHHEHEkHEă}u4L\cHHHƿޝAEHHHEH@HHfv HEH}u4Lr\fHFHHƿEHEH@@HEHEHkH HEHkH HEH}u4LmHGHƿTHEHPEHMHH HEHHEHH| HHHu5Ls[qHGGHƿ耜HEHHEHUHEH@H9HEHpPHEH@HM؋UAHoHEH}u1LZuHFHƿaHEHHMHUHEH u1LZxHfFHƿ蟛H]UHHPH}ȉuHUdH%(HE1f)EfEHEȾH(HEH}u1LHEHƿdHEHUHPHEHPXHEHH QjuAAH_H EHUHEHH?+EHUdH+%(tؙUHH@H}HuHUdH%(HE1HEH@HEHEHUHMHEHHu4LYHDHƿHEHtrHUHEHHHEH}u1LXHDHƿ踙(HEHUHHHF HEHUdH+%(t踘UHH`H}uHUdH%(HE1f)EfEHEHH HEH&HEH}u4LHCHƿHEHUHPHEHPXHEpTHEHH #QjuAAH0H EEtiHEHENHEHHEHpHEAH!8E̋E;E~ẺEHEHHEHUHEHH9uHUHEHH(EHUdH+%(t5UHH H}HuHUHUHEHH|u1LVH^BHƿ藗UHH H}uHUHEHPXHEHH kQjjAAHхH UHH0H}HuHUdH%(HE1HEH@XHHEHEH@PHטtFHEH@PHILHsAHƿ謖HEH@PHHUHEHHu1LEUHAHƿRQHUHMHEHH9u1LTH@HƿHUdH+%(t)UHSHhH}uHUdH%(HE1HEHEH@XHHEHEH@XH@HEHEо/H8HHEؾ/HHyH~BH趓HaHEH@HUHH`u HEHEHu4LS=H?HƿKHUHMHEHHTu4LS@Ht?Hƿ譔HEH芎HEH|؃EEHcHEH@HHm HEH}t0HUȋEHcHMHEIHH2HǸ4 y1LUAEH>HƿUHEH@XHPHEHHEH@XHPHEHH QjjAAHDH HUdH+%(t֒H]UHH0H}HuHUHEH@HEHUHEHHBHEH}u1LRZH=Hƿ!(HEHUHHH HEUHH`H}uHUdH%(HE1f)EfEHEHH/ HEHM HEH}u4L= mH.=HƿgHEHUHPEȿJHEHEHPXHEHH QjuAAH艀H EċEȉEtiHEHENHEHHEHpHEAHp1E̋E;E~ẺEHEHHEHUHEHH9uHUHEHH!EHUdH+%(t脐UHH0H}HuHUHEEEHEH@(@$t'uE=E4L& H;HƿHE@T~pHEH@XHHHE@TPHEHpPHEH@AHbcHEH}uCL4OH;HƿApHEH@PHHELE}MHUHuHEMAHu1LNH:Hƿ֏UHH H}uHUHEHPXHEHH [QjjAAH~H UHHHHHHdH%(HE1H+7HDžHDžHDžH08HHDž@DžDDždttHHHxDžHHHHDž Dž8HHgHHH@@H^HHH,HHHHH)H<@uBHuLC Ht8Hƿ譍HHHHHH)HHu>HIL:H7Hƿ7)HHHHHHu>HILQ:H7HƿόHuSHH@t>HIL@H97HƿrdHHH@HHHHHAHHHHfHHHHHHǸ)HIL H4HƿHHPHHHHR7HǸ) y4L%Hc4Hƿ蜉HHHHHH0HHHHHPHH0HH6HǸ( y4L-H3HƿHH0HHkHu4L1HN3Hƿ臈yHHHHHHHHHHHHHPILQ:H2HƿHH0HHT HHHHHHHu1LoF@HC2Hƿ|qH0HHH2IHHu1L4CH1Hƿ!HHHHUdH+%(t3UHSHHH}HuHUdH%(HE1HEH@PHEHEȺHHEHEHHEHHUHEHHu/L:EYH1HƿGHUHEHHHEHEHu6HEIL2\H0HƿxHEH@XH4t>HEHCIL.aHg0Hƿ蠅'HEHH蟾 u>HEHIL3fH0HƿLHEȾH^uVHEHHHHǸ"HEHILqH*HƿHEH;Eu>HEH>ILHb*HƿHEHHUHuHEIAHfu>HEHILH)Hƿ,HEHljHEH}u>HEHzILH)Hƿ~HEH@HEHEHHŷ u6HEIL`HA)Hƿz~^HEH HEHsHEHHHHǸHEH*IL/HN#HƿxHEHHUHuHEIAHRu>HEHIL5H"HƿxZHUHEHHHEH}u6HEILr;H"HƿwHEH@XH H!Hu>HEHILB@H3"HƿlwHEH@XH0IHEH[HHLHEHELHEH|HHEHyHSILLH!HƿvHHEH7ILNH[!HƿvHUHEHH胐u/LA5TH!HƿNvEu;HEHILWH Hƿ vNHUHMHEHH3u,L4`H HƿuHUdH+%(ttH]UHH H}uHUHEHPXHEHH QjjAAHcH UHH@H}HuHUdH%(HE1HEH@PHEHEH@PHvtAHEH@PHILxHHƿtHEغ]HHEHEHu/La3}H5Hƿnt8HEHHUHEHHu/L3HHƿtHUHEHHHEH}u6HEILW HHƿsHEH;Eu;HEH$IL/HHHƿsNHUHMHEHH褚u,L-2HHƿ:sHUdH+%(t[rUHH H}uHUHEHPXHEHH QjjAAH^aH UHATSH@H}HuHUHEEEHEH%EHEH@(@%tZ(HEH@XH0uHEH@XHt"HEHKHH@H,%EEHEH@XH0t/L0HHƿqE4LHgHƿq}EHHm!HHa!H>}L'0HHƿ4q4}L/HHƿpE܉QHE}t L%L%bH}t HEHXH3HEH,ATSILHMHƿpHkHEH?tCHEHILHHƿ(pHEHuCHEHxILHHƿoHEH@XHtCHEH"ILHFHƿohHEȋ@T~sHEH@XHHHEȋ@TPHEHpPHEH@AH!BHEH}uFL-HHƿoHEH@PHHEHEH@XH H!Ht_HEȾ]Hu1L)HRHƿnwHUHMHEHH*^LE}؋MHUHuHEMAHDu1L -HHƿnHe[A\]UHH0H}uHUHEH@(@%t!(u8HEHHEPHEHHE4LLH=HƿvmHE@TEE9HEH@XUHcHHH HEH@XUHcHHHHEHE@T9E|HEH@XHUHHE@TPHEPTHEHPXHEHH QjjAAHS[H UHH H}HuHUHUHEHHhluUHH H}uHUHEHPXHEpTHEHH QjjAAHZH UHATSHPH}HuHUHEHEEHEH@XHt$HEHEHEHHhHE@HEH@XH0t$HEHEHEHHHE HEH@XH-tjHEHEHEHH襥 HEHuHEH}HEH@H@H HEH@HEHEH@XH%t4HEHHH@HEHEHHHEEHEH@XHt2HEHHH@HEHEHHHEH}uCHEHIL;`HHƿ5jH}uCHEHILeHHƿi@HuHEH3Hu HEH@XHHMHUHuHEHfu HEH@(@uAHEH@HEHEu'HMHEHH&t EjHEH@XH0tHEH@XH4]HEH@(@HUHMHEHH"UEHEH+HHEHIltHSMLH#HƸahHHEH@(@HUHMHEHHOEHEHHHEHIճtHSMLHHƸgHLH^HƿgHEH@XH0HEH@XH-HEH@(@uHUHMHEHHiWEHEH@(@uHUHMHEHH%TEVLEHHƿf*LHzHƿf}uHe[A\]UHHPH}ȉuHUdH%(HE1f)EfEHEHE@HEȾHHEH}u4LHHƿeHEHUHPHEHPXHEHH QjuAAH?TH EHUHEHH}uE,EtHUHEHH?!uEEHUdH+%(tdUHH@H}HuHUHEH@HEHE؋@THEH@XHHHE؋@TPHEHpPHEH@AH7HEH}u4L#HiHƿdqHE؋@TPHEHEH@PHHEHEHUHHEHUHHUHMHEHHRDE}t4L"HHƿdHE@\HEHH u<衯tLOH`HƸcpHEHHEHHnHEH}u1L@"HHƿMcHEHUH¨HHؚ UHSH8H}HuHUȉMHEHEEMHEHEHHEH@XHH!HHEH@XH@H!HHEH@XHH!HHEH@XH@H!HuiHEH@XHx\HEH@XH H!HtHEHHA t,HEH@X%HuHEH@XHH!Ht|}}}g}uaH}t HEHXH$HEH9HSIL'HX HƿaHF?HEHIL3H HƿEaH]UHHHHdH%(HE1H0HHDž4EH0HHEH0HHEHH[H(H(u4LE H6 Hƿo`H(H0HPH0HHHu9DžL(H Hƿ`-HHPXHHH QH Q(AAHANH 蜦HEH H @H @ЋEH HpHAȉщH;~ H HH H H0HH9`H(HHHZHUdH+%(t]UHH H}HuHUMHEH_u@HEHIL5JH HƿG^UHH0H}HuHUHEH@HEHE@THEH@XHHHE@TPHEHpPHEH@AH0HEH}u1LZHcHƿ]NHE@TPHEHEH@PHHEHEHUHHUHMHEHH^=UHHHHdH%(HE1H0HHDž4EH0HHEH0HHEHHfH(H(u4LPpHAHƿz\H(H0HPH0HHHu6Dž$LyHHƿ \THHPXHHH QH ;Q(AAHZJH $H(HHH1$HUdH+%(tZUHATSH H}HuHUHEHAHE辺HHEHRHEDH赮uH [A\]UHH H}uHUHEHPXHEHH NQH QjAAH@IH UHH0H}HuHUHEH@HEHE@THEH@XHHHE@TPHEHpPHEH@AH%-HEH}u1LHHƿZNHE@TPHEHEH@PHHEHEHUHHUHMHEHH9UHHHHdH%(HE1H0HHDž4EH0HHEH0HHEHHH(H(u4LHHƿXH(H0HPH0HHHu6Dž$LhH<HƿuXNHHPXHHH Qj(AAHFH $H(HHH$HUdH+%(t5WUHH H}HuHUHEHuUHH H}uHUHEH@ PHEH@ PHEHPXHEpTHEHH |QH QjAAHEH UHH0H}HuHUHEHtHUHMHEHHpEIHEH@XH$tHUHMHEHH EHUHMHEHHEEUHH`H}uHUdH%(HE1f)EfEHEHH HEH HEH}u4LHHƿ'VHEHUHPHEH@ PHEH@ PHEHPXHEpTHEHH QjuAAHTDH EEtiHEHENHEH趻HEHpHEAHEE̋E;E~ẺEHEHHEHUHEHH9uHUHEHHEHUdH+%(tYTUHATSHHHHxdH%(HE1HDžHH@PHH 8HHDž0Dž4DžTddHHHpHH@HHDžHHHHDžHHc Dž(HpHt\H HPPHHHHu4L7HaHƿSHHHnHHHH躵HHHH{HHHu4L>HHƿRq_HH@ H@XHttHH@ HHXH HHHхuBHH@(IL BH)HƿbRHH4Tt@HHILJHHƿ RHHHXHHHH(u/LOHvHƿQ)HHHH"u4LQRH%Hƿ^QHHHHuAHH螯IL&UHHƿPuHHt HoHkHH%HSIL{[HDHƿ}PHt,Ld_H HƿFP*L`aHHƿPHH諵uYHHiHH$HǸJHHH襨ILHHHƿJLHHƿIL*HkHƿIHXH5usHHHHH@HHHH HǸ2HƿwCHEHIL7eHHƿ9CUHEH0HMHEHjIAйH[HHEH}u/LjHHƿBEt5EALoH[HƿBHEHPHEHHHEH}t0HEH@Ht#HUHEH@HHAtHEH}u/LyHHƿ B&HEH*u/L~HHƿAHUHMHEHH4HEHH*tFHEHu*LHHHƿUAHEH>HEHHEHu*LHHƿ@HEH|HEH0HUHEIйHH踪u*LHaHƿ@H]_tILbHHƸY@"tLXHHƸ@;7HEuAHUHEHHu*LHHƿ?LH^Hƿ?HEH袿HhHEHEH賖u,LHHƿA?^HEtIHMHEHHYt,LHHƿ>E}tLHEHEH蕊tILHQHƸ>HEHH'tFHEHu*L1HHƿ>>HEH;HEHHEHu*LHHƿ=HEHeHEH0HUHEIйHiH衧u*LvHJHƿ=EHUdH+%(tuAHHZIL 'H~Hƿ8.HHDžDžHH@H@@HHHHuf=u =u =u =u HHHHHH9"t8t/LCEHLHƿ7tMtDw8AL5JHHƿ/7HH@XH%uHH@XH&t DžttQRALZHAHƿz6HHHpHHH@PHHHHHIIHHcHǸyAHH耔IL[ bHHƿ5THt6LcgHlHƿ5DžHHHHdNtit DžttQRALHHƿ4HHH6ILHZHƿ4LH0Hƿi4HH}_H)HǸHdHƿ*HHHH6LE@HHƿR*HHHHHDuuGHHHH蹷u*LGHHƿ)LHHvHƿ)HHHH"uuGHHHHu*L*MHHƿ7)LNHHƿ )qu^HHHH蘶uAHHIIL SHmHƿ( HHHAHZu/LDZHHƿQ(HHtUHHHAHu/L\HHƿ'THH)HHHHHHH@HH HHHPHHH@HH HHHH HHQH@HHHAHQHPHXHHHHuFHH~ILwjHHƿ&?HHPHH`HHHǸyFHHILtH*Hƿc&HH`HHu4LxHHƿ &mHHPXHHH HPXHH@XH%t_HHΥHH@HHH ILGH0Hƿi%HHHHHHIHHHu/LHHƿ$UHHtu/LHvHƿ$HHH@vHcHHH@HHHHjL uIH訚HuIHHHILhHHƿ#HHHUHotIL8HaHƸ#HUdH+%(t"H]UHHPH}ȉuHUdH%(HE1f)EfEHEȾHHEH}u1L՝HHƿ"HEHUHPHEH@ PHEH@ PHEHPXHEȋpTHEHH [QjuAAH/H EHUHEHHEHUdH+%(t!UHHPH}ȉuHUdH%(HE1f)EfEHEȾHЯHEH}u1LHHƿ!HEHUHPHEH@ PHEH@ PHEHPXHEȋpTHEHH QjuAAHH EHUHEHHEHUdH+%(t UHSH(H}HuEHEH@X%HuNHEH@XHH!Hu4LHHƿ HuHEعH$:H葤u4L{HOHƿ HEH@XH tHEH$E}u1LHHƿ, QHEH~HktILHHƸH]UHSHHH}HuHUHEH@PHEEHuHEȹH8Hau4LKHHƿXHEȋ@T~oHEH@XHHHEȋ@TPHEH@HuAHHEH}uBLHHƿ HEHHEHEH@XHt4L~HOHƿHEH@XH tHUHuHEH0E܃}u1L HHƿQHEH|HitIL HHƸH]UHHĀH}HuHUdH%(HE1EHE@HHEdH踋HHEHH萋u4LHHƿ'HEcH4tHEcH輌EHEbH裌tHUHMHEHHEHUHEHHXE}uHUdH+%(tUHH0H}uHUHEHHEH}u4L/HHƿHEHEH@ PHEH@ PHEHPXHEpTHEHH QjuAAHC H EHUHEHH#EUHH H}uHUHEH@(H@HUHR(RHPALYlGHHƿ+HUHSH(H}HuHUHMHEH@X%@Hu HEHwu4LHoHƿHEH@XH%HHEHPXHEH/ju1LC#HHƿPQHEHxHftILn%HHƸH]UHSHH}HuHxdH%(HE1HEH@HHEHxH@HHEHEHHXHMH]HHHXHMH]HH HX(HMH]HH0HX8HMH]H@@HEHEHxH HZHHXHJHZHHHXHJ HZ(HH HX(HJ0HZ8HH0HX8HR@HP@HxHMH]HHXHMH]HHHXHMH]HH HX(HMH]HH0HX8HUHP@HuHEHlH\u4Lh7H7HƿuHUHxHEHu1L:HHƿ!SHUHuHEHu1L=HHƿHUdH+%(tH]UHHH}HuHEHPXHEHPXHEP`HEP`HEHPhHEHPhHEPpHEPpHEPtHEPtHEPxHEPxHEHHEHHEHHEHHEHHN HEHHEHHHuQ UHSH(H}HuHUHUHMHEHHuXHEHuHHEHuHSILե[H!Hƿ_HgHUHEHHHuHEH?Eu1LeHHƿH]UHSH8H}HuHUHMHEHHEHEH@X%HtHEHHuCHEHtILrH!Hƿ_IHEHsHatILwHHƸ HEH@H@H tcHEH8HEHPHMHEHHL~H[HƿHEHppHEعHCu\HEHrHHEH@pHrHSIL:HHƿHH]UHAUATSH8H}HuHUHMdH%(HE1EHEH@X%HtHEHHu HUHEHHq7uCHEHqILHHƿSEԃuCHEHqILHHƿDEԃuCHEH`qILHHƿHE@txEԺ)HEȉH?rHHEL`HEHpI?^tSATML!HHƸ6HcEԺ)HEȉHqHHEL`HEHwpSATILHHƿHEԅuHUdH+%(tHe[A\A]]UHH0H}HuHUHMdH%(HE1EHEHHu HUHEHHHu1LHпHƿ^HEH'E9t@HEHXoILHwHƿHUdH+%(tUH}}t }t]UHHH}HuH}u HEH@HHtbHEH@HHUHH|tGHEH@HHuIL)HHƿHHEHUHPHUHH@H}HuHUHMdH%(HE1HEЋEHEHHEHEغH}HUHBPHEHPPHEHHHHEHHqu4L=H"Hƿ! HEغHR}Hu1HEغH7}HuHEغH}HUHB`HEHP`HEHHHHEHHu4LiCHwHƿvG HEHH@H }uEHEH@`HLCUHHƿ  HEHHEغHHZ<HEHE/H HuOHUHEHHI<L|]HHƿ Z HUHEHPXHEHPXHEHHHHEHH͕u4LbH'Hƿ& HEH@`Ht}HEHPXHEH@`HHG tPHEH@`HUHRXHPIL,fHHƿ H{HEH@XHEHPXHEHP`HE@HEHHPHEHHEЋPHEЉHEH@HHu[HEؾHGHHEHHu4LzHHƿ HEH@HHu4L}}HHƿ HEH@`HLHsHƿr CHEHEؾHqqo}u4LoHHƿ HEHHEHPXHEHPXHEHHHHEHHRu4LHHƿ |HEH@HHu[HEؾH?FHHEHHu4L6HDHƿC HEH@HHu4LHHƿ HEHHPHEHHEЋPHEЉHEHH@%HHu7HEHH@%HuHEHH@H)w}mHEHHEغHH7HEHE/HHuxHEtHEؾHPot HEHUHEHHLHַHƿHEHHHHUHEHH)u4LuHHƿSHEH@`HtsHEHP`HEHHtXHEHP`HEHMHHI(RPILܚHHƿHHUHEHP`HEH@HHu[HEؾHCHHEHHJu4LHHƿ_HEH@HHuFHEHH@(IL9H<Hƿ; HEHHPHEHHEЋPHEЉJ}uoHEH@HH3HEؾHBHUHBHHEH@HH LΙHHƿqHEHHEغHH4HEHE/HHt4LH8Hƿ7HUHEHHu4LHHƿHEHHPHEHHEЋPHEЉHEHH@%HHHEH@PHHEH@`Ht{HEHP`HEH@PHHt\HEHP`HEH@PHMHHI(RPILHHƿHHEHPPHEHP`HEH@PHEH@`HthHEH@PHt[HEHPPHEH@`HH uHEEHEM̺ΉKgEHE;EHEEHE‹EHHEHHHcHHEDcMtHSELQ HTHƸXHOHEEHEM̺ΉfE HE@ t?HEHHEЋEЉEHEM̺Ή8fEHEEHEM̺ΉfEHEt HHILD+H_Hƿ^{HEtnHEH@XHtaHEHPXHEHH}HEH}u?HEH@XIL 1HHƿH}u4L6HHƿHEPxHE؉HG~HE؋)HE؋EHEM̺Ήd؉ENHEE?HE@ALp AH Hƿ 'HE@ HEǀ}u4LIHHƿHE@t2HEt$HEEȺEȃ}uEHEHLh(HED`pHEHE@O\HUAUATSURURPALVHHƿH0HEUȉHEHEH@XHHE~HE@xu4Lm_HHƿH}uaHEHPXHEHHzHEH}u?HEH@XIL dHHƿ4HEPxHE؉H{EHE9EHE‹EHHEHHH+^HHEHEHHEHHH]IRHtHSML`lHCHƸGHHEUȉHE@tHUEă}uEHE@HE@pHEHURpMĺUԃ}HEHE+EԉHE@pE9syHE+EԉHEDJGtHSELyH;HƸ?HHE+EԉHEHE@HEHHtsHEHEHHEHHHC]HUHEu4LHHƿHEHH@H uHEHH@%HHEHXAH5xHǸaH@t4L(H6Hƿ5HEjhhhAAH5HǸbH t4LHHƿZHEHgHUHBHEH\HEH\t4LPH;Hƿ:HEHufHUHEHgHUBHEH\t*HEHfHUHHE@THEuJHEHH@%Hu1LHcHƿbUHH H}HuHE辝HW[E}HEIHdHUB}tH|`HEЉHEЋHUЋ9s4L<DHҞHƿHEЋP|HEЋ@t9HEЋ@tHEHHQIHEЋ@|HEHHPHHEHLh(5;tATSMLՆIH(HƸ,HHEЋPtHEЉP|He[A\A]]UHH H}HuHEHH@H HEHH@Ht E@E@HEHH@HuHEHH@%HtmQHEHH@HH!Ht0m*HEHH@Ht EEHEH8T/HEHM^PHEHEvNHEHH@Ht4LuHHƿHEHEHH@HtFHEHH@(ILU|H Hƿ8tLDHכHƸ0HEHH@HtHEHEHH@Ht|HEHE@p9EscHEHHH(HEEHQALH"Hƿ!HHEHH@HteHE9EHEHH@(UHPALxHHƿHHE@p9EsRHEHH@(UHPALHEHƿDHHETHMQHEPHE@tUHEHH@HH!Ht4LԃHǙHƿCHEH[HUB|HE@|uRHEHHUB|HE@|u4LHMHƿLHEHH@HtHHUHEHHu1LڨHHƿgHEHH@H tHHUHEHH-u1LxHHƿUHHH}HuHEHH@% Hu#HEHH@%@Hu HELHEHHEHHEHHEHpxHEMIH:Bu1LHHƿUHHH}HuHEHH@HH!Hu HEHPHEH HEHJu1LHHƿYHEH HEHHFu1LHHƿUHH0H}HuHUJ EHEHWHU؉B4HE(HMt"HE(HWHU؉LHEHH@Ht!HEH8tHE؉HE苀`HEH*WHU؉HE؋HE؋HE؋uЅHE؋;EsHE؋U"HE؋uEHE؉EHE؋HRAL.HHƿHHEHHHEHPHEH@HpHEHku4LHHƿHEHKt@HE؋@,HE؉P,HEH)UtHE؋@,HE؉P,HEH_KtHE؋@,HE؉P,HE H7Kt%HE HTu HE@0UHSHhH}uHUHMLEEHEHH( HEǀHEH,JHEHEHJHUHEHTHEHHE@DtH{HEHEHYRHEH}t@HE@$HEH*HH/HzHEEHEHIt:HEHIuHEHIuHlHEoHEHIuHEHpItHhHE5HEHKIuHEH6ItHkHEHEHIuHEHHtHcHEHEHHtAHEHHtH)kHEHEH HEkHEHRtFHEHRvEЋMHEH HE HxHEHUHEHH3]HUHHEHHu4L:HHƿfHEHH@H?t;HEILz=HSHƿRHEHH@H HEjhhhhhhhhj_j^j\jGhhhhhhhjVjOhhjLjEj3j/hj$j#hhhhj jhAAH5HǸJHH0t4L)H7Hƿ6HE@HEHH@H9HEjhhhhj_j^j\hhhhhhjVjOhhjLjEj3j/hj$j#hhhhj jhAAH5xHǸ9GHt4LH&Hƿ%HEH%Hu4LxHݍHƿHE@qHEjhAAH5*HǸDHt4LQH_Hƿ^HEHH@H7HEjhhhhhhhhhjGhhhhhhhjVjOhhjLjEj3j/hj$j#hhhAA H5=HǸeEHt4LDHRHƿQHEH^CHE@$t4LvHHƿHEjhhhAAH5vHǸCH t4LqHHƿ~=HE@$t^HEHBuIHEHkBu4LcvHHƿHEZHEH5EvHǸ3Bt4LHHƿnHEHH@HHEHjhhhhhhjGhhjTjIhhhhhhhjVjOhhjLjEj3j/hj$j#hhhAA H5HǸBHLHHƿZHEAIH5tHǸ@t4L.H<Hƿ;HEHH@H HEjhhhhhhjcjdjbhhjHj>jGhhjThhhhhhjVjOhhjLjEj3j/hj$j#hhhAA H5HHǸ6AH0LHHƿHEjjcjdjbAAH>H5HǸ4?H t4LHHƿkHEHH@H DHEHjhhhhhj(hhj%hhhhj_j^j\jGhhhhhhhjVjOhhjLjEj3j/hj$j#hhhAA H5HǸ?H@t4LzHHƿFHEH=uHEH=tYHE\Hj=t4LqHHƿHE@HEjhj(j%hhhhAA_^\H5qHǸ=H@t4Ln H|Hƿ{:HEH<HE@HE@$t4L:q&HHƿL6q *HHƿHEHHHQHUHHEHHZLt,HHƿ@HEHEH;HEHEHH@H ?HEjhhhj%hhhhj_j^j\hhhhhhjVjOhhjLjEj3j/hj$j#hhhAA H5oHǸZ<Ht4L9:HGHƿF HEH%Hu4Lo<HHƿ HE@HEufHEAA%H5HǸ:t4LpDH~Hƿ}< HEHH@H)HEHjhhhhhjjhhhhhjGhhhhhhhjVjOhhjLjEj3j/hj$j#hhhAA H5HǸw:H t4LVPHdHƿc" HEHp8uHEH[8tYHE\HF8t4LlUHHƿ HE@HEjhhhhhAAH5EmHǸ7H0t4LN^H\Hƿ[ HEHH@%HHEHH@%HHEATH5lHǸE7t4LgHHƿ HEHk@t4LljHtHƿs2 HE@udHEuZHEH5zlHǸ6t4LsHHƿHEHEHH@%Hu{HEHH@HH!HuZHEH5lHǸ5t4LUyHc~Hƿb!HEHH@%HufHE@u[HE(HK5tFHEHH@(ILk}H}HƿHEHH@ H@XHHEHH@ HHXHEHHEHхuFHEHH@(IL" HE}HƿDHEHH@% HtEHEu4L-H|HƿHEHH@HtEHEu4LEL H|HƿFHEHH@HtEHEu4L-H)|Hƿ(HEH<HUBHEH3tHEH<HUB 5HE9HtHEPHEP HE@ HMHUHuHEH赼 HUHMHEHHHELHEHHEHHtHEHPpHEHHEMIHN#HE@tOHEHxHEt4L[]HVkHƿU'HEHH@%HuMHEuCHE@L%]HjHƿHE@HEHjhAA H5\HǸ!Ht1L_zHmjHƿlAHE@ t1L\H1jHƿ0UHH0H}HuHUHMHE؋@upHEHjA%A_^\H5kkHǸ!Ht4LyHiHƿ蕺HEHH@% HHEHH@%HHEHH@HH!HHEHH@%HHuxHEH@`HtaHE؋uWHEH@`HUHHR(HPILy[HhHƿ賹HHE؋@HEH@`HHEHH@% HuHHEH@`Hwu4LxH%hHƿ$<H}toHEHP`HEHH6HtSHEHHUHR`HPILZHgHƿ貸HHEHH@%HHuHEHH@H)twHE؋@u HE؋@t4LUZH0gHƿ/GHEHH@%HHtbHEHP`HEHPPPH}tIHEH t4LZHfHƿ贷HEH@`HuHHE؋t LZHVfHƿUmH}]HEHP`HEHH4HEH}uSHEHHUHR`HPILY$HeHƿٶHHEHH@H tZHEH@XH H!Hu@HEHIL$ )H_eHƿ^yHEHH@H tZHEH@XH H!Hu@HEHIL( .HdHƿUHH H}HuHUHEHH@H)t;HEt1LX;HwdHƿvUHATSH HHdH%(HE1HHH@%Ht H@,tH@,u L%eL%\H@4u HeH\H@4u H5eH5\HH%Hu H eeH p\HH@XHt H=U\H=P\HH@XHuH9\HHRXHt HeH\LATSVQIIHHdH¾L׸SH y4LV]HbHƿ軳+uHHH@@HHH9#HH##HHH@@Hu;HILqVeHbHƿvHHHX(tILNVhHaHƸ譲H@ HP HPHUdH+%(t赱He[A\]UHH H}EHE@u>HEH@`Hu1LUHaHƿEHEH@XHu HEu0HEH@XHtTHEuJHEHH@%Hu1LUH`Hƿ蘱EHE@uTHEuJHEHH@%Hu1LUH:`Hƿ9EEUHHH}HEHHt"HEHH)HEHǀUHHPH}HuHUHMHEH@HEHEHHEHEH@HEHEHXHEEHUHMHEHHu/LAoHO_HƿN"HEtWHEH@XHtJHUHMHEHHnu/LnH^HƿHEHH@H tFHUHEHHu/LnH^Hƿ药aHEHH@H tJHUHMHEHHu/LnH*^Hƿ)HEHH@%HtJHUHMHEHH9u/LmH]HƿƮHMHUHuHEHu/LnmH|]Hƿ{OHEHH@H)tOHUHMHEHHiu4L mH]HƿSHUHEHHu4LlH\Hƿ̭HUHMHEHH蜩u/LplH~\Hƿ}QHEHH@%Ht?HEHu/LlH&\Hƿ%HE@HEHH@HH!HHEH HEHHEHEH]u/LkH[Hƿ薬jHEHHH(HEHPHHEH@`HuHo]QRILPH8[Hƿ7HHEHHtgHEHHHHYuFHUHEHHu/LPHZHƿHEHH@H HEHL@(HEt HEHHXH oSHEt H5\H5USHEHxHHEH@`HuHG\HUHRPHuH3\HAPQVWPILPHYHƿH0HEHάtJHEH@(@Bu,LOHYHƿ襪|HEPDPDHUHEHHXlHEH}u,L@iHNYHƿM$HEH@PHuHEHPHHEHPPE}tdH}u]HEHXHtMHEHXHEȺHHu*LSOHXHƿ轩EUHH@HHdH%(HE1HDžH08HHDž@DžDf))fօ HH0HHIH*u4LgHWHƿۨ\HH0HHu4Ltg HWHƿ聨H0HHHHH5HHu4L"H WHƿ HHHPHxHHH QjAAHѺHdKH H0HgHHHH8HUdH+%(t褦UHH@H}HuHUHMHEH@HEHEHHEHMHUHuHEH,E}uEbHEHPPHEHH$HEH}u?HEH@PILL/HUHƿ謦HUHMHEHH1wE}LZL6HUUHƿTHUHEHH3u9HEHILBL8HUHƿHuHEعHzu9HEHPILV:HTHƿ譥UHH@HHdH%(HE1HDžH08HHDž@DžDttf))fօ H0HHHHH0HHIHu4LcVHSHƿ薤HH)2HHu4L[H>SHƿ=HHHPHxHHH QjAAHѺHGH H0HHHHH?4HUdH+%(tբUHH@H}HuHUHMHEH@HEHEHHEHMHUHuHEH]E}uEbHEHPPHEHH HEH}u?HEH@PIL;IwHQHƿݢHUHMHEHHE}L I~HQHƿ腢HUHEHH$0u9HEHILsHH6QHƿ5HuHEعHu9HEHIL/SHPHƿޡUHH@HHdH%(HE1HDžH08HHDž@DžDttf))fօ H0HHHHH0HHIHu4L_HOHƿǠHHZ.HHu4LDHoOHƿnHHHPHxHHH QjAAHѺHCH H0HHHHHp0HUdH+%(tUHH H}HuHUHEHuHEHc uaHEHtHEHb 9HMHEHHHEHYt HEH-UHH H}uHUHEHtxHEHuHEHt4LP'HPHƿ蚞tHUMHEHWZHEHu~HEHxuiHENHcuTHEHNu?HErH9u*HEH$uHEHt4LoD4H3OHƿ蹝HEHtFHEHt1L1D9HNHƿ[8HUuHEHH }QjjAAH蹋H UHH H}uHUHUMHEHUHH}uEHUHHЃ]UHH H}uHULCHNHƿ茜LCHMHƿbUHH H}uHULxCHMHƿLCHvMHƿUHH H}uHUL.C&H.MHƿ訛L,C'HMHƿ~UHH H}uHUL4C/HLHƿ6L2C0HLHƿ UHH H}uHUL2C8HJLHƿĚLPC9H LHƿ蚚UHH H}HE/H9HEH}t HEHHEUHH}uHEH@8Ht"HEHH8EHcHHHHHȋ]UHH}uH}t!EHcHHHHHHEHЋ]UHHH}uUHEHYUHHHHH`HhLpLxt )E)M)U)])e)m)u)}dH%(HH1Dž0Dž40HEH8HPH@0/w#H@0HЋ00H8HPH8,,t,HHt,uWHtH,UHIL|HIHƿCHHHdH+%(tfUHHHHH`HhLpLxt )E)M)U)])e)m)u)}dH%(HH1Dž(((}0((z(&d(}1f(-HA@@HHL7(H@HH" (`(HHDž0Dž40HEH8HPH@0/w#H@0HЋ00H8HPH8,,t,;(u,;(t_HtH(HILGHvGHƿH#((HHdH+%(tUHHHHH`HhLpLxt )E)M)U)])e)m)u)}dH%(HH1Dž(Dž0Dž40HEH8HPH@},HH8u\HtH,HIL]xHFHƿ苔HDž(0/w#H@0HЋ00H8HPH8,,.(HHdH+%(tNUHHHHH`HhLpLxt )E)M)U)])e)m)u)}dH%(HH1Dž(Dž0Dž40HEH8HPH@,HHot|,HHu\HtH,HILvHbDHƿՒHDž(0/w#H@0HЋ00H8HPH8,,(HHdH+%(t蘑UHHH}uUHEHUH}H BEHcHHH)HHH@]UHH}uHEH@8Ht$HEHH8EHcHHHHHH@]UHHH}uHUUHEHt$HEHH8EHcHHHHHH@HEUHHH}uHUUHEHt#EHcHHHHHHEHH@HEUHHH}uUUHEHt"EHcHHHHHHEHЋ@EUHH H}uUHEH@@HEBHEHHEUHEH[tUMHEHUHEHHEHUHEH@H9uEUHHH}uUH BEHcHHH)HHȋ@$tUMHEH2;UHEHt#HEHH8EHcHHHHHȋ@EUHHH}uUUHEHt#HEHH8EHcHHHHHȋ@EUHHH}uHUUHEHRt$HEHH8EHcHHHHHH@HEUHHH}uHUUHEHt$HEHH8EHcHHHHHH@ HEUHHH}uUUHEHt#HEHH8EHcHHHHHȋ@(EUHHH}uUUHEHTt#HEHH8EHcHHHHHȋ@,EUHH}uHEHH8EHcHHHHHȋJ]UHHH}HuHE@(HE@,HEH@H7HH׌uHE@HE@=HEH@HoIHH行uHE@HE@UHHH}HuHE@(HE@,HEH@HqHH3tHHuHE@HE@GHEH@HVHH辋t^EJM>YEȋEPUEXEf*EMYEEf/M>r4La0H/Hƿ^~>f/Ev E,HUB=f/EvEH,HEP=f/Ev EH, HHUHB=f/Ev@Ef/o=s EH,,E T=\H,HH1HHUHB HUdH+%(t|H]UHHH}HuHuHEH>uBHE@(u1L /Hy.Hƿ|UHHH}HuHuHEHUHHH}HuHuHEHuNHE@(t HE@(u1L)&H-Hƿ3|UHHH}HuHuHEHUHHH}HuHuHEHuBHE@(u1L-H-Hƿ{UHHH}HuHuHEH[uBHE@(u1LA-H,Hƿ {UHH H}HudH%(HE1HUHEHHtHEu HE@(uHUdH+%(tyUHHH}HuHUHEHHftHEH@ H9sUHH H}HudH%(HE1HUHEHHt HEtHUdH+%(tyUHH H}HudH%(HE1HUHEHH_t HEtBHE@(u1L+H*HƿTyHUdH+%(twxUHH H}HudH%(HE1HUHEHHu HEu HEHPHU<%t HUHEHHu1Ln7H*Hƿ{xNHEH@ H9s7AL!H)Hƿ2xHUdH+%(tUwUHHH}HuHUHEHHuNHE@(t HE@(u1L!,H))HƿwUHHH}HuHUHEHH5UHHH}HuHUHEHH uBHE@(u1Lk)@H(HƿvUHHH}HuHUHEHHuBHE@(u1L)NH(HƿvUHH}Hu]UHH H}HuHEH@HEHE<@uHEHEHuHEHUHPUHHH}HuHE@(HEH@HHH"utHEH@HA(HHuu HE@2HEH@H+HHtu HE@UHH H}HuHE@(HEH@HE}uHEUPUHH H}HuHE@(HEH@H,E}uUHH H}HuHEH@HNHHst HEH@Hm HEHUHEHHHEH}u1L53H%HƿBtHEH@HH?UHHH}HuHEH@HqHHkuHE@mHEH@HpHH\kuHE@=HuHEHuHE@(uUHH H}HuEHuHEHOu hHE@(u4L@H$Hƿr(HEH@ H9s:ALH;$HƿrHE@E}u4L%H#HƿjrE EЅt7EALH#HƿrI}t E#Et1LHa#HƿqUHHH}HuHEH@H7HH+iuHE@CHEH@HHHhuHE@HUHEHHDUHH H}HuHUHEHHu(HE@E}t}t }tUHHH}HuHEH@H HHhuHUHEHHZ=HEH@H 2vHHhuHUHEHHUHHH}HuHEH@HHH{otZHEH@HٰHH]ottX}HtK{tmf_HEH HHau92HEH ,oHHau UHHH}uE- HHHHuH>Ih}{Ht>mf_uXHEH HH`ua2HEH %nHH`u UHH dH%(HE1H zHHDžDžDžHHi HHHK+‹Љ HHHxVBHHHHHfy ~    ;~@ HHHUBHHHHH9ft;}7HHHUBHHHHHet; P HHH2UBH@DžXHHPHcHHHHHi5HHHЋHDŽ HHi5HHHi5H z9hDžUHcЋHcHHHHHi5HH}HЋHDŽ HHi5H9|DžUHcЋHcHHHHHi5HHHЋHDŽ HHi5H9| ;DžH {H >YBHcHHH)HHȋ@HHcHiHHH H-uHHcHiHHH Hnt uHHƿa<HHUBUBEEHHi5HH EHHHOBH EHHi5H UEHHi5HHH0UHcHi5H m EHHi5HWucEHHi5H5HILO KHHƿ`HTBTBEHHi5Hڽ;UHcHi5H ĽH EHHi5HHHuIEHHi5HqHH2HEH}tHEHPEHHi5H gHE}ZH\HHNBH]EEEEHHi HHHu֋ESBHHSBUH}}uEHHHHˤH]UH}}uEHHHHH]UH}E7EHHi5HG9EuEHHi5HHE}~]UHH H}uHEH@UHE}tUHEHtUHSH(H}؉uԉUЋEHcЋEHcHHHHHi5HHHЋEEHcЋEHcHHHHHi5HHtHHHRtnMHEH'HsHEHcЋEHcHHHHHi5HH0HHHH7\u EHcЋEHcHHHHHi5HHHHH裿t[EHcЋEHcHHHHHi5HHHHMHEغHHH9u H]UHSH(H}؉uԉUЋEHcЋEHcHHHHHi5HHHЋEEHcЋEHcHHHHHi5HHHHH賾tnMHEHHHEHcЋEHcHHHHHi5HHHHHHZu EHcЋEHcHHHHHi5HHFHHHt[EHcЋEHcHHHHHi5HHHHMHEغHpHH9u H]UHSH(H}؉uԉUЋEHHPEHcHHHHHi5HH-HЋEUHE؉HQu`UHE؉HuK}u8HEؾHt#EHHi5H·HHYu EHHPEHcHHHHHi5HHHHH蕼MHEHfHHEHcЋEHcHHHHHi5HHoHHHHvXu 4EHcЋEHcHHHHHi5HH&HHH2HH&Xu@MHEHHHHHHPu EHHPEHcHHHHHi5HHKHHHYt[EHcЋEHcHHHHHi5HHJHHMHEغHHH9u H]UHH0H}uUHM؋EHHHEHHHt ^EHcЋEHcHHHHHi5HHHH HrtHEHqt HEH@HsHHtV}EHcЋEHcHHHHHi5HH(HH HHEHuWHE辀H̼uBHEH跼u-HE辐H袼uHHTHHzHTHt HEH{HEH}t HE/HSHt HEH:HEH}t HE/HSHt HEHHEH}tHE/H?SHtCHEHHEH}tHE/HSHtUHH0H}uHUEEHHPEHcHHHHHi5HHֲHЋE}XEHHPEHcHHHHHi5HHHH"H誷t EHcЋEHcHHHHHi5HHHHHu EHcЋEHcHHHHHi5HHZHHHUHH]Su }EHcЋEHcHHHHHi5HH HHH HHKu)HEغH HHKu EEHHi5H5EHHi5H 9E*EEHcЋEHcHHHHHi5HH'HЋE}OEHcЋEHcHHHHHi5HHHH"Hεt -EHcЋEHcHHHHHi5HHHHHu EHcЋEHcHHHHHi5HH~HHHUHHQu EHcЋEHcHHHHHi5HH1HHH 8HH Ju&HEغH HHIu0)EEHHi5Hc9ENUHATSHHHHxHpdH%(HE1HDžDžDžDžDžDžDžDžDžf) )0DžDžHHHDžAHHi5HjHHHHOu ~HHdt"HH%HnHDž HHi5HԭHHHH.Ou HHҵuHHH躵u0H=H袵uHH芵tHHi5H+HHHi5H%u'H@PHH@8H@,9HtSHHi5HHHt4HHi5HwHHHHMHtSHHi5HAHHt4HHi5H"HHHHMGHt&HHHDžDžDžDžDžDžDžDžH@ HCHHi5Hau'HHi5HLu DžDžHHtYHHPHcHHHHHi5HHުHЋ=uDžHHi5H9SHHi5Ha/HHtHHi5HHHi5H 9|HHi5Htu DžDžDHpHHtHHi5HZ9|t_t t$;W;EHHi5HuHHi5Htu tDžHH貰yHH@Hu 6DžDžSHHPHcHHHHHi5HHާHЋ9u DžGHHi5HHHi5H o9mDžqHcЋHcHHHHHi5HHeHЋ9u-HH\t Dž,HHi5H9jDžqHcЋHcHHHHHi5HHHЋ9u-HHYt Dž,HHi5H09ju7'PH@Jti;~ tR;|D;6;;;H@HHH H(HPHXH0H8 HIL gH%HƿFtWLjHHƿeFHI;BHHi5HкHtW^tUL mHHƿFH:BHHi5HкHWDžHDžH HH至HHHuH^Ht L%IL%DSATIL HHƿ EH;;HHi5HtCHcЋHcHHHHHi5HHHЋ7HHi5H?tCHcЋHcHHHHHi5HHHЋDžHHHpHHHHHi5HHHi5H 9|THHHpHHILo HHƿYC>DžHHH‹HHi5HH,HHHHH@8HH@HHH@HnH@4t6HP4HH0HAH)HP8HHpHHHIHX=H@0*HE@HI8H`@H08H@4t-HP4HH0HMHA@HmHP8HHpH`HA@H<H@4tCHUHH`PILt HHƿ6AH4H`ILr HHƿ@H@0H`@H6HP8HHpH`HA@HBH`ILHHƿS@HHi5H9HHi5HHcHi5H ߝH PPILQ H@Hƿ?HHHi5HHHHi5H bH HH@HHBHHi5H2HHUdH+%(t{>He[A\]UHHH}HEIL H{Hƿ>UHH0H}؉uԉUHEHHEHEEԉEH}u;HEILH Hƿ>HEHI8:HEH@HUHPILHHƿ&>HHE EEMH2BEHHi5HHHUHH+=H2BEHHi5HЋ@0H2BEHHi5HЋ@0t }Hf2BEHHi5HHPH L2BEHHi5Hȋ@H532BMHcHi5HIRPAL HHƿ=HH1BEHHi5HкHNH1BEHHi5HHEE}H}u8HEIL HHƿn<vHUHEHH]HUHEHH3Z}tC}tHEH`*LD +HHƿ;UHHE-EHHi HHHEEHHi HHHuX`UH}HuHUH M0BEHcHHH)HHHEHE@ tH9tHEȺHu HEH@H NHHeuHEȺaHt=HEH@H $HH(u!HEȺHuH]UHHH}HEH̄u*HE=H跄uHEH袄t1HE=H荄HEH@Ha2HEH\tHEH&UHHLB HhHƿL/ H>HƿL HHƿEcHrBEHHi HHEHEH@HUHHPIL HHƿ#HEB9E|UHH0H}uHUE}us}u$HEHHaHHuIE8EHHHEHHHuEEE;E|EUHHH}HEHHEabbHEHxH HEHEHHEHEHHEHE։(HEHHEHHHEHHHUHB`HEUHH0H}uHUHEH@Hu/L  HHƿ6EEHHHEHH HHE}tRHEH@H kHHu/Lv HHƿEHHHEHHHRH‹EHH HEHHHEH@HHhu/L HHƿ#}tRHEH@H HHu/L H9HƿE9E}OHEH@H HHu,LB HHƿOqEE;E7HEH@H LHHTu,L H}HƿHEH@H|?L< H?HƿHEH@HUHH@H}HEHHHEH}tFHEu HE1HEIL HHƿ#HEȾ`H:~u;HEȾH%~u&HEȾEH~uH}u jHEȾ`H}HEH@(HH@HHtBHEH@(HHڻHHt!HEH@(HHHHu HEH@(HH3HHHEH@(HH@+HH^tcHEH@(HHHH=tBHEH@(HH|HHt!HEH@(HHkHHu`HEȾEH|t4LS  HHƿeEHHEHEȾH[|t4L+  HHƿH}t2L) HWHƿHEEHHEHEȺ`HHEUHMHEHHwHEH}uFHEHuIL3 HHƿ=H}uZHEH@HPL hL8 HxHƿHHEHHUH^}uXHEH@HPL hL1; HHƿHHEHHUHUHEȉH HUHEHHfuFHEHuILB HHƿHHEȾHzu H}HEȾHytMH}t*LP H*HƿHEȺH؁HEHEHEHHEHMHEȺHHtHEH}uFHEHuILW HHƿHHEȾH HUHEHHuFHEHuILk] H2HƿH.HEH@HPL La HHƿYHHEHHUHHEH@8HuHEHHUH0HEȾEH3xTHEȺEH>HEHHEHMHEȺHHLsHEH}uFHEHuIL n HHƿH HEȾH HUHEHHjuFHEHuILs HHƿHHEH@HPL Low HVHƿHHEHHUHHEH臮u1Lh| HHƿuUHH0H}HEغHqFEHEH@(@lu:}t*L\ HHƿ!}tHE⿈}t[HEؾQHutFHEHEHE}@HEؾ8Hu'HEHF8H}HEHEHHH Ht>L{ HHƿHEHEH`HH Ht>LJ H)HƿHEHEHHH5 Ht>L HпHƿCHE#HH~ HEH}u HnHEHEH E }tHEH !UHH H}HE&HCHU  ȈHE'H6HEH}uHEH; HHEH$ HH t4HEHHHs tHEH`HHY uHEHUHEBHE9Et3HE@9Et'HE@9EtH}ȋMHUuEIEHE9E|HEHHE}~OHEH9Et>HE9Et3HE@9Et'HE@9EtH}ȋMHUuEIHEHHEH}uHEHtL PHPL LHHƿ$HHUdH+%(tJUHH }uUFMUEAAЉHEH}u1LHHƿXHHZAt=HEHZL+HšHƿ8HEUHHH}HEHRUHHPHHdH%(HE1DžDžHHHHH7AHHEHHu1<#u HHHHHPH9FHH}p LÏHHƿI HH6PH"H64HH>HHu/L2HHƿ? HH ~HHOt*L HHƿHHHH}HHHHAAH^tiHH5uQHHH HǸ6mHqHƿ蹸HEHpHEHp6HEH}uEHEH@HuILw DHpHƿOHaHEHHEH@HHEHHHEHuHEHhH;u/LvYH/pHƿ̷HEHPHMHEHHu/Lqv\HoHƿ~HELpHEЋt HjHR_HELhHEЋt L%jL%0_tuAVSAUMLv ^HNoHƸH EEHe[A\A]A^]UHHH}uHxdH%(HE1HEf)EfEEHEʀ}HxHHEHHHEHxH@HEHxH@HEHE/HѳHHUHEHHHEH}HUHEHH3HEHuIL~u HnHƿ蠵H}u6HxHHEHxH@HEHUHEHHHE4LBu HmHƿ,HHEHwu4L.u HKmHƿHE/H耲Ht{HUHEHHqHEH}t]HUHEHHtFHEHuILt HlHƿ[HsHE/HHEH}t HEHHEHE/H׮HEH}t HEHHEHEfg)…u HEEHE@g)…uH}tHEHHE4L=t HkHƿHEH\}H)HUHEHDH9EsFHEHuILt HvkHƿH+HEu4Lt H3kHƿвHEHu4LqHjHƿ茲HEH u;HEILs HjHƿA]HUHEHHwu4Ls HYjHƿEEHEH@HUHHHEHEHu HEH@HUHHΑHEHEHu HEH*?HEH}u1L, HiHƿDcHEHUHPHUHEHH QujAAHѺHTH EHUHEHHpAEHUdH+%(t UHH@H}؉uHUHMHEHHEHEغHHEEH}HEHHH誯uH+GHEEHUHEHHu+HUHB HEH@ Hu4Ln H]hHƿHEHTHH"u HE@42HEHbHHu HE@4 HE@4HE@0HEP0HEPxHEؾHHEP8HE@8HEjhhhAA^HǸcH tLp 5H0gHƸǮYHEغHHUBhHE@ht:HEغHHUBxHEغH HUB|HEHjhhhhAA^H5=]HǸH0t4LlKHTfHƿHEغ^HHUHB(HEH@(Ht]HEغ^HHUB0HE@0u4L\o PHeHƿ^HEغHBHUHBpHEH@pHt(HEغHmHUBxHE@|HEH@pHt?HE@ht4Ln [H-eHƿ迬HE@huAHEH@pHu4HEH@(Hu'}~!HE@hdHE@|HE@xHE@4u@HE@xu4Ln jHdHƿ'VHE@4uLHE@xt HE@0u4L]n qH=dHƿϫ}u4LSn vHdHƿ蕫HEHHEHPHEHPHEHHHEHH3u4L"j}HcHƿ/^HEH@HuZHEؾHHUHBHEH@Hu4Lm H6cHƿȪHEؾHHEغHt4Lom HbHƿaHEغHHUBTHE@TtHE@TPHEPTHEغHcHUBXHE@XtOHEغH:u4Ll HbHƿ豩}t@HE@Xv4LiF HaHƿkHEغHOHUHB`HEH@`HtLHEغHzu1LOl H_aHƿ#mHEUԉHEHEHUHPUHH@H}HuHUHMHEH@HEEHEHPHEHH&HEH}uNHEHHUHRHPILk H`Hƿ/HHEt*HEHHHEHEH@HuAHz HEHHEH}u,LfH!`Hƿ賧NHUHMHEHHu,L_fH_HƿlEEUHHH84H(dH%(HE1HPHHH8 HWEH8H EH8H EH8TH EH8H EH8H EH88HHEHPH(4H8Hu4L eH^HƿH8H3HHHHu4L H-^Hƿ迥HHHPHPH`H8HH QHjAAHѺHIH DHHH8HH5HEHt'HPH8HHJGu DžDDHUdH+%(t6UHAWAVAUATSHxHxHpHhdH%(HE1EHxH uHpHe%u HUHpHxAAHѺHtEtEHpH!t4}t.HUHpHHE}tEuE}t}t HA\HE HTHEHpH t H \HE+HpH t H \HE H=HEHp@`IHpHHxHHHHpLpHHpH@PLHxLHtHEATSAVAUAWuILp[3Hv[HƸϢH0HUdH+%(tHe[A\A]A^A_]UHH H}uHUHEHt1Le >HZHƿM8HUuHEHH ?QjjAAH諐H UHATSH@H}HuHUHMdH%(HE1EEEHEH@X%Ht5HEH}HMHuHEIHtEu4LFe %H ZHƿXHEH׮EHE@tfUHEȉHHHEL`tHESATILO+HYHƸԠHPUHEȉHlHUHRHMPRILrO.H7YHƿ肠HE=t}uHUdH+%(t臟He[A\]UHH@H}HuHUHMLELMHEHEȋ@HUHMHEHHHEH}u4Lc HHgXHƿ貟HHEH@(L@HMHUHuHEHAЅu4LK^MH XHƿXHEH@(L@HMHUHuHEHAЉEHHH谢}u4L]VHWHƿݞs}uHEYHUHMHEHHgHEH}u4Lb _H"WHƿm}u^HEH@(L@HMHUHuHEHAЅL\fHVHƿ HEH@(H@HtHEH@(LHHMHUHuHEAHAхuSLb jHMVHƿ蘝HEH@(L@HMHUHuHEHAиHEUHH0}܉udH%(HE1HEHEEHE}u}uHEHUHEHH͜LHEdH+%(t#UHHH}HuHE@uzHEH襜HEH*HE-t1LK[H UHƿXHEHmUHATSHPH}HuHUdH%(HE1HEEEEHE@Eԃ}HEHl}tVHUHEHHu?HEH@IL.` H5THƿ耛HEH0HUHEIйHH@u?HEH@IL_ HSHƿ?UHEH0HMHEHjIAйHxHHEH}EătQHEHXtILl_ H+SHƸ{EEHUHRHPILP_ HRHƿ2HE:HEHPHEHHHEH}t0HEH@Ht#HUHEH@HH/tHEH}t-HEH@ Ht HEHPXHEH@ H!HuHEH}HEH@ H= uGHEHXBtIL^ HQHƸou*L$UHNHƿ1HEHsHEH0HUHEIйHHu*LTHNHƿѕEHUdH+%(tHe[A\]UHH H}HuH}t3HEHHt'HEH@HtHEH@Ht HEH@Hu4LZ HMHƿ9IHE HmHEH}u4L/ HMHƿHEHPHEHHtHUHBHEH@HHEHPHEHHtHUHBHEH@HtUHEHHEHHtHUHHEHHt,HEHPHEHHptHUHBHEH@HuDLZ HLHƿHUHEHHSnHEUHH H}HuHEHqlHEH}u1LY H?LHƿ芓FHUHEHHHUHBHEH@HuHUHEHHmHEUHSHHxHpHhH`dH%(HE1H`tH`H@HEH}u4L Y 5HkKHƿ趒HEH"HhHHEHEH@HEHEHPXHEH@ H!H\HEH@(HHEHHEHEHuHE@/HEHu>HEHILmX HHJHƿHEH uFH]tILjX PHIJHƸ虑HEH@HHEHhHHEHEHEHxH@HUHHpHEH}u/L-X ZHIHƿCHUHEHHHEHHEHUHhHH9SHEHEHEH@HPHhHHHHEH}HEH@H@HtHUHEH@H@HHɏuzHEH@ HtHEHPXHEH@ H!HtXHEH@HHLEH}HUHhHxMIHt!EuHE@PHEPHEHHEHUHEH9 HEHu%HEH7HHxH@HHjHUdH+%(t̎H]UHH H}HuHEH@HEHE@HEHHRujAAH2H HEHHHHoHE@tHE널UHHPH}HuHUdH%(HE1EEHEH0HM܋UHEHjIAйHHHEH}uMEHUHRHPIL`U HFHƿ2HEHEHPHEHH HEH}t0HEH@Ht#HUHEH@HH/tHEH}t0HEH@ H=@t HEHPXHEH@ H!HuHEH}HEH@ H= u7HEH@ILR HEHƿIIHEH@HUHHPILXT HEHƿHEHEHu>HEH@ILCR HbEHƿ譌ELHEH@(L@HEHPHMHuHEHAЅu EH HHEHEHHOutFHEHiu*LJHDHƿHEH詉HEHHEȹHdu*LJHaDHƿ謋HEH.iEHUdH+%(t̊UHATSHĀH}HuHxHpdH%(HE1HpH@HEHxHHEeHEH@HEHEHPXHEHH@ H!H+HEHH@(HHEHHEHEHuHEH@HEH@PHHEHEH@HHEHEuPH]LectHSMLBCHCHƸXHHEHEHEHHMHEHH辖E}tTHEH@ uFHEH@HUHHHEH}uGHEHUHHHHEHHEHUHxHH9HUdH+%(t؈He[A\]UHH`H}HuHUdH%(HE1f)EfEHEHEHEHHHEHUHPHEHHRujAAH,H HEHHdHEHEHEHEHHErHMHEH@HUHH蘘Eă}tEtHEH?&HE@uHUHEHHHEHHHEHEHEHHEHUHEHH9yHEHEHH7:H}tHEH@HUHH]bHEdH+%(t)UHH@H}HuHUdH%(HE1HEEHEȋ@t HEH}HUHMHEHHE}tqHEȋ@ ufHUHMHEHH5E}tFEu?HEȋ@u HUHMHEHH7E}tHEȋ뚃}t |HEؾHHEH}u1Lv 9HU?Hƿ蠆/HUHMHEHHHUHEHHHUdH+%(t虅UHH0H}HuHUHEEEHE؋@ t5HEH肰E}u p}u HE@HEH̅HEHH}tUHUHMHEHHhLgDhH)>HƿtEHE؋uHEH賲HE؉HEHHEH}u3L pH=HƿEHEHUHPHUHEHHOHE؋@ t*}u$HUHEHHAEp}HUHEHHEUHH@H}HuUHMLELMHEHyHUBHEU܉P HEHE}u4LK H<Hƿ|HEHBHEHHU}HEPHEHUHPHEHUHP HEHUHP(HEtbHE@uWHEHE@t HF<H)HRILJ H;Hƿ!HHEHEPHEH0H1yHEHHthHEHH|Hv1LJ HP;Hƿ蛂#HEHHUH0HH)UHHH84H(H LLdH%(HE1L(HH 4H@H8MIHlu1L@Hx:HƿÁ^}t"H@HH8HH3H`% H`H@HH8HH HUdH+%(t荀UHSHH8H0H(H dH%(HE1H H@H`H(H?HhHDžpHDžxHEHEEHDžXDžDH8HWHH8DH8LH8H|H8 Hf؉PH`@PH`PH05H0H#H0H4Hu@H0HIL( /H8Hƿ] H8Ht/LiG 4HM8HƿK H0H(HMAPtRH0H@H@@pu9HhIL)G <H7Hƿ~ H8HrH0HM[HhILF AHa7Hƿ_~* Pt9HhILF GH7Hƿ~ H(H@TTy/L<MH6Hƿ} TH8HOtnHhILo PHs6Hƿq}HhILKF QH?6Hƿ=} H8HKH(H0?tdH(H@`@p uOH(H@`H@8HhILE YH5Hƿ|HtHtPH(H<Ht9HhILE `HR5HƿP|&HuPH(H<Hu9HhILE cH4Hƿ{HtcHhILE fH4Hƿ{H(HHHH(HDžDaHhILPE kHT4HƿR{H(HHHH(HDžDH(H:=tQH8HjHH[u4L9yH3HƿzPH8Ht\H(H8AHѺH!u/L89HG3HƿEzH8 HTt\H(H8A HѺHu/L8H2HƿyDžDH8DHH0H0H^tqH8HuYH(H!8HH_C HǸ( H,HƿsHUdH+%(t&sH]UHAVAUATSH@H}uHUdH%(HE1HEHEHEHHEHHE HHEH~HEDHk؅u6LA> H,HƿsEKHEHtHEʀHEH~HEH}u6Ln H+HƿrEHEHUHPHEHuG}uAHEȋ@u6L= H2+Hƿ0rEhHEH;t<}t6L= H*HƿqEHEH=HEHt2HEH HHQu EHEH:HUuHEH &QuAAHHEċUԋE)ƒu L%1L%Y;UԋE)AՋEЃu HH6;DuϼtHATAUSEL< H)HƸpH HUHEHH<EHUdH+%(toHe[A\A]A^]UHHH}HEHƿpUHH@H}HuЉỦMLEHEHEHEHEEHcHEоHdfE;E:HEIL&< OH)HƿoEȃEEL$jHHEHHH%@tHEHEHE?HEHEEE;E|HEUHH@H}HuЉỦMLEHEHEEEHHHEH}u:HEILF(lH.(HƿoHEEHcHEоH)eEHcHEHeE;E:HEIL: tH'HƿnEȃEEEHEUHcHUHщHHHϸhEEEHEEE;E|HMHEкHHqHEHgHEUHH H}HuEEEEHcHEHEhHHUHHu}.t}_t }-t}+u}tkEO} u}t}tLE0}{u#}t}tHEU$E}BUHH`H}ȉuĉUHMLELMHEHE}uEĉEEEEEHE HUHEHu EHEHEH;Erփ}tEHUH)HUoEHUH)HUEHE HUHEHu EHEEH9Er׃}XHEH-HEHUHEHHEH}wBEHUHPIL88 H$HƿkHHEHEH3HEH}H}tFUHEH HUHEHHgnHEHHUHEH HEHHAnUHEH HUHEHH!nHEHPHEHu,HEHPHEH< uHEHPHEH< t HEHEHUHHEHUHUHH0H}HuHUHEHXHEH}uEHUHEHHMHEHHuHEH_HEHUHUHH H}HudH%(HE1HEHUHMHEHH.uHEH_HUdH+%(tiUHH}HuHU؉MHEEKEHcHEHЋUHcHUHEHcHEH< t EHcHEHt EE;E|EPHE؉]UHH@H}HudH%(HE1HEHUHEHHt*L'7H"HƿhHEH HEHE%HEH}w1L~'=H!HƿhHEH+EH+EHEHEHUdH+%(tgUHH@H}HudH%(HE1HEHUHEHHt*L&LH!HƿgHEH HEHE%HEH}w1L&RH HƿgHEH+EH+EHEHEHUdH+%(tfUHHHHH@dH%(HE1H`H@HH>at4L%eH% HƿfQx%=t4L%hHHƿf H@H`HHPHPHPHHH@HH$?HXHXu4L*%lH_Hƿ7fHXHHHPH@HHhH@HǸaHXHXy1L$qHHƿeHXHUdH+%(tdUHH@H}HuHUHMLEH}tHMHUHuHEH|H}unHMHEHΉeHEHEH9Et@HEHUHMHΉ ]HEH}yHEH9EtUHH HHHHLDHE HdH%(HE1HDžhHDž`Dž<Dž@DžDDžHHthHH_HHeHhHhu>HIL5HHƿc H(HYDžLHEH-HpHpHYH(HYDž8Dž0HDžXDž4DL PPHHHxH@ht(HHPHEHH9t L#H@ht DžDHHXH,HHxH,HHxH0HHH:u L0HcHHpHHdHH?XH,HHxH ,HHxHH HHYt LHHH&HH^dHHWH,HHxHp,HHxHH {HHFYt L`H8HH 8iHHǸ]t L*H@tt HP889t LH@tt DžDLXL`HMcAHTH,HH5cAH HcAHP[HxHxt HxL bAL'bHyHƿQ]HHHHHXHHHgbAH?SH,HH5EbAH H1bAHyZHxHxt HxL bAL|iHHƿz\HhtO@P@t#HhHHH]H`HhHHXH`HUHDž`HXH=w LLHX%HuHXH ‹LЉLHXH ‹LЃLLHcHpH H9Ht*L( HxHƿP[HhtzHhH^t*LH1Hƿ [HhH][t*LHHƿZHUdH+%(tYUHH0H}HuHUEEEHEH lHH|ZtTHUuEPAL!$ !H+ HƿTHUEPEPAL $ "H HƿSHEt>UEPEPAL# %H HƿSHHIL HhHƿ@HT HHlHILHHƿGHHLHZILHHƿGHH@ILeHHƿ[GH@ALGHLHƿ$GH@AL&HHƿFHHxHLH\ILHHƿFH`HHHHuHH HHH HHH+HHH9t*L 2H#HƿElHIL15HHƿEHHL  H-IL6HHƿfEHH@ IL7HVHƿ.EHH`uDžHH(HHH(HHH+HHH9*ALL HHHƿDlHAL= LHgHƿ?DHHHHPAL/ NH!HƿCHHH@HPAL PHHƿCHHHHHHHlHAL ZHVHƿ.CHHHHPAL \HHƿBHHH@HPAL ^HHƿBHHHHH+HHH9AL iHVHƿ.BlHAL mHHƿAHHHHPAL oHHƿAHHH@HPAL qHzHƿRAHHHHXHHHPHPHHXHH=HXHH= HXHH=tqHXHHPAL ~HHƿ@H)HHHHHHHPH@HHHHHHHH8lHALY HHƿ?HHHHPAL HHƿ?HHH@HPAL HnHƿF?HHHHHHHHH+HHH9t*L HHƿ>lHILNHHƿ>HAL HuHƿM>H@ALH>Hƿ>DžHHHHHHlHALG HHƿ=HHHHPALA H{HƿS=HHH@HPAL* H4Hƿ =HHHHHHHlHAL HHƿHEHUHPIL) H[Hƿ3-H}tHUdH+%(tL,UHHH}HuHxHpLhL`dH%(HE1HEHEHEHEHEHEHEEEEEHEH舒tUHEH藚HEH}u4L H9Hƿ,_LEH`HhHpHEHH}WH}WH}WH}WH}WMAHpH0Hx@huHx@hHx@htHxH@HEЃEHx@htHxH@HE؃EHx@\E}tEH}t H}D}4L ?HHƿ*;H}ub}uHEHt HEHEI}uHEHt HEHE0}u HE }uHUHhHH$HEH}u0}u HE }uHUHhHHHEHx@luHx@pMLo UH!Hƿ)Hx@luHx@pWHx@ltHxH@HEЃEHx@htHxH@ HE؃EHx@\E}tEH}t H}}4L iH]Hƿ5)}u4L nH#Hƿ(IH}u-HEHt HEHEHUHhHHgHEH}HEHt HEHEHUHhHHBHEHx@\tHx@\E7HEaHwtHEaHEE}u.Et'HEHtHEHtHEHEHEHE&}u{HEHEHEHuIL HHƿ'HL HHƿy'}u.Et'HEHtHEHtHEHEHEHEq})HEHUHhHHt*L HHƿ&HEH HEHE%HEH}w4L HHƿ&HEH+EH-HEHEH+EHEHEHuIL HeHƿ=&HL] H7Hƿ&>LH Hƿ%1}udHEHt HEH9EuHEHtHHEH9Et>HEHUHPIL7 HHƿi%H}udHEHt HEH9EuHEHtHHEH9Et>HEHUHPIL H'Hƿ$HHEHuIL HHƿ$HHEH.HEH}u4Lq HHƿ~$H}HMHUH`HhIHþtOHEHuILv H8Hƿ$HHEHQDEH`HhHUHxHEHuuuEIHH HEHHUdH+%(t"UHH H}HuHUHMHEH HHukHUHEH  HHǸ t/L H1Hƿ #HEPhPhHEH qHHuoHEHP8HEH ~HHǸ}t/Ln HHƿ{"HEPtPt<HE H HHvu@HEH@HUHHUHUHB`HEH@`Ht HE H HHuoHEHPHEH HHǸt/L HHƿ!1HEPhPhOHEH pHHuoHEHPHEH HHǸt/L H(Hƿ!HEPhPhHE H HHulHEHPHEH j HHǸtt/Le HHƿr HE@l6HE H HHpulHEHP HEH HHǸt/L HHƿHE@pHE H HHuoHEHP(HEH T HHǸ^t/LO HHƿ\HEPtPtHE H nHHWuoHEHP0HEH HHǸt/L HHƿqHEPtPtHEH HHHE-H0HtFHEH_H u4HEHHHIL HCHƿDHHHH HHH HHH+HHH9t4L HHƿHH *HHOHHH )HH-HHHPH@ HHHƿϦ#0HPAL HHƿHH}t4LHHƿHH }u1HxHHHHǸH`H@HHp HH6H`HH`H`HhHH9uHhHH@@tt6HEIL HtHƿLPt3HEIL H5Hƿ ETuH@IL HHƿg3H` H։t9H@ILo H6HƿHEHHHHu9H@IL8 HHƿQHHH'~HPHP,HHHP HΉ$$HH9HtHH@IL HVHƿ.HPH t*LҬ  HHƿHHHPHHHuCL'  HHƿHPHeNH(H0HHHPHuCHPH$L  H?HƿH8uhL " HHƿH0HLJ $ HȥHƿH8HȥHH5HXHXuCH8IL( HeHƿ=DžH0HXHHHXHt*L˪ 0 HHƿHXH,t*L 2 HäHƿDžHPHeH0HVA t*L" < HWHƿ/HUdH+%(tYUHH@H}HuHUȉMdH%(HE1}Ā4L I HߣHƿHHEHHH% HHUHHHH% tyHEH HHHt^L R H8HƿL S HHƿHE<#u}HEȺ H ަHHu^L [ HHƿL \ HHƿ^EHHPHEHu.EHHPHEH< uEHHPHEH< t*L{ c H HƿHUHEHHztHEHHH{HEH}u4La g HHƿHEHHHEH&HH<L; n HMHƿ%HEؾHMuIHD HǸ݅HIL' HHƿ_ HHHHHHuVHHHHPILž H2Hƿ H H'H4OHHHHHHHHHy>HIL7 HHƿl@ %=u%HHHHxH%=`HHHHu>HIL` HHƿ HHHHIHHu`HuVHHMHHPIL HaHƿ9H HpHHHu4Lם  H Hƿ HHDHjHDuHiHDHHLH H Hu4L'  H\Hƿ4 H HHHeu4L֜ H Hƿ lHHHHLHHHHHAЅuVHHHHPIL HSHƿ+HHHHL@HHHHHAHHHѺHrtFHHIL # HHƿg;HHLHHHHHAЅuVHHsHHPIL( HHƿHHHHHHHuKLHHHpHHjjMIH̨HHHHHxuKLHHHpHHjjMIHdHHHHHuKLHHHpHHjjMIHH%HH7HHuCLHHHpHHMIHHHŒHHHu@LHHHpHHMIHhHHHHu!HpHHH*L&C HqHƿIu4L F H>HƿHjH:GHHHHHdHHu9HHHpHHIH茽HHHHuCLHH HpHHMIHHHHHAu@LHH HpHHMIH*LqV HHƿu4L@ Y HuHƿM!HiHM=HHHH HpHIIH5Hu4L c HȏHƿtHHH HpHIIH5_H9u4L# f HXHƿ0uTHHHHHu{L r HHƿHHu4Lu t HHƿVDžHHHHHHHHHH HHHHHHHHuNHHHHPILgz H׍HƿH/HHHpHH跤u;t1L! HVHƿ.HUdH+%(tQUHH H}uHUHEmH0BHUHBHEmH9tIHEH9u4L9 HyHƿHEmH9uxHEH{9tcHERHf9uNHE1HT t4LԸ &HHƿdHEH9t:}t4L ,HHƿHEH8t\HEHxzH@HUHB HEH@ HUH\HHu HEHP\HEHHEXHpCu1L 8HݏHƿXHEXHBHUHB(HEmH7uHEH7t HE@ UHH H}HuHEH@Hu wHEHPHEHHEH}u?HEH@IL` OHHƿHEHP\HEHHLHEH}u\HEHXHEH@HUHR HPIL UH~HƿHHEH@HHUHHEH@HHUHHEH@HHUHHEH@H蕐HUHEH@HސHUHEHwUHHpHHdH%(HE1HHCHHHwu HHHHu HHHHu HFH;5u&HmH#5tHXHHHHH' HHu4L{ H~HƿHH H@HHHH[HHu1LH HHƿYHHHHH u Dž DžHHHH3^HUdH+%(tUHSHHH}HuHUHMHEHQHEEHEHhtHEHPHE6HEHHEH )ÉډHEH~HHEHEȾH3tRHUHEHH>.HUHPILH "HHƿH<HEHHtYHEH4H7tHEHSIL (H$HƸ(HHEHHILƫ HHƿHpH HH0H H tH H(nHpH HHH H tH5PH(4LF HHƿH H_HyH@H@u>H IL HHƿwH@HpH H)Hк~HH)H HxH@H(IHH H¸by>HIL HHƿHH@PHpHHU?HHHHu>HpILHHƿyoHH@PHH@H`HHHHju>HpILIHHƿ H`H0H0HPHHH8H8HXHPHPHXH@H9uSHXH@H@@HIL. Hm~Hƿ`HXH%H8HH8H8H;_H0HH0H`H90HUdH+%(t/UHHPH}HuUH}u4L H}Hƿ袿H}tHEHt HEHHEHEHHEnHEHEHEHHEHEH@XHtXEHEH HZtILsH\sHƸTHEH4HE}HEHX9HUHxHHAEH@t7HEH1u'HEH4H@H@%Hu H H\HEHIktHSML HhrHƸ`HHUHxHH@uUEHEHHtIL HqHƸmHHH8HMHhHuHxIHu>Lr HqHƿ菳HEHHEHUHpHH9KH`tD}u>H`ILqHqHƿHEuu}t*Lȝ HpHƿʲHpHIL'qHpHƿ菲Hx HtHxHlHuHxSTRXURAAH3H u1L< HoHƿbHUHxHHu1L! HoHƿ蛱}t H@HEHUdH+%(t謰He[A\]UHH0H}HuUEHUHEHH=E}u*Lo &H oHƿEUHH0H}HuUHEHEHEHHEHEH9Et HEH@HEHEH[u1Loo <HnHƿ|gHEH@PHUHMHHuAt6Lț FH'nHƿUHSH8H}HuHUHMLEHEH@PHHEH@HHHUHHEHHt.HEHPHHEH@HHȏHUHHEHHu1L\ SHkmHƿ^SHEHUH HZHHXHJHZHHHXHJ HZ(HH HX(HJ0HZ8HH0HX8HR@HP@H]UHHH}HuHxHpdH%(HE1HpH@HEHEHEHxHmHEEEHE@@HE@<HEH@HrHEHPHEHHEHHHEH}u?LltHlHƿ HE@<HEHLuFHEILԙ zHkHƿ趭HE@<HUHEHH%+HEH}u;HEILkH_kHƿRPHEH@XH tDHEH6t4LA HkHƿHEHЮH}u4L" HjHƿ謬HEH@XH7t4L HrjHƿecHuHEH H0u4L HjHƿHUHEHH&EHxHjHHE HHAHEH}tHEIL HiHƸ{HEЋ@uH}t*L} HLiHƿ?HUHMHEHHHEHEHu/Lg HhHƿHEHHETHEH@HHEHEH'uHEH*H@H@%HtEHEHHEHUHEH9uUHMHEHHu/L HGhHƿ::eTHUHEH@HuAHѺH|HEH}u/Lh HgHƿѩHEЋ@uHEPPHEЉPHED@HEHPHEЋpHxHMHEEIH:HEH}u/LHaHƿ胣~t=Du4LÑ HHJaHƿ=p8t=tu4L QHaHƿ*tHxH@HHz{HEH}u4L^aWH`Hƿ蓢HEHEHhHHxH@HH莂HEHEHu4LP ]H7`Hƿ*]HhHHxH@HH-HEHEHu4L bH_HƿɡHEHMHH|LHEHtHEtHhtEHhHEHxHtnHxHRHHxH@HH\HEHEHu4L_tH_Hƿ+Hx H0EE}tHxHxHK.HEH}u4L; Hr^HƿeHEHUHP}t H`H;}tHUHxPuAA记HHUHxHHy0}uuEu4L^ H]Hƿ诟EtxLf^ H]HƿsEEu1L-^ HG]Hƿ:pEubHxH HHNHxH LEHUH}tHEHuHxAHHHUdH+%(tUHH H}HuHEEHEH0HEH}u?HEH@HIL" H0]HƿDHEHt@HEH@H@HIL !H\HƿwHE@L;Es7EAL 'H\Hƿ謝4HEHUHHHHHH@H9EuUHH@H}HudH%(HE1EHEHHEȾHPt!HEH/HuEHUHuHEHh IL7H!Ht HUHuHEHѺ Hou1Ls[ BHl[Hƿ耜HUdH+%(t裛UHH0H}HuHUHMDEHEHu1LZ RHZHƿUHH H}HuHUHMHEHu[HUHEHHHtHEH)u4L ]HeZHƿyHEHu4L(Z bH!ZHƿ5THEHxHUHEHH(uCHEHrIL} hHYHƿϚLYmHYHƿ蛚HEHu4LO oHMYHƿaLK tHYHƿ-HEHr\tHEHpju1L1 vHXHƿUHHpHHdH%(HE1u4L HXHƿpHH EEHHHHHHHHW HH(yuku,L[ )HWHƿ識4LtW +HWHƿ聘HHaHHiuHHH%HHu1L 7HVHƿYHHHHHu Dž DžHHHH!(HUdH+%(t跖UHH0H}HuHUHMHEH@HEH}u4L "H;VHƿHE@ PHEP HEHYtKHEHI HHwu1LU .HUHƿ誖|HEHHEHHUHuHEAHΈu1L7U 2HfUHƿDHE@PHEPUHATSHPH}uHUdH%(HE1HE}u6Lʆ @HTHƿĕEmHEXHu6L{ FHTHƿsEHEXHUHEEEHEHHEH"HEH}u6L THTHƿEHEHUHPHUuHEH QQuAAHTHEċU܋E؉)DeZtHSELx ]HlSHƸOHHUHEHH$EHUdH+%(tdHe[A\]UHAWAVAUATSHhH}HuHxdH%(HE1E2HEHRHEHEHtKtHEIL] ;HRHƸxHx@HxHPHxHHHEHHHx@PHxPHx@PHxPHxPEHxP Hx@ HEH@HHkHxHB(HxH@(Hu Hx@EHx@ HxH@(H辈HEHHEHM(HHtu4LQ OHIQHƿXHx@PHx@ HxH@(HuHMIIȉHPHHǸ1y4LPUHPHƿ虑HxH@(HEEEHEHSHEHvPHHEHHIHEH@`HtHEH@`HX8HtHxDhtUHATSH8PAUuAL3P]HOHƸĐH0HEHQHHEHvQHEHQ)ÉډHEHPHHHEHHIHEH/QHEHPHHHEHHIHEHNHtEAUATSuALI cHNHƸЏH HEHPHEHP)ÉډHEHPHHHEHHIHEHSPHEHOHHHEHHIHEH@`HtHEH@`HX8HrHEHMIHxDxtEAVAUSATAWuALl hHMHƸÎH0HUdH+%(tHe[A\A]A^A_]UHSH8H}HuHUHMHEH@HEHEؾHtHEHNHt%HEؾH\tHEHHPu HE@PHEPHEHPtOHEPHEHEHLHUHRHHEHPHEHLHUHRHHEHP6HEHyNHEHNHHHEH@HHEHPHUHMHEHHAH]UHAWAVAUATSHxHxtHhdH%(HE1f)E)E)EHEHxHtLHxHt4Lz~ HKHƿ褌@HxHuHxHtUHxH~t HKHKIL~ HBKHƿHxHHEH}u6L HJHƿ̋EMHEHUHPHhtHxH QuAAH*HEEu?7tL]} H\JHƸ4HUHxHHIDuHUHEH)HxHHcIċUE)AHUHxHH?HËEdtHAUAVATAWSDdL| HIHƸwH0HUHxHHEHUdH+%(t艉He[A\A]A^A_]UHHH $H HdH%(HE1HHIH HHۏ HǸ)yDHL  Lo HHHƿ薉HHILIHHHƿYHHt[tO؇τHPH~ PILS HHHƿHHEdH+%(tUHHH $HLHdH%(HE1Dž\DžXLHHPALHHzGHƿMHHM} H]H`H`7Hh@<.HH7~HhHPHIH| HH HǸ~Dž\DžXHpH}HpHXH\HAH譽\9LX9HHILFH:FHƿ HHt[蘅tO茅胂HPH4| PILcQ HEHƿ裆Hpt!HpHHpH?H`H跉HhHh/H`H胇tOڄсPHk PL ){ LP H!EHƿHHEdH+%(tUHHH $H0HdH%(HE1HHHHbH@<.HH{HHHHHIHH" HǸ{HH}t^觃tR蛃蒀HPHCz PILrO HCHƿ貄HHHHHHH軅tR HPHj PILN HVCHƿ)HHEdH+%(tQUHSHH $HhHHdH%(HE1HHHIHy HH HǸ#HtJHHHPL ry LGi HgBHƿ:HMHHd|SH'y RALHBHƿHWHHǸr~yNNHHPILrBHAHƿpHHILFBH[AHƿ.HHH HH@HH HH҄ƅ ƅH!HΉHHHtFHHHPILs %H@HƿgHHzHPHPALs %HJ@HƿHHHHHHHH9qwtOxo|HPHOPILOK )H?Hƿ菀HHUdH+%(tH]UHH`H}HudH%(HE1#HMHE HHBuHUHE@HryHuøHUdH+%(t4UHHHxHpHhH`dH%(HE1HEHEHEHEEHpILCr >H>Hƿ]HxH{HMHE HHHEHyH t3HEIL?FH>Hƿ~HEH}MHUHuHEHjIAȹH:HHEH}HEt?EHUHPIL_d Hn-HƿAnH=]vgSuALHd H/-HƿnHSHEHP%Ht/L, H,HƿmaHEHOHt/Ld, H,HƿqmHEHKot/L%, H_,Hƿ2mHEHHEHEH@H@@HUHHHEt3HEIL1c H+Hƿl=eHuAL&c H+HƿxlHEHEHHEHUHEHH9,HEILx,HA+HƿlHuHEHHEt:HEHIL),H*HƿkFHEHdHSAL^ H*HƿdkHHEPHEHEHLTtFHEHHu*L) H1*HƿkHEHhHuHEHCu*L) H)HƿjHEH2HEHUdH+%(tiH]UHSHXH}HuUHMdH%(HE1HEEEHEHHEH}uxHEt/L H)Hƿi8'cAL` H(HƿiHEHUHPHEHHEHEHHEfHEHPHEHH7HEt7HEH@IL)HR(Hƿ%iCHEHXYbHSAL ` H(HƿhHHEHPHEHH(HEt7HEH@IL4)H'Hƿ}hCHEHXaHSAL_ Hi'Hƿq@Ht`HEHuOLl(H&HƿgHp@HHMHuHEHEHp@HtHEH財w EąE@L(HJ&Hƿg}u HEH7M uHMHEHHERujAIȹH H EHUHEHHDH p@HtHp@H$DHo@EHUdH+%(teH]UHH0H}؉uԋMHEغHHEH}HEH@ HEHEHEH@HHEH@HEHEHxH]ILx8HRHƿ%VMHxHj]HOOHSAL"8HHƿUHHPHHEHdHEHEH@HH`HUHEHHHEH}uANALAO ?HHƿSUDž$HDžhHxHSHEHxH;HEH}tNHEHOu>HEH@LPHUHuHAAHH HAHhHhuUH}tNHEHOu>HEH@LPHUHuHAAHH] HAHhHhHt>HxHy[ILYPH#HƿSMHxH;[H MHSALM PHHƿSHH}HEH@HPhHEHHhHEHH\9HxHhHHHEH}HtUHhHHxHhZHSIL]YH HƿRHYHhLHxHZHKATSALL YHHƿRHHhH0HHxH@`HHHHHHHHxHHHt>HxH\YILpaHHƿQMHxHYHKHSALK aHHƿQHHhH /QDž HHHHcHxH@(H%H9tgHHHt!HEHHHH9t Dž HEH@HHt-HEH@HH  HHIu Dž  HxHHHt>HxHWILpHgHƿ:PMHxHWHdIHSALJ pHHƿOHHhHj-HhHQHt>HxHVIL9vHHƿoOMHxHVHHHSALI vHQHƿ$OHHhH,HhHHsHhHZHHHCHH*HhHTHLHhHHxHUATSIL I ~Hg Hƿ:NHHt>HxHhUILH HƿMMHxH*UHGHSALH H HƿMHHhH+]HhH/HHt>HxHTILHC HƿMMHxH[TH@FHSALH H HƿLHHhHF* HPH(HhtHhHHxHHHTHt>HxHSILjG H) HƿKMHxHASH&EHSALGG H HƿKHHhH,)Dž$j ,04Ht>HxHRIL7 HD HƿKMHxH\RHADHSAL H HƿJHHhHG( ,u 8)DžDžDžDžHhHhHILE HZ Hƿ-JHHHhHHpHhHHL3HhHHHHhHILsE HHƿIHHHhHHHt=HhHIL5 H4HƿIIHhH5BHSALD HHƿHHHhHHPfLD HHƿ{HHPHHHxHIHu DžHt>HxHdOIL- HHƿGMHxH&OH AHSAL D HHƿGHDžHtSDHPHxHNATSILC H@HƿGH_DLPHxHFNH+@HAUATSALC HHƿFH Dž*HtNHPHxHMHSILHC HoHƿBFHRLPHxH|MHa?ATSALC HHƿEHHPHH@HH%HHH@HHH輹u*Lr HHƿEDžHPHuHhtHhHHP4u 0HPHu/LdH+HƿD8u9HPIL HHƿDI<tVHPHHHKu9HPILH}HƿPDHH_t#HPHHHǸ:HPILw H HƿClHHt HPHH8HǸ94HPIL5HHƿnC0t}HhusHt,Lz@ $HIHƿC2XHxHIIL7H[Hƿ.BMHxHsIHX;HSAL? 7HHƿAH8usHEHpQHpH@H,ILc ;HHƿAHpHHpHpHEH9utsHEHpQHpH@H谟ILAH:Hƿ AHpHHpHpHEH9u[HhHusHt,LHH Hƿ@29ALR> HH Hƿ\@HEHpHpH@H@X%HuBHpH@H薞ILLH Hƿ?@HpH@HTILNH Hƿ?HpHHpHpHEH9@,tLHH@Hu@Hht6t-u$HHyuHhHH@HhHH`HXHXHH`HXH9$HUdH+%(t>He[A\A]]UHH`H}uHUHMdH%(HE1EHEHvH3 H誸H3 H蛸Hy4 H茸HEHcHEHEHL+< zH: Hƿ >HEHHEHEL; H Hƿ=HEHHCHEH}LQ H Hƿ^=HEH@HWHEH}u=HEHFCL H+ Hƿ<rHEHUHPHUHEHHtHUHEHH_CHEH}bHEHBHuHMHUHEIHPHUdH+%(t;UHATSH H}HuHEHCHHEHH蟎HEH}u;HEHyCILl: H# Hƿ;zHE@HMHEHHjHEH]HuH HEL` HEHCSATIL4: H Hƿ~;HHe[A\]UHATSHĀH}uHxHpdH%(HE1EEHEHrHEHrHEHEHgPuzHEt,LuN H Hƿ:23AL9 H Hƿ: HMHxuHEHKu4L% H_ Hƿ2:? HUHMHEHHu4L H Hƿ9HEHEbHEH@ HuIHEH@HtLjH Hƿ8HEL7 H Hƿ~8HEt9HEHE"HEHPHEHHHEHHEHUHEH9uHEt HEHsHEt+HEHktEHEHEHEHEHEHHEHEHLHEHPHEHHEHAЅ_HEt[HEH@HNHHEH@H>HSIL\ H: Hƿ 7H_HEH@HXNIHEH@H:>H0ATSAL H Hƿ6HHEHHoHEH@@T%tsHEH@H=HH HH.t.HEH@H=HH HHc.uHEHPHEHHHEHEHEHHEHUHEH9EHEHEHE Hƿ,Et HMHUuHEHnu }u HEHdt1L H Hƿ+eHMЋUHuHEHEEtEHEHu*L HK Hƿ+EHUdH+%(tJ*H]UHH H}uHUHEH@(H@HUHR(RHPAL{ H Hƿ*HUHH H}uHU}t*L, CH HƿO*HEH@Hʺu1L FH Hƿ*UHH0H}HuHUHMHEH@HEH}HEHuHEH@HUHjjjAAHH u1LY SH Hƿf)HEHF7UHH H}HuHUMDEHEHPHEHPHEH@H!t }HD HHUHB8HEH@8Hu4L fH2 Hƿ(}t'HUHuHEAH@HUcHUHuHEAH@HU<}t6HEHPHEHpHEAAHѺH?HUUHH0H}HuHUdH%(HE1HEHE@HujHUHEHHA_u4Lm H Hƿz'HEHE9t&vHEt HE@t ZHEHH@H荅IL) Hz Hƿ&HEHUdH+%(t &UHHHXHPLHL@dH%(HE1H@H@HhHpHHDždHPH@XHtHPHHt DžHHPH(HƋHLHpHXAHu/L HK Hƿ%8HPH@XHHPHHH`HpHPHHdu/L* H Hƿ7%`t:HPHH@H@XH$tHPHH@HPHPHPPHhHhHu H@H@HPHjHpWjAAH H t DždHEHt HEHdHUdH+%(t#UHH H}HuHUHUHuHEIйHOUHH H}HuHUHUHuHEIйHUHH H}HuHUHUHuHEIйHUHH H}HuHUHUHuHEIйHUHHHXHPLHL@dH%(HE1H@H@HhHpHHDždHPH@H@XHt!HPH@HHt DžHHLHpHPHXAHHPH@HH@H@XH$tHPH@HHPHPHHHPH@HPPHhHhHu H@H@LPHjHpWjMAH荮H u,L Ht Hƿ DždHEHt HEHdHUdH+%(tUHH H}HuHUHUHuHEIйH UHH H}HuHUHUHuHEIйHUHH H}HuHUHUHuHEIйHUHH H}HuHUHUHuHEIйH\UHH H}HuHUHEH躅uHEH]uHUHuHEH HWUHH H}HuHUHEHYuHEHuHUHuHEH HEWUHH H}HuHUHEHuHEH蛟uHUHuHEH qHVUHH H}HuHUHEH藄uHEH:uHUHuHEH KHVUHH0HHHDLdH%(HE1HH@HDž HH@ Hf) )0)@)Pfօ`HDž0`H# HHH/HHHHHP HHHHHHHHHHHHHHHHHHHHHHHHH H#HHH H8HHuHH@HDžH@DždDžhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHMHHHHH HH@HHxHHHxHHHH@HHHHHpHHHHxHt_HpHHAHRu/Lc mH HƿpHH@HIHHuHHLPHt HHHHHHHu HH@HHAPLpAPIMHH>H u6Dž L~ tH HƿHHtHH HUdH+%(tUHH H}HuHUHMHMHUHuHEIAHUHH H}HuHUHMHMHUHuHEIAHUHH H}HuHUHMHMHUHuHEIAHPUHH H}HuHUHMHMHUHuHEIAH UHH H}HuHUHMHMHUHuHELHiNUHH H}HuHUHMHMHUHuHELH,NUHH H}HuHUHMHMHUHuHELHMUHH H}HuHUHMHMHUHuHELHMUHH0H}HuHUHMHEH@HEH}HEHuHEH@HMHUHjjjAIȹHXH u1L H? HƿUHH0H}HuHUHEH@HEH}HEHuHEH@HujjAAH诣H u1L H HƿUHH H}HuHUHMHUHuHEH |H,UHH H}HuHUHMHUHuHEH OH+UHH0H}HuUHMLELMЋE(HEE0HE؉E%tME%tM@E<E%@HE@0HEH@8HtHE=HEH@8HtHEH@8HH HUHR8Ht H H HMHqHMHI8Ht H  H d HPRVIL H Hƿ5H Et E|E%uE%@tEH H HHUHuH}HMHE+L UHd HƿEUHH@H}HuHU؉MDEDME}@t}t,HEHHMHUHEH$E}t}t5}u}u}t}t HH Hc HHUHHMHUH}IeEE+L  nHc HƿEUHH HHHHLdH%(HE1HH@H(H@VHHH@HHH0Dž$H(PH(@ H0H(@@H0P0H(L@ H0HH H0H@MIHGu4L H/ Hƿ HHHH-H8H8u4L4 H HƿA qH8@H8H(HPH(@=tc=t@D H(H HH8HEAH$D H(H HH8HEAHM$mD H(H HH8HEAHY$+Lk H Hƿ H8H@H8HHH_$HUdH+%(t UHH}HuHUHEH@HHE؋@tHE؋=t HE؋=uHE؉P0HE؋@0t`HEtVE HXHMHhH@H HH>xH`H8H`H8HHMHhH@HS HHwH`HH`HHHMHhH@H HHwH`HH`HHHMHhH@H HHlwH`H@H`H@HtFHMHhH@H HH*wH`HH`HHL H3 HƿrHMHhH@H HHvHXHB@HXH@@Hu,L. H Hƿ; Dž|HEHG|HUdH+%(tLH]UHH@H}HuHUHEEEHEH@@HEHEHH\kHEHH?ktjHEHHlHEHEȋHUH։E}u/L H Hƿ)HEȋHEȋUΉ\tJHEHHkHHuЋEHcHHHHHHHHHHEHHEHUHEH@H9EEUHHPH}ȉuĉUHMLEHEHEHEEHEH@@HE%HEHHiHEHHitlHEHHjHEHUEH։ E܃}u4L H0 HƿHEHH#jHEU܋MEĉΉtCH}t/HMEHcHHHHHHHHHEHHEHEHEHHEHUHEH@H9H}t HEHUHUHH H}HuHUHEHE0HMHEAHtUHH H}uHUHUuHEIйHUHH0H}HudH%(HE1HEЋu"HE@HEHPHEHP(HEЋHUHMHΉ訆HEHHEHEHUHH<_uHmH}u=HEЋAL H HƿHEHUHJ HHݤu1L Hļ Hƿ4AHUHEHHHE؋@tHEHPHEHP( HUHEHP(HUdH+%(tUHAUATSHXH}HuHUHMdH%(HE1HEH@HEHEEHEEEHEHXPHEDX,HEDP(HEDH$HED@ HExHEDhHEL`0HEHP8HEHp@HMHEHjSASARAQAPWEMH H@HEH}u/L 3H] HƿfHEHUHPULEH}HMHuHEMIHu/L\ 9H HƿiHE@@t HEu\HEHP(HEHPBHMHH"u/L =H HƿEE==u=9=_==I==3=q=H @HHHD@@H„uTHƒH„H@H!HHEHUHEHWEHEH@8Ht1}MHEHP8HuHEAAȹHExEtEt9EuEu EtEt HH H HGHUHRHM1H}HPjuAAH EHEH@8Ht1}MHEHP8HuHEAAȹHEHEHPHE0HEHH QujAAHXH EfHEHPHE0HMHELHrE9HEH@8Ht1}MHEHP8HuHEAAȹ@HEHE@0tRHEH6ZHEHPHE0HEH QuAAHHEHEHPHE0HEHH QujAAHHH EVHEH@8Ht1}MHEHP8HuHEAAȹH3EEtEt9EuEu EtEt H~HR H HHUHRHM1H}HPjuAA`H EHEH@8Ht1}MHEHP8HuHEAAȹHiENHE@0EtEt9EuEu EtEt HH Hd HHEH7XHEHPHE0HESuAAȹHHEHEHPHE0HEHH QujAAHPH EaL H Hƿf5L8 Hʴ Hƿ:7HEHI't HMC Hƿ.PHxHUHPHxHEHH諶HEHDH8H@HMHXL8HHAЉttu HC HI tHHf Ht;l~ tl趁pp;TiHEHxqt9L7C H"B Hƿ~DžlHxH@HHhHEH}t HEHMUHxHPHXHH HxH@HHEH}HxH@H辄H貀H@HMHXL8HHAЉttu H]B H tHH Hat;l~ tl0HxHHxHxHEH9{HXHHHEH}8LA Hw@ HƿX|Džl0t9LJA H5@ Hƿ|DžlHEH菉HEH}HEH@H2H&H@HMHXL8HHAЉttu H@ H7 tHHT H t;l~ tl~HUHXHH΁HEH}HEH7H0HHMH]HHXHMH]HHHXHMH]HH HX(w}H0lHUdH+%(tzH]UHH H}HuHUHMHEGH2v4L H}> Hƿ^zHEHv4L H3> HƿzHEHu~HEGHuHEHt4LJ H= Hƿy HEHEHEHEH&HUHEGH HUHEHQt?HEu4L֍ H= Hƿx]HEHH HHpu[HEHHEL H< HƿoxHEtJHEH@ HUHPALz H3< HƿxHHEtHEH@ HUHEtQHEHEHuHEHu1L6 *H; HƿwUHH@H}HuHUdH%(HE1H}t HEHHu OHEH/HtHHEHHUHEHH虰HEH}u4L5 AH: HƿvHEHHu HEHUHbHEHHEHHutHHEHHUHPIL; FH|: Hƿ]vH^HUHEHHEHHu;HEHIL OH: HƿvHUdH+%(t#uUHH H}HuHUHUHMHEHH(u1Lt4 bH9 Hƿu\H}tPHEHHtDHEHH}u1L4 eHI9 Hƿ*uUHH@H}uHUHMLELMEEH}tqHEH@HUHHTHHEH@HMHHu4L: {H8 Hƿt*E"H}HEHrHUHEHHӮEEHHHEHHHEHE<@HEHHuGHEILd9 H7 Hƿs}UEIHEHPHEH@HHSHHEH@HMHHL8 Hl7 HƿMsHMHEHH蝡HEHE/HpHt@HEIL8 H6 Hƿr}uElHEH@HUHHRHHEH@HMHHu8L7 H6 HƿrrEE;EEUHSHXH}HudH%(HE1HEH@ H.SHEH}u4L H6 HƿqHEHUHHEؾHHEPHEHEP H}u>HEHPBHu.HEH跓upHEH@HUHHK`H]HEHsHEHUHhBHpBHEHUHxBHBHEHUHBHBsHEHUdH+%(t$pH]UHH@H}HuЉUdH%(HE1HEH@HQHEH}u4L H4 HƿkpHUMHE؉Huu4L/ H=4 HƿpHEỦP HUHEHH HEHHEHUHHEHHuHHEH@HUHH'JL. H3 HƿoHEHUHPHUdH+%(tnUHSHH}HuH}3HEH@Ht#HEH@HHtHEH@HHUHEH0HHhBHpBH HZHxBHBHJHZHBHBHJ HZ(eqH0HEHEHPBH u*Ld- H2 HƿqnHEHǀPBHEHXBHt"HEHXBHTHEHǀXBHE H]dH]UHH0H}HuHUHE@u HEH@@HUHuHEAHѺH^E}u8HEHILE3 H1 HƿtmHEH@@EUHH0H}HuHUHMHE@u HEH@@HMHUHuHEIHѺH0^E}u5HEH@HIL2 H0 HƿlHEH@@EUHH0H}HuHUHMHE@u HEH@@@HMHUHuHEAH]E}u=HEH@@HsIL2 +H&0 HƿlHEH@@EUHH}HE@u HEH@@]UHSHHHHLLHEHdH%(HE1HpHmHDžHDž4Dž0Dž,Dž8Dž<Dž@,nHHtHH t Dž<HHHPHPH@HXHPH@H`Dž(Dž$EHXHJSt&mHXHP HEHHmiH`tIHMH`@HHLu*L( hH&. HƿjHUHXHHHmAt9Dž8L( nH- HƿiHXHHEPIL/ qH- HƿriHH4HXHIйH4ujL ( tH5- HƿiDž88u H6. H 8HH H:D4L0H`HXHHHHWH4HHhHH0DLHXHH$WH(WHTH6L ' |H6, HƿhDž88u H7- H 8HH H;HHH.HXHPtLHH'Eu*Lo& H+ Hƿ|gHHHeHXHH,@u*L& H>+ HƿgHHHDmHHHHXHOtLHHVDu*L% H* HƿfHHHJdHXHH[?u*LA% Hm* HƿNfHHHC($<utHH!uHXHHHuDHHHhHHHHYHhHHHHs1HH|H`tHEHK HXHPILP+ H6) HƿeHHHhHXHLHAЉDH,HHH趚Dt*L# H( HƿdDu H) H( DHHE HD;8~ D8HXHHMtLHHAu*L" H( HƿcHhHaHXHHHEH@XHHEH@XHHEH@XHHEH@XHHEH@XHtHEHHt YOHEH@XH;HE$HEH@XHHEH@XHHEH@XH2HEH@XH3HEH@XH HEH@XH6HEH@PH@`H HEH@XH&HEH@XH'lHEH@XH.XHEH@XH/DHEH@XH0HEH@XHHEH@XH"HEH@XH!HEHHEHHEHHEH HEH HEHvHEH@{HEHmHEH1_HEH\QHEHYCHEH5EALg H HƿOUHH0H}HuUHEHHE}EHHKHH?H>HEH@H@HtHEHvu wmHEH@H@Ht&HE@LuHEH0u 1'HEH HEH@XH$HEH@XH%HEH@XH0HEH@XH-HEH@XHHEH@XHHEH@XH?HEH@XH1vHEH@XH bHEH@H@% HCHEH@H@H+HEH@H@HHEH@H@%HHEH@H@HH!HHEH@H@HHEH@H@H$HEH@H@H%HEH@H@(H HHL]HEH@H@(Hd HHL5EALe H HƿLUHH H}HEHHEHEHt HEH@H@HtHE@Lu HEH@H@Ht cHEH@XH$t FHEH@XH%t )HEH@XH0t  HEH@XH-t HEH@XHt HEH@XHt HEH@XH?t HEH@XH1t {HEH@XH t ^HEH@H@% Ht >HEH@H@Ht HEH@H@Ht HEH@H@%Ht HEH@H@HH!Ht HEH@H@Ht HEH@H@H$tuHEH@H@H%tWHEH@H@(Hf HHIu.HEH@H@(HJ HHoIuUHHPH}HuHUHMLEEH}t HEHH}t HEHEUHEȉHsEHEH}HEH@HuUHMHEHHkEHEHHHUHEHHщE}tEH}t!}tE/sHUHH HEHH}t'}u!EsHUHH HEHE}EUHHPH}HuHUHMLEEH}t HEHH}t HEHEUHEȉHrE{HEH}HEH@HuUHMHEHH EHEHHHUHEHHщE}uEH}t!}tEqHUHH HEHH}t'}u!EqHUHH HEHE}"}UHSH8H}HuЉŨ}u  HEHH(ẼHcHHHHHHh(HHu HEHH(ẼHcHHHHHH`(H HpHEHH(ẼHcHHHHHH`(HHEH@(H@HMHI(IHRURPAL^ y H HƿgFH HEHH(ẼHcHHHHHHh(HHuHEAH E}HEHEEKHEH}uJHEHMHHEPIL=^ H HƿEHJHEHXHEHHSIL)^ Hr HƿSEHEH]UHSHHHH@dH%(HE1HEHEHEHDžxHDžpDž`Dž\DždH@HlltlHEDžhdHHH@(hHcHH,HHHEHE@4t0HEP4HEH0HHAHMHEH@Ht1HEHPH@HHAHHEH@Ht1HEHPH@HHAH{HEH@Ht/HEP8HEHpH\H`HHIHHEH@ Ht/HEHP HpHxH@HHIH,HEH@(Ht)HEHP(H}HMH@HHIH8HEH@HHE@0`HE@H8HEP8HEHpHMHHA@HNH@HHHHEPILQ[ Hj HƿKBHDždHEH@HHE@0\HE@H;8HEP8HEHpHMHHA@HH@H7HHHEPILZ H HƿAHDždHEH@ HHE@0HxHHE@4t_H}t HEHXHl H@H荟HSILCZ H Hƿ@H]H}t HEHXH  H@H.HSILZ H Hƿ@HDždHEH@ HHE@0HxHHE@Ht6HEH@ HM@HHEHE@4tNH@HqHHHEPILY  H Hƿ?HaH}t HEHXH H@H HHEPSIL]Y  H~ Hƿ_?HDždHEH@(HHE@0HEHHE@HP5HEHM@HHeHE@4tNH@HQHHHEPILX % H Hƿ>HLH@HHHHEPILX ( Hs HƿT>HDždHEH@(HHE@0HEHHE@HE4HEHM@HHZHE@4tNH@HFHHHEPIL]X 3 H Hƿ=HLH@HHHHEPILOX 6 Hh HƿI=HDždhHHH@(59hdHUdH+%(t7GHHHHHHeEHH@H@HH HE@HH>u*L h H Hƿ,HH@H@H@HHUHH/yt9DžL; n Hg HƿH,t{HH@H@HPHHH HHHHt>HH@H@HPHHHH+HHidDžHH@HTFHH@H@H@HHEtBHHHH %EHtHHTtiHHHHRHRHRHHPILF H Hƿ*HHHHpH5tDHщtHHHHo`t*LD Hp HƿQ*u H{ H HHu H;~ tCt:DžL H Hƿ)HHHHHHHHH9~,H@,t9u0HHtHHu DžHHHHH@H@,HH@HHHPILD H Hƿ(H Džu H H HH4t H赺HHHHH90Džt1u HH H HHs HL5+*uHHHH@HH]H0HH0H8HHXH@HHHHHXHPHXHH HX()H0HUdH+%(tl&H]UHSHH}uHUHMLxLpHEHhHEH`dH%(HE1EEH}HEH@HUHHHHEH@HpHH蓚u4L Hu HƿV&HxupHEH@HUHHXHHEH@HhHH:L[ H Hƿ%HHEHHHxHHHHEHEH@HUHHDHEH}t1HxHUHuHEIHH[+ HǸBy4L~ HK Hƿ,%HEH@HUHhHHu4LU H Hƿ$BE:EHHHEHHHEEHEHEHE<@HEHHD|u6HEILSW He HƿF$HEHPHEH@HHSHHEH@H`HH]LV H Hƿ#CHUHMHEHH(RHEHE Hƿ"H}upHEH@HUHH$HHEH@HhHH5L' %H Hƿ!HEHHHEHvHHHEHEH@HUHHHEH}t.HMHUHuHEIHH-' HǸy1LP ,H Hƿ mHEH@HUHhHHu8L* 0H Hƿ EE;EEHUdH+%(tH]UHSHH}uHUHMLxLpdH%(HE1HEHEHEHEHEHE}t4L2< rH HƿHEHHEH@HHHEH}u4L wH Hƿ{YHE<@HEHHwu;HEIL*R }H< HƿHEHPHEH@HH%HHEH@HpHHu4L, H HƿHE/H;Ht`HUHMHEHHWHEH}u4L* HV Hƿ7HEHEHEHEE,EHH HEH6HEH}HEȾ/HxHHMHEHH1WHEH}u4Lb H HƿoMH}toHUHEHHt`H}t H H uuIL9 H HƿHHEHEE}H}uRHEHWHEH}u;HEILH9 H HƿhHEH@HUHHHHEH@HMHH^u4L H@ Hƿ!HEHHHEHHHHEHEH@HUHHHEH}t.HMHUHuHEIHH! HǸ荻y1L H HƿwXHEH@HUHxHHau1L HC Hƿ$HUdH+%(tGH]UHSHXHHHLLHEHHEHHE HdH%(HE1HpHHDžDžDžDž Dž`HHH H H@H8H H@H@DžDžEH@tIHMH@@HH;u*L H HƿHUH8HHft9Dž LD Hp HƿQFHH0H`HPHHH(eH(H@HHHH/HHPHPu H HHb HBDLH@H8HHHWH HƿDž  u H? H HHa HCHH H8HtLHH/u*Lw H HƿHH#H8HH4u*L HF Hƿ'HH_HHH8HtLHH^u*L $H HƿHHRH8HHcu*LI $Hu HƿVHHzHH0H`HXHIAHHt*L ,H Hƿu H H> HH[_ Hܥ; ~  H8H^tLHHu*L 1H2 HƿHXHH8HHu2L 1H HƿHXH,HH8HIйH*d Hb|u*L7 5Hc HƿDH HH H H9Džt1 u H' H HH] H+H0HHpHxHHXHMH]HHHXHMH]HH HX($H0 HUdH+%(tH]UHSHH84H(H LD0HEHHEHHE HdH%(HE1HEH/HXH8H@ @\DžLDžPH8߈HEHHHEHGHEHGHpHGH`HGH8H@ @%t6LEH}HMH(4H8MIHTBLMLH H(4H8H}WH}WHHTTt;TPLu lH HƿHu^H8HHHu9DžPL qH9 HƿH@tkHH@Hu[HH8HHu9DžPL wH Hƿ.HEHGu DžLMHEHGt\t DžL(HEHeGtH@t DžLLtVH8H< HHSu9DžPL H Hƿ fH8HLy* H Hƿ HpH8Hu9DžPL6 Hb HƿC HEHHFHpHMH8HHӪTT;P~ TPHEHEtIHEHEt9DžPL H Hƿ &HEHEtLHpHEt9L Hf HƿG DžPHEHBEt 0LtHpH`HHF!H`HpHuH8HLEH}HMH`0H8HMIHH TT;P~TPXuHH8HHߛH0HHMH]HHXHMH]HHHXHMH]HH HX( H0PHUdH+%(t6 H]UHH`H}ȉuHUHMLEdH%(HE1EEEHHHEHHHEHUHEHQHEHHEH9EHEHHEHEHbuGHEIL!= H3 Hƿ }EHEH@HUHHHHEH@HMHH}L H Hƿ }HEH@HUHHHHEH@HMHHr}u5L HT Hƿ5 EE;EnEHUdH+%(tFUHH@H}HuHUEHEHHE'HEH@@HHEH}u4L1 H HƿHEHHEHHHEHH HUHBHEH@HuWHEH@H!HUHRHPIL H HƿHE:HEH@HHEH HH HUHEHHb?HEHHEHEH9EEUHH H}HuHEHHE,HEH@H9EuHEH @HEHHEHEH9EuʸUHH}HuHEHHEHEH@H9EuHEHEHHEHEH9Eu׸]UHH`HHHdH%(HE1DžL# =H Hƿ HHAL+ HHW Hƿ8W~StDž#H@P%HH)HHHS=HHH>=HH HHHH IL< ^H HƿdHHHLHAЉt DžHHHH HHHH HUdH+%(tUHH`HHHLdH%(HE1DžH`#HHDž H`HHXH`HH`H`HHhH`HHpf)) )0)@)PHH H0HH H8HH0H@HH0HHH/HHHHHH@HHHHF HH8 HDž0HHHHHHHPHHHhHHHpHHHxHHHEHHHEHHHEHH:HHHHҔu4L2 H^ Hƿ?HHHHPHHHHHtHHPHHH?uH#HH@ @% HH@HIL H HƿeHH@HHٟHHu4Lm H& HƿHHHHtHHHHƝHHH@HHH覠HHHuHv HHt4HHHQHHHAHQHHHHh H\HH`HHLHAЉt Dž'Mt5L H Hƿ9HHHHHH9OHUdH+%(tUHSHHHHHHDDHEHHE HdH%(HE1H0HHDžDžDž ƅ`HHHhH`@HHu*L@ Hl HƿMHu^HHHHu9DžLݼ H HƿH@tkHH@Hu[HH@HHΌu9DžLd H HƿqHHHu HHH`HH`HHHHH@H H HH(EH HM@HH:u*L H HƿHUH(HHIt9DžLC Ho HƿPhHDžHt^HH15uKH HP@HHHHHtHHPHHH4uHt DžuFHH4u3H HHHHrt DžtBH HHHH舎tHH-t2%H} EtKHHH(HPIL (H HƿHE%tKHHH(HPIL *HO Hƿ0HE%tKHHH(HPIL ,H HƿHDž[tMHHH(HPIL\ 2H HƿnHKHHH(HPIL( 4H@ Hƿ!HHH HHLHAЉ t*L 9Hͼ Hƿ u Hؽ H>n HH[D H܊ ;~ u0HHa1tHtPHHD1u=rHHHHHHH9Džt1u H Hjm HHC HuHHHHH0HH0H8HHXH@HHHHHXHPHXHH HX(H0HUdH+%(tAH]UHSHHHHLDHEHHEHdH%(HE1HpHDž8Dž4Dž<Dž@pHHHP4HPH@HXHPH@H`Dž0Dž,EHXHt&HXHP HEHH'iH`tIHMH`@HHu*Ln H Hƿ{HUHXHHBt9Dž<L HG Hƿ(2H8HXHIйH^u@Dž<<u H H{j HD;<~ D<0HhHhHHWtLHHu*L H+ Hƿ HhHHhHHHu2L Hǵ HƿHHHHXHtLHHu*L2 H^ Hƿ?HHHHXHHu*Lկ H HƿHHHaHhHRH8HXHIйHPB HZu*L] H Hƿju2HHh)tHHU)t Dž@>wHPHHPHPH9Dž@@t1<u H Hxe HHDž t1u Hޫ HD\ HHa2 HxH0HH0H8HHXH@HHHHHXHPHXHH HX(H0HUdH+%(t[H]UHH0H}HuHUHE辺HKuHEHKEUHuHEHA)u1Lv H HƿUHSHH}HuHEHJHUBHE辺HJHUBHE4HT~:AL; H HƿHE4HsUHHEHP@HEDHJt!HEDHYTHEPXHEHHEPXHEaH|JtYHEaHTu?HE@Xt4L H HƿHEHSHUB HEHUu4LK H HƿHEHyTHUHB0HEH@0H9s4L HP Hƿ15HEHkTu4L H HƿHEHSHUHB8HEH@8H9s4L H Hƿ~HEHP0HEH@8HHHEHHHEH@0Ht#HEHHUHZ0HHH HEHHEH@8H9HEHHEHHKCHHEHP0HEH@8HHEHH&CHSIL H HƿHHEH@0HEH@8HEFHRu4L HD Hƿ%)HEH_Ru4L H HƿHEFHQHUHBPHEH@PHu>HEH HcHEHPPHEH@PHuHcHEHPPHEaHPHUBHHE@HyHEH HUBHHEHHEHQHUHH]UHSHHH}HuHUMHEH@0Ht HEH@0Hu HEHEH@(HEEEHE@HE@`EHE@DtgHEIL)0HJ Hƿ+HEIL@ 1H HƿlHEH HH HH'uAHEHuIL 3H HƿHHEHuIL5Hv HƿWHHEHuIL 6H: HƿHHE@t Eu}toHUHEHH HǸ{HHEHPHEHHI>HHEHHHb HǸzH)f HƿGHHHH|uYHHHPIL AHe HƿHHPHH@HH>8HUdH+%(tțUHSHHH}ȉuHUdH%(HE1HEE}unHEHHEȺHHHEHEH}HEIL UHd HƿnHEȾHtHEȾHu4L YHgd Hƿ腛HEȾHHEȾHyt1HEH=C H HHEHH艒HUHEHHt4LY fHc Hƿ֚aWH}u4L lHsc Hƿ葚HUHEHHu6HEIL oH!c Hƿ?E؅EHuAL qHb HƿHL sHb HƿʙHEȾHuVUHEHH HǸx7HEHu.HEHuHEH@XHH!H`HEHnt*HEHH@X%HtHEHHEHEH@XH HEHHEH@XHHEH@XHHEH@XHHEȾH‹MHEH}uHUHEHHݝt|}uHEH@XHuiEUHMHEHHiu3L"Q Hm[ Hƿ/EE HEHHEHUHEHH9=}t_HEHEzt H HZ SURILk HZ Hƿ腑H}tVE tHHUHEHHu1LP HjZ Hƿ,EHEHHnu?HEHIL HZ HƿڐEEH]UHAUATSH(H}HudH%(HE1EEHEH:HUHuHEHщH"uEgt H28 H HELDmtSATEL HY HƸߏHEHUdH+%(tHe[A\A]]UHSH(H}HuHEHILݼ HX Hƿ_HUHEHH E}tTHEHtEHSAL H,X HƸHH]UHATSHPH}HuUMdH%(HE1EEEOEHEHHHEHHEHHtqHEHt_HEHHEHHH胍t:}t4L H:W Hƿ}uRHEH@`HtBHEHIL HV Hƿ褍}}HEHHE^HEH@H@@HuBHEHILV HjV Hƿ,2HEHHEHUHEHH9uHE}&HEHHE"HEHPHEHH`HEHHEHUHEHH9uHEH"EЃ}HEHHEHEH@H> t}HEH@H@X%@HugHEH@H譫uNHEHHEPIL H.U HƿHHEHHEHUHEHH9M}tHEH衙HE@}HEH4Eԃ}HEHUHPAL HsT Hƿ5HQCHUHuHEHщHuEt H2 H HUHMPRALX HS Hƿ袊HUHMHEHHu1LMI HS HƿZEHEHHEHAtHSEL H0S HƸHEHUdH+%(tHe[A\]UHHH}HuHEHILR "HR Hƿ臉HUHEHHu1L9H %HR HƿFUHH H}HuHE HiEHE@P9EuBHE@PNIL 2HR HƿĈKUHEH~u1LqG 8HQ Hƿ~UHH H}HuHEHE}tVHEHOjHtBHEHILO CH/Q Hƿ}uSHEHiHu?HEHIL IHP Hƿ蕇;}tHEH@`HHHEHP`HEH@`HHHEHP`UHH H}HuHE HEHEH@`HE}t}u }uP}uJ}t H| H܆ ILe ]HO Hƿ识;}tHEH@`HHHEHP`HEH@`HHHEHP`UHH H}HuHEHEUHEHyu1LD pH=O HƿUHH H}HuHEH"EUHEHyu1LxD {HN Hƿ腅UHH H}HuHEHQH9sKHEHHIL H@N HƿHEH=EHE9Eu]UHEHH,HUHHPIL HM Hƿ聄HUHEHwmu1L'C HrM Hƿ4THEH.u?HEHIL+ H#M HƿUHHH}HuHuHEAHQUHHH}HuHuHEA HUHHPH}HudH%(HE1HEHt4L HLL HƿHEHHhHHQHEHUHAHQHEHUHEHhHcu?HEHIL7 HK Hƿ葂nHEHHE.HEHhHUHRHѺ HH9HEHHEHUHEHH9uHUHMHEHH)HUdH+%(tKUHH H}HuHEH7EHEH\fUjPALp HJ Hƿ蚁HHEHf9EHEHfu:HEHILG HwJ Hƿ9DHEHHEPILE H5J HƿHKUHEHFfu1L? HI Hƿ譀UHH0H}HuHEH@XHtHEH@XH@HI HEHEؾ!H|tHI HEHEH@XHEؾEHKtHEغEHZHEHEغ`H>HEHMHEغHHWHEH}u1L> HH HƿSHEHUHPXHEHuuILѰ HH HƿKHUHH H}HuHEHgHEHUHEHHHEH}u4LgH HH Hƿ~HEHHUHH}uBHEHIL( HG Hƿj~,HEHEHHHEHHEHHv}Lׯ H/G Hƿ}HEHusHEHHEHHHǯ HǸ Hƿu!HEȾfHtOHUHEHHL04 H{> Hƿ=uHEȾLHJtHHUHEHHAu1L3 H> Hƿt`HEȾZHtHHUHEHHu1Ls3 H= HƿtEH]UHH`H}HuHUHMLEdH%(HE1HEEEEEHEȺ HXHEH}u4L2 H= HƿsHEH C HHst>L H< HƿsHEHEȺH芩u>L Hj< Hƿ,sHEOHEPPHEHEHYu4L1 H; HƿrHUHEȾH>HEHtxHuHEȹHYKu,Lҧ H; HƿLr.HE HEHEEHuH}HMHUHEIHqudHEHuH HUHt Hl; H HPILT $H: HƿqHHEHuHE HEE܅t(HE HEHUHEHwEt3HEIL DHF: HƿqkE؅t3HEIL NH : Hƿp1HEIL VH9 Hƿp}HEHYtDHEHMu*L:/ ^H9 HƿGpmHuHEȹHIu*L. ^H39 HƿoHE%HEHEHUdH+%(tnUHH`H}uHUdH%(HE1HEHEEHEHu?HELHxu*HEZHcuHEfHNtEHE H*uTHEHu?HEEHu*HE`HuHE!HtEHEHHEHu~HEHuiHE HouTHEHZu?HEHEu*HE H0uHEHtEԃ}u}tE؃}u:}u4L H6 HƿmHE`HuHEEHtIHE!Hrt4Lң HZ6 HƿmzHEH)tIHEfHt4L H5 HƿlHE.HuHE~Ht:}t4Lx H5 HƿZlHEHgtHELHRuHEZH=tUHEHVu4L$ H5 Hƿk$HEZHtIHE~Ht4L H4 HƿhkHEHutOHEHu4L¢ HB4 HƿkbHEHtOHEH)u4L H3 HƿjHEHtg}uaHEHuLHR HǸ3H HƿQl HHH k HHԮu4LX @H HƿeQ HHHPHH *u>HPIL7 QHG HƿP H@HH!HPHHHPH9tGHH.u*LJ ZH HƿWPMHPHH )u*L ZHR HƿOHPILI [H HƿOz HH^HHu4LH `H HƿrO! HHHHH~uMHHHHL fHT HƿOHHHPHHHDHHu/L lH HƿNnHH@H@@p%t#HHHHHHPXXHHO7HhHH@tqH`HH)BtSpHHQCt8HHHHCtxHH3u/Ll wH HƿyMSH H舳t:H H uHH@`HHHHP`HHHH u/L ~H. HƿLHhHH9t:HAL/ H HƿLH`HH9t:HAL H Hƿ,LHH@HH@@HHHH莹HHHcHHu/L H HƿK[HHHHfu0L# H Hƿ0K HHHHHH@H9HH@ tHH;u/L H HƿJHHHH踕HILy H HƿKJHHzHHL HV HƿJHPH2tLHHY'u*L H HƿIHHMGHPHH^"u*LD H HƿQIHHHuH2 HHHt L%{ L% HLϔtSATML H HƸHHHHJWH8HHHHHۗu/L H Hƿ=HHHڙ HHa(HtHH, HHOGuKtLO H  HƸGHH@ZHH HHFueHEH u~HEH uiHENHuTHEHu?HErH̩u*HEH跩uHEH袩t4L HH HƿLCHEHYtIHEHDt4LL* MH HƿB}tFHEHt1L= RHQ HƿB8HUuHEHH ZQjjAAHH UHSH8H}HuHUHMHEHt6HEIL~ H HƿBHEHCHEHHEHEH@HHEHpHEعH [ HvuVHEH@HHUHHPILP~ &H HƿJAH`HEHpHEعHْ H7HEHHEHUHEHH9!HEH@`HHHEHP`HEHǀHEHHE-HEH@HHEH@HHHEHHEHUHEHH9uHEHtHEHu,L& 7H Hƿ3@PHEHtIL"} 9H HƸ?H]UHH H}uHU}u^HEHХuIHEH軥u4L| DH# Hƿe?HEHrtL}uHEHWt1L| IH Hƿ?8HUuHEHH QjjAAH}H UHH H}HuHEHUHEHH=HEH}uOHEHHUHPIL+| H HƿE>HHEH@H@@Hu;HEIL| H Hƿ=HEH@H%HubHEH@uOHEHHUHPIL{ .HD Hƿ{=H.HEH@HHEH@HHUHH@H}HuHUHMHEH@HEHEHEEE/HEHUHHHHEHHtEEHE@9ErŃ}u4Lz DH^ Hƿ<HEHtHEH u1L4 IH  HƿA<FtHEILRz KH HƸ;UHH@H}HuHUHMHEH@HEHEHEEHEؾDHҡHE@uuHE@ujHEH tZHEHHy HǸBLr QH Hƿ2HEHUuHEHH QjjAAHBH UHHH}HEHƿ2UHH}HuHEHHEHEH@H9EuHEHEHHEHEH9Eu׸]UHSHHXHPHHdH%(HE1DžlHEHQiHPHHtRHH@(u@HPHILqq 4H Hƿk1HPHuHt@HPHILJq 9H( Hƿ1HPHHpHpH@HGuHpH@H@@Hu/L DH Hƿ0HpH@Hp@HXAAH6!tKHpH@H@@H7IL}p HH3 Hƿ0lHpHHpHpHPHH9lt/L NH Hƿ/2HPHHp-HpH@HP@HHHHHEH}t$HEH hHUHEHHfHpH@HHE@HHu/L ZH Hƿ.sHPHHUHPIL=o ]H Hƿ.HL_o _H Hƿ.HpHHpHpHPHH9HHHHEHEH;HHPHHEH@Hg5HSILn fH Hƿ-HLn gH Hƿ-,HHHUHH(hHH@(tHPH@`HHHPHP`HPHhH u/L uH: Hƿ&-HPHHPHHHHP HPH@HH HPHHPHHu/L {H Hƿ,HPHǀHPHǀHXHHt&HXHHPH@HHf HPHHPHHpHPH@(H HEH}u/L H Hƿ+8HpHPHEHPHHHP HPH@HpHYHH HCpHCpHu/L5 HV HƿB+HH@(t"HEH@HHEH@HHHEH@HHEH@H HH-HEH@H u/L H Hƿ*HEH@HHpH@H@@H HHR-HEHPHHHaHpHHpHpHPHH9HPHHxPHPHhHxHRHѺ HH,HxH@HǀHxHHxHxHPHH9uHH@(uHXHHHHEHEH@HHEHpHXAH|u?HEH@Hz0ILej H Hƿ(uHEHHEHEH;HpHPHtHPHu,L| H Hƿ(HUdH+%(t'H]UHH@H}HuHUEHEHH-HEH}L H Hƿ'HUHEHHnHui@HEH}u3EL| H Hƿ'EHEHUHPHUHEHH_HUHEHH-HEH}\HEHT-EUHSHH84H(dH%(HE1HDž`HDžhHDžpHDžxHEHEHEHEHEHEHEHEHEHEHEHEHDžHDžHDžHDžHDžHDžHDžHDžHDž HDž(HDž0HDž8HDž@HDžHHDžPHDžXDžTDžDDžLHH]HH]H8HH0HHH\H82Hc ЈH8H5 ЈH8HJ> HHu (H8HZH8ʀH8H2u4L%8 H| Hƿh$H8u H_ HƿKHHxH8HH LrW H HƿHxHsHHtGH8H@u*L H Hƿ9HH8HJu*L0 HQ Hƿ=HH8tGH8Hu*L H HƿHH8HL H HƿHxH HHxtGH8Hu*L HA Hƿ-HH8Hu*L H HƿHHtGH8H0u*Lx H Hƿ)HH8H:u*L HA Hƿ-uH8t?H8HvRu,L H HƿDžLH8H臧LHUdH+%(tH]UHHĀH}HuHUHMdH%(HE1HEH@HEHEHEHEHEEEEHEHEHHEHEH@HYuHEH@H@@HuiHEH@HHEк HHHEHHHEPIL-S 'H HƿHMHEHHEHUHEHH9PHEHBuHEH#tEHEHHEHEH@HEHEH@XHEHEH@HHEк HHHEHp@HMHUHEAH*bHEPHE}tEHEHHEHUHEHH9i}tLHEHtHEHu,L% LH Hƿ2HUdH+%(tS UHH@H}؉uHUdH%(HE1EEHEؾ*HstHEHEHEHEH& HHu HEHu4LQ Hx Hƿ+ vHEu4L H2 Hƿ 0HEH+uDHEHKu4LP H Hƿ HEHHu HEH HEؾH HEH}u/L Hr Hƿ% _HEHUHPHEHEHE@HEHEHUȋuHEHH QujAAH2H E}Eu,L H Hƿ9 vHEHLu3L HJ Hƿ E3EALN H Hƿ HUHEHHAEHUdH+%(t UHH H}HuHEILN H HƿP HuHEAHp4HEH}u HEH HEHIL=N HA Hƿ HEHtFHEH0u*Lx H Hƿ HEH'HuHEH>u*L$ H Hƿ1 HEHHEUHH0H}HuHUHEHXHtHEHXHu HEHXHEHX9sHEHEHEHEHHUHMHEHHĉu1LD 6H HƿQUHATSHH(H HdH%(HE1Dž4Dž8H(_HwHILL GH HƿW H(H/HH HH~ Dž88|HH(HHHXHXu4L RHZ Hƿ H H(HH0HPHPlHHtLH(H u*LS TH Hƿ`HXHHH(Hu*L THu HƿHXHL UH< Hƿ H H(HHHPHPu4L_ YH Hƿl: HH(HHHXHXH H/tLH(Hu*L \HV HƿHPHH H(Hu*Lz \H HƿHPHLA ]H HƿN HXHXHHPHXHHXHXHPHX9sHPHXHpHXHXHpHpH%bIL@H jH HƿHpH(Hz2u4L' lH Hƿ4 HPHXH(HHOu/L pHN Hƿ1HXHtHPHpu/Lz uH HƿHXHPH(HHJu/L' xH Hƿ4HXHH@H@HHHH@HXHH;H@HPHH;HPHH(H@H@HYHHHCpHPHH@H@H@@HHSIL H HƿHHH@H@HH@H@H@H HHHH@H@HHHH@HXHH9HPHH`H`H@HEHXHHh0HhH@HEHEHP HEH HHHEH HuAHhH@H@HILD H HƿgHEHH HE@HHZu/L H5 HƿHhH@HPHHHEPIL H HƿyHHhHHhHhHXHH9H`HH`H`HPHH9\HXHH`cH`H@HPHPPH`H@HpPH`HHHFhHVpHHQHFxHHAHQH`HH`H`HXHH9u/HXHHEHPHHEHH57HXHHV7t1HXH@H@ HEHPH@HP HEHH6HXH@H H7t7HXH@H@0HxHPH@HP0HxHH6HXH@H0H6tHPHXHuHXHXHPHXHPHXHPHPHXHPHXHHPHHPHLj; HH HƿHEHHEHEH@H@@HtHEH@HDtS}tNHMHEкHHEu2L OH1 Hƿ&HEHHEHUHEHH9eEUHH H}HuHE@HEHiHEHHEHEH@HEHEH@XHHEHrH@H@%HtDHEHduL fH1 HƿHEH@XH1tTHMHEHHqL lHʾ Hƿ(<HEJH5XtLHEH@X%Hu:HEH@HILP9 qHd HƿHEHrHEHPIL.9 xH HƿpHuHEH4L {Hƽ Hƿ$;HEHHEHUHEHH9HUHEHH^UHH0H}HuHUHMHEHu.HUHuHEHE}uUHH0H}HuHUHMHEH@HEHEHuHE@HEtXHUHEHHu4LӮ H HƿHE@HUHEHH-HUBHEHtHEHu8HEILD7 H Hƿ^UHH`H}uHUdH%(HE1HEEHEgH2UE7:Eԃ}u:}u4L6 Hk Hƿ}u4L6 H1 HƿHEJHTt:}u4L6 H Hƿ@;}uOHEHGTu:}u4L6 H Hƿ}~IHEHSt4Lr6 H> Hƿ}~:}t4Lj6 H Hƿ\WHEHHEHHHEHEmHEH HHVu4L٫ H HƿHEHnHEHpzHEH}u4L`g H, HƿHEHUHP}u:HMHUuHEH=xWuAAHHEHEHQEHE 3HUHEHH wQujAAHѺHH EtJ7tHEIL4 H HƸ|EXEtJ57tHEIL4 Hȷ HƸ+EEEԉ2HUHEHH{EHUdH+%(t*UHH`H}HuHUHMdH%(HE1f)E)EHEHBPuHEHPEHEHEă}}HEHEȃ}t0EAL3 2H¶ HƿUHEHH3 HǸ؇% H HƸHHEHHe[A\]UHH0H}uHUHEUH?WYu4L$ %H Hƿ4;HEHDu4L$ )H6 HƿHEHF\HEH[HEH \HEH>t1L$ 3H HƿoyHU؋uHEHH QjjAAH{H EHEKHD>t&HU؋MHEHEE;E~EEEUHH}HuH}tHEH@PH9Et]UHH}HuHEHHEHEH@H9EuHE HEHHEHEHH9EuѸ]UHH@H}HuHUHMHEH@HEHEHFWHEHEHH9EuHUHEHH$HUHHEHHEHHHEHUHPPHEHpPHMHFhHVpHHQHFxHHAHQH}EHEHUHHHHHȋHEHUHHHHHH@HHEHUHHHHHH@HUHHZHEH}t#HMHUHuHEHuDVHEHUHHHHHH@HUHHHuEHE@L9EUHSH8H}HuHUHMHEH@HEHEHHEHyHEH}tLHEHXHHEH3HSILz! NHM HƿH9HEHX3ILs! PH HƿHEHHEHH~t! VH HƿXWHMHUHuHEHu4HEHXH9EuHEHUHXHEHǀXH]UHHPH}HudH%(HE1HEHHEHEHHEHEH@HEHEH@XH HEH@XH HEH@XHHEH@XH%nHEH@XH$WHEH@XHCHEH@XH,HEH@XH0HEH@XH-HEHEHHEhEAHEHUHHHHHȋHEHUHHHHHH@H@HEH}tZHUHEHHMHEH@HIL H^ HƿUHUHEHHyMt HEHEhHUHEHHXMt HEHEGHEH裐IL Hٞ HƿEHE؋@L9EHEHHEHUHEHH9HEH;Et_HMHUHuHEHuDLߏ HE Hƿ? HEHEHEHHEHEHH9EHUdH+%(tUHH@H}HudH%(HE1EEHEHHEHEHHEHEH@HEHEH@X%H[HEHHE.HEHPpHEHHEHEHPXHEHHEԃ}t }}u}u }tI}uCHEH@pH@HIL HΜ HƿuHEHPpHEHHgtiHEHPXHEHHLtNHMHUHuHEHu2L HH HƿRHEHHEHUHEHH9HEHEHEHHEHEHH9E[HUdH+%(tUHHPH}HudH%(HE1HEHHEHEHHEHEH@HEHEH@XH kHEH@X%HXHEHHEHHpw9HEHMHEEE=HEHUHHHHHHPHEHHtEEHE@L9ErHEHHEHEHHHEHHSMHEHEH@H@HtlEEN}tH(IL .Hш HƿxKHHH0HWH8H8H0Hu>H0IL 6HH HƿH0HH褓u>H0IL ;H Hƿ荺`H0HHHHHeH0ILƇ @Hz Hƿ!H0HtGHH|u*Lx AH* HƿѹuH0HH膒u*Llx AH҆ HƿyL H0HAHHHu>H0ILņ FH] Hƿ DžH(HAH H H H0ILB MHڅ Hƿ聸H0H|tLHHܕu*L$w NH Hƿ1HHеH0HHu*Lv NH- HƿԷHHS H H@HPHHP`HHt9H0ILs VH HƿM HH HHHm8Lu ZHO HƿP H H@HHH|u9DžLu ^H Hƿ虶H0H@H@HMHHHcu9DžL$u cH Hƿ1HUHHHu9DžLt hH7 Hƿ޵8UHHڞHEHH艨teHEHH躩tJUHHt2HUHHH9tUHH謚u/Lt qHl HƿmH H身u/Ls vH* HƿѴ+DžHHHHHHc_HHHHHHH HHu/Ls |H Hƿ*;OHtSHHH HHu/Lr H Hƿ贳HH HH/u/L[r H HƿhHH HHVu/Lr Hu HƿvHH HH~u/Lq H) Hƿв*HH HHdu/Lwq H Hƿ脲HH HHu/L+q H Hƿ8HH HHu/Lp HE HƿFHH HH>u/Lp H~ Hƿ蠱HH HHH#u@H t/L H~ Hƿ<H0HHHHSu/Lo HB~ HƿCH HHHL< H} Hƿ螰HH@`HHHHP`HH HHHgau/Lo H} Hƿ&H H H HHau/Ln H} HƿƯ HHmu/Lwn H| Hƿ脯HHqtHHu/L"n H| Hƿ/HHHH tdH HLqtH HGu/Lm H| Hƿ躮H HӪHH@`HHHHP`HHptHH~u/L,m H{ Hƿ9HHRH LHLt H{ H{ tAUATILp H{ HƸ语HDžH0H蜖tLHHu*LDl Hz HƿQHHH0HHu*Lk HMz HƿHHsH(HtLHH@u*Lk Hy Hƿ蕬H H4H(HHEu*L+k Hy Hƿ8H H跉HUdH+%(tRHe[A\A]]UHH }uERE¾ϺHEH}u,HEHJuHEH脥HEUHHPHHdH%(HE1DžHDžHHHuTDžHHu4Lx 7Hx HƿHHHHHP0HH{HHu9Lx AHnx Hƿ}DžHHH@Hڭ@u?A@L GHx HƿDžu9Lw MHw HƿԩDžWDžHHw HHuHH'HHw HHĨuHH'HHyw HH蓨uJHHHHHH<DžHH)w HH,uCHHLHHHHզt0Dž$HHHhHHBtHHHUdH+%(tpUHHH}HEHvUHH}uHEHEEPHE8]UHHH}HEHUHH H}HEHEHEHtUH]UHh]UHH}Hu]UHHPH}HudH%(HE1HEHEؾ=HŤHu;LHEIL #HBu HƿAHEؾ=HtH+E؉EHEHs HHgHt4L [L )Ht HƿAHEH HHHt}HE/w$HEHPHEHHUJHU HEH@HHHUHJHHEHuHM؋UHEIH5Vt HǸpHgHEHo HH耡Ht}HE/w$HEHPHEHHUJHU HEH@HHHUHJHHEHuHM؋UHEIH5s HǸG]HEHs HHHHE/w$HEHPHEHHUJHU HEH@HHHUHJHHEH}HuHM؋UHEIH51s HǸ1Gy,HUHEH n HHǸ GHEHHUHEHH0tnHEH$HE/w$HEHPHEHHUJHU HEH@HHHUHJHHEH}HEH赝HUdH+%(tUHHHHXH`HhLpLxt )E)M)U)])e)m)u)}dH%(HH1Dž0Dž40HEH8HPH@H0HHH,,HHdH+%(t"UHHPH}HuHUHMDEHEHEHEH@HUHH$QHEH}t"HEH@ HEHEHEHEH@HEH}t&HEtHEH@HUHH蓡uH}t}t sH}u}u \H}tZ}uTH}tHEHPHEHP;HEH@ H9EuHEH@HtHEHPHEHP HEH@ H}}H}HUHEHHZHEH}u HEHPHEHPHEHZHUHB HEH@ Hu{HEH@ HEHUHPHEHUHPHEHdZHEH}u7HEHEHUHPHEHP HEHPHEHUHP UHH}HuHUHEHUHPHEH@H}tBHEH@Ht5H}u.HEH@HE HEH@HEH}t HEH@HuH}tHEH@Hu HEHUHPH}tHEHPHEHPHEHUHP]UHH H}HEH}u6L L^ Hn HƿAѸpHEH膙HUHHMHEHHuBHEHiL %L+^ Hm HƿAѸHEUHH0H}HuHUHMHUHEHHWHEH}u3HEH@ HEH@HUHMHEHH HEUHH@H}HuHUHMLEHMHUHuHEHRHEH}t!HEHWHUHB HEH@ Hu"HEH@ HEH@ HUHPHEUHH@H}HuHUHMLEHMHUHuHEHHEH}t!HEHBWHUHB HEH@ Hu"HEH@ HEH@ HUHPHEUHH`H}HuHUHMHE0HEHEо=H HEH}u@LHEIL Hk HƿAҸ%HEH@HUHH"}HEH}u9L Lfk H&k HƿAѸHEH+EHHEHHEHEH HHԛHE/w$HEHPHEHHUJHU HEH@HHHUHJHHEH}HMHUHuHEIHHEH}HEHf HH4HE/w$HEHPHEHHUJHU HEH@HHHUHJHHEH}HMHUHuHEIHHEH}pHEHi HH蔚HE/w$HEHPHEHHUJHU HEH@HHHUHJHHEHEHHEHH'SHEH}u HEHUHHUHMHEHH=LWHEIL Hh HƿAҸwH}uHEHEH}tHEHEHE/w$HEHPHEHHUJHU HEH@HHHUHJHHEH}{HEUHHHHHHhLpLxt )E)M)U)])e)m)u)}dH%(HH1Dž0Dž40HEH8HPH@H0HHHHH(H(HHdH+%(tCUHEME\E~ mX fTX f/]UHH H}HuEHEHU9s cHEHE9s IHEtt(HEHPHEH@HHsEHE@ZHEHfZfH~f(fHnu%HE@HEH/v EIHEHPHEH@H9t#HEHPHEH@H9~ EA}u8HEH@Ht+HEH@HtHEHPHEH@HHnEEUHH H}HuEHEH@ Ht+HEH@ HtHEHP HEH@ HHEHEH@ HtHEH@ HuEHEH@ HuHEH@ HtEHEH@Ht+HEH@HtHEHPHEH@HH6E}tE}HEH@Ht+HEH@HtHEHPHEH@HHEHEH@HtHEH@HuEHEH@HuHEH@HtEEUHH H}uHEEE;E}EEHEEHEHEHcHEH@HH荗HEH}tHEHUHP9HEH@H/HEH@HE@HEPHEUHH H}HuHEHEHEH@HtHEHE@)9U|EPHEHu;HEHPHE@HHHEHHNHEPEHEPUHH H}HuHEHEHUHEHH1u&HEHb HHuUHHH}HEH@HHEHUHH}HE@HEPHEHEH@]UHHH}HuHE(HHUHMHHBUHHH}HuHE(HHUHMHH/>UHSHH(dH%(HE1f)0fօ@f)P)`Hp HHHHfHfDžpLM0HU(HEHuHQRPIL^ H]a HƿAH 蝐00DH%HHEt Hc{ H1: HMHRH RPIL^ #H` HƿH cHEHpHJlHHM=u;LHEIL (HS` HƿAHpH0nHΉg DHHHEt HYz H'9 HMHRH_ RPIL] .H_ HƿH YLHEIL_ 2Hl_ HƿAHPHHHH0H8HHQH@HAHI_ HƸH PuhH HHPHXHHQH`HhHAHQHeR HHx H|H HH HHGtVPDLPHUHPIL^ 6H^^ HƿAH H HHPHXHHQH`HhHAHQHT^ HH H8H8HtH8HH8H HHPHXHHQH`HhHAHQHM H$H @HE(Ht~H8HtHU(H8HHtXLdH8HuH6 HU(HMPRIL} AH] HƿAHE0tT@E09tGL@E0HMRPILG FH\ HƿAHgH HHPHXHHQH`HhHAHQH H(H0H8HHQH@HA"00tqH+H¸dt Hkv H95 HRHS\ RPL *\ LY PH[ HƿH Dž0HhHt;H HHPHXHHQH`HhHAHQH H8H聆HDž8H(H0H8HHQH@HAHEdH+%(t蛋H(H]UHHPH}dH%(HE1f)E)EEydLիEAL` bHZ HƿAEHMHEHUHHQHEHUHAHQpHE(HU0HEHUHEHuPHE8HHUH HHu/E HMHEHUHHQHEHUHAHQHEHu^L L pHY HƿAE HMHEHUHHQHEHUHAHQEHUH։ u nEЋEHUHH։t"HEHHEHEHuEG )EHUHE0H9t HEHIHMHEHUHHQHEHUHAHQHEdH+%(ttHEUHHE(Ht HE(HHEH]UHHĀH}HuHUdH%(HE1f)EfEHMHuHHVHHQHFHAHUHEH5X HǸtHUHEHH"u'HEHFHEf@HE {HuHHHEHUHHQHEHAHHHEHUHHQHE HAHH0HEHHMHEHUHHQHEHUHAHQHEdH+%(tHEUHHHHH`HhLpLxt )E)M)U)])e)m)u)}dH%(HH1Dž0Dž40HE(H8HPH@HL0HHHHHEHUHHQHE HALH HHHHHQH H(HAHQHHdH+%(tІHUHSHEL(EAL+ HU HƿAҋE}tqH跂H¸dt H%p H. HRH V RPL U LS HvU HƿH HEH菀H]UHSH8H}HudH%(HE1HEHjHEHEHu1L L%E HT HƿAHEH]HUAH5;U HUHHHu1L LD HT HƿAHMHEHUHHQHEHA8HEHtHEHHEHMHEHUHHQHEHAHEdH+%(t誄HEH]UHH@H}dH%(HE1HE HuIHMHuHHVHHQHFHAHE HHE HMH[HE܋EHUdH+%(tUHHHPHXH`HhLpLxt )E)M)U)])e)m)u)}dH%(HH1Dž0Dž40HE(H8HPH@H0HHHHEHUHHQHE HAHH ,,HHdH+%(tUHHE Ht HE HH}]UHH\HPdH%(HE1HP Hu OHPHP@)HcHPHHHP@HH\HΉ4{ddHPPdHPPHP@~xHPHPHP@HHHкH Q HHzu?HP@PHPPHPHPHP@HHWHPHP@)ƒHPHhdu輀hd蚀 t莀t肀HpHhDž`Hh`H``vۋ\P?HHcHp\?HHH HcHpHpAHƿxdHUdH+%(tCUHHLH@dH%(HE1DžPPu H@H>H`DžTEH`@+THcH`HHTHHLHΉ߂\\~\T\~ t~t~HpHhDžXHhXHXXvۋLP?HHcHpL?HHH HcHpHpAH¾v\y/H`@9TPPbHUdH+%(tP~UHHH}HEHƿUHH0H}؉uԋEEEHHEH}tHUHEHH_HEHEHHEH}u HEUԉHEUHHH}HEH RPIL@ HX HƿH HHl{H|=HHHʋH [|=HH HHHHH;rHxHHrtyHG"qnHHt H[ HP HHRH= RPIL> H@ HƿH HHkHt^tNLHHILVA H HƿAH HUdH+%(tpH]UHHH}HuHEHH A HH@ H't)HEHHb HH@ HuHEUHSHHHD@dH%(HE1HPHHHHjIotyH[6o-lHHHt HY Hd HHHRHqU RPIL= HT HƿH Ph%= LHHIL? H HƿAHHHahu HlGn>kHHHt HX Hu HHHRHd RPIL< He HƿH aDOHx@DHH @H H%H H9Lhh  Љh%HH@PDPQRIL H HƿAH HHHgu H liHHHt HHW H HHHRHkc RPIL: H HƿH HUdH+%(tlH]UHSH(H}؉uԉUЋUЋMHE؉HE}u9L :L@, &Hz HƿAѸ}t C@HoE$HEEo΅}u9L L+ 1H HƿAѸ+LjHU؋EPEPILa< 3H HƿAHHEؾ H<$oEEUHH ‹EH H%H HEؾ!H hyzHՋjgHHEt HU H HMHRH; RPIL8 9HԾ HƿH EEhngEH]UHH }Ht=Hu t=t au t=‹t=‹t==v  u@EHt=HH\ HH: Hu H/t=H(t=Hu]EH=\ HH : HZE}t}u&Hs=HHs=}UHH}uutKHs=HuXHus=UHHЋU!Ѕ Fs=u5s=9EUHSH `yqH. heH¸_t HnR H< HRHV8 RPL 9 L5 H/ HƿH H]UHSHH}HEHǸ|dʤĤyzHuPgGdHHEt HQ H HMHRH RPIL#5 Ht HƿH H]UHHH $H dH%(HE1Dž Džt Cu 0ߥHHL7 HHm HǸy4L WL]& H HƿAZp=‹p=‹p==#wQHHHHu4L L% H! HƿAHH"u4L L% H̹ HƿAHHu1L ELK% H HƿAKu6L L HF HƿAѸslL ɅL H HƿA\_u/L L HѸ HƿAѸHUdH+%(tdUHHH}H}t,HEH[_HHEH[HEH+_UHHH}H}t&HE@ HEHW[HEH^UHH H}HEH@HE`HEH@ HEHE苀tHEH@H2HEH@H^HEH@H~^HEHr^HEHEH}uHEH@ HEHP HEHPUHHH}HEH@HEtHEH@PHHEH@PH]HEH@H]HEH@H]HEH@XH]HEH@`H]HEH@hH]HEHH]HEHH]HEHv]UHH0H}HuHUHEH@PHuH}tHEHEH@PHEHE@l=HE@l=H}HEH8HEHHEHuHEAAȉHuM HǸGYyDL L- Hܵ HƿAH}tHEUHH0H}HuUܿ ZHEH}u@L %Lֶ .He HƿAHE}t k=HEH/HEHUHMHEHHcu/L L 8H HƿAHEHS!k=EUHHdH%(HE1HEHEHEHEHEHEHEHEHDžpHDžxHEHEHEHEHEHEH Hhj=t gj=Hp@H&t pu4L `Lf QH HƿAL,bAL SHc HƿA-Hp@Ht9L L WH HƿAѸH/ HhHE@HVLupt HpH/ UtHUH/ PhIL `H{ HƿAHMHUdH+%(tl^UHut*u th=w v]UHHE(tGšv<'h=v E(h= u h=vh=(wEEUHH}HuHUHMLELMHEHEH}u HEH@HEH}u3HEHHEHHEHHEHCHEHHEHHEHPHEHHEHPHEHHEHPHEHHEH@ ]UHH0H}HuHEЋ@HEHHEHEHEHEHEYHEHEHEHx(HEHHHEHPHEH0HEIHtu)HE@HEHHEEHEЋ@9ErUHH0H}uUM܃}FEHcM܋UHEAȉH HǸ&SE}xE;EUHHH}HuHEH@PHu bHE0HRHEH@P@HEHEu HEH@P@HEPHEH@P@HEP HEH@P@HEPHEH@P@HEP HEH@P@%HEP(HEH@P@HEP,HEH@P@HEP$HEH@PPHEPHEH@PP HEPHEH@PH@(H%HEPHEH@PH@(HEH@PH@(H % HEPUHH H}HuHEHEH@PHtHEH@P@u HEH@P@0tHEH@PH0HE`HEH@Ht HEH@HEH@HEH}u6L >zLϯ H~ HƿAѸTHEH@PH@(HEH@PH@(H % HEH@PH@(H%HUHEHщH߁UHH}HEHPPHEH@P@H]UHH}HEHH]UHHH}HEHUHy>t*vu b=%w ^vWQ]UHHpH}HuHUEEHEHHEHEHnHEH}tBHEHHt6HEHEHE@ uEEHEHEȋ@EE}u}t)EHcHHHHHHEHH+EH  HPHEH}u9L !xL' 0Ha HƿAѸHEH袏UHEPHEH@}uHEHEHEH HEЋEHEHEHH%HEЉPHEHHEHH % ЉHEЉPHEHP0HEHPHE@ HEH@(HEHP HEH@HHWHEH H>QHHEHEHP0HEHHvHEHEH@HugE膃HUHBHEH@HuEHEHPL vL OHܩ HƿAѸRHEHEHEHP HEHHHEHEHEЉP HEHHEHEHEHHHEHEHUHP(HEHPHPHEHHSHEHEH@(HUHHUHEHH(HEH@HUHHu6L uL ]HǨ HƿAѸ@HUHEHH.HEHEHE@E}HEHUHUHH0H}HuHUHEHEHEH@Ht;HEH@HUHHHEH}tH}t HEHUHUHH H}HEHHEH}t4HEH@HtHEH@H蟂HEH|NHEHUHH}HEHPPHEH@P@H]UHH}HEHPPHEH@P@H]UHH H}HEH@P@%u HEHPPHEH@P@HHEHEHPPHEH@P@ HHEHEH;EsZLsHEH@P@ HEH@P@HRAL4 H HƿAH[HEH+EHHEHJHu6L sL! HP HƿAѸHEUHH}HE@(]UHH}uUHEUPHHEUPL]UHH}HEǀ]UHH}HEǀ]UHHH}u}wHEU􉐐4L rLu" H^ HƿAѸUHHHXHPdH%(HE1vJlDžhHPHKH=vCLqHPIL! HƤ HƿAҸ lHPH ! HHNu9L *qL0 Hj HƿAѸlHPH KHƋlHpHPAAHHH5;! HNhhyCLpHPIL Hǣ HƿAҸ htkLEplu HQN H HpRPIL H[ HƿAHHpHPHXH@XHIHPHNHHXHPXHXH@XHu@LoHPILA HТ HƿAҸHXǀHUdH+%(tNUHHH}HuHEH@`H1IHEHNHHEHP`HEH@`Hu6L nL H& HƿAѸUHH}HuHEHUHPp]UHH0H}HuHUHMLEHEH@hH}HHEHxhHuHMHUHEIIHHH HƸy6L nL HZ HƿAѸUHH}HE@x]UHH}HE@|]UHH}HEǀ]UHH}HEǀ]UHH}HEǀ]UHH}HEǀ]UHH}HEǀ]UHH}HEǀ]UHH}uHEUP,]UHHH}HcV=Hu !HRV=HKV=Hu6L lL bHǟ HƿAѸHEǀUHH}HEt HU=]UHH0H}HuHUHMHEH!FHv@LkHEIL tH HƿAҸL(HEH}u?LkA(Lڢ yHɞ HƿAҸHEHKJHHEHPHEH@Hu1L ,kL Hl HƿArHEHIHHEHPHEH@Hu1L jLx H HƿAHEHUHHEHUHPHE1HEH@H2HEH@HDHEHDUHHpH}HuHUdH%(HE1HEHEHE(EHEH@H?DHvDLjHEH@IL H7 HƿAҸEHEHHEHEH@HEHEH@HUHJHH7JEHEHEHEH@HEHEHPHU<\uEHEuHEH@HkC‹EЉEHEH;EsEHHPHEHH;Er9L iLӠ HJ HƿAѸ}t_HEH@HEHE<\uHEHPHU\HUHBHEHEHHHMHEuHEHPHU$HEHPHEHHLHEHHHEHEHeHEHEH+EEHUHMHEHH8KHEHUdH+%(tGUHH@H}HuHUEE @HEH}u HEH .tmHEHOHEH}tYHEHHtPEHEHEHH9Eu$HEHH HUHEHHHEHE@E}uHEHEUH}E„u#DHHЃHt]UHH`H}uHE8EHEtKHEH@HE4HE(HEH@H@HUHH HEЃEHEH@ HEH}ucHEH@HtVLPfHEHcHHHHHH0dHIL" Hi HƿAHEƒu&к,HHЃHt HE@HE}tSHEH@pHu HEH@`Ht9L eLӝ !Hژ HƿAѸ# }tFHEH@XHt9L NeL &H HƿAѸ }tFHEH@hHt9L eL +HB HƿAѸ HEH@XHtSHEH@pHu HEH@`Ht9L dLS 0H HƿAѸ+ HEH@XHtFHEH@hHt9L OdL( 5H HƿAѸHEH@hHtSHEH@pHu HEH@`Ht9L cL :H/ HƿAѸxHEH@pHtFHEH@`Hu9L cLŜ ?Hܖ HƿAѸ%HEH@XHtHEH@XH}=HUHHHEHEH@`HtHEH@`HQ=HUHH HEHEH@hHtHEH@hH%=HUHHHEHEH;EsHEHEHeЋEPUuHEHHEH}u [HEHcHHHHH`HH HEHEHEHE@HEPHE@HEPHEЉHEP HE@8HE@4 ]~usHE@8thHE@0K=9tWLaK=HUR0HPAL* fH! HƿAHwK=HEP0HE@04L aL mHԔ HƿAHE@HEPHE@4HHE@0HHH HE@4HH H%H HEHP(J=-HEH@HtHHEH@HHEHHtHHEHHHEH@(HHEHH0HEH@(HHuNLs`HE@4HUR0HPAL xH HƿAHL%`HEHH0HE@4HUR0QPAL |HJ HƿAHHEH@HtHHEH@HtNHEuHE@4x HE@0y-HEH@HuHEH@HUHJ0HH@HEHHtHHEHHt6HEHHu HEHHUHHH?HEuHE@HEPHE@xtOH= w1L ^L H HƿAHE@HEPHE@(tHE@HEPHEtHE@HEPHEt+HEt HEuHE@ HEPHEtMG=w/L ]LO H6 HƿAHE@̀HEPHEtKu/L ]LF Hݐ HƿAHE@HEPHEtRF=w4L B]L; H HƿAHE@@HEPHEtTF=,w4L \L# H" HƿA_HE@ HEPUHEPHEP,HEP HEH8HEHUHEHHEHE:twHEH@HEbHUHMHEHHHEH}u4L #\L) Hc HƿAHEH@ HEH}uHEH@XHtHEHPXHEHH;HEH@`Ht2HEHEHEHPpHEHHEH@`HUHHHp;HEH@hHtHEHPhHEHHL;HEHEHBUHSH8H}EvyHEHEHv5HEH}H[96HHEt H>$ H HMHRH RPIL H HƿH HEHH HH:HEHH{ HH9HEHHr HH9HEHPHEHHDu8EL YL H; HƿAIHEH$ u9EL YL H HƿAHEH =HEH}HEH:tPHVY18(5HUPH( PIL  Hx HƿHEH]UHH0H}EE 1HEH}u HEHu EHEHQHEH}u EaHEHHtTEHEHEHP HEHH,Cu E*HEHuEHE@E}uHEHEUHHH}HEHHEHUHH H}HE苀t$HE@,fEf}tE M UHHH})t#su (A=v sw HE@% UHH0H}dH%(HE1/HEH}uEHEH&L WL MHN HƿAѸHEH@HtOHEHPHEHHAu4L VL RH HƿAQHEHHtRHEHHEHHIu4L KVLQ UH HƿAHE؋P0HEP0HE؋P4HEP4HE؋Pu/L RL H݅ HƿAHEHu/L ^RL H HƿAѸHEHHEH(HUdH+%(t~1UHH}HEH]UHH@H}ȿ *HEH}u9L QLh H HƿAѸHEH@Ht1HEHPHEHH,<uHEH-OHEHHt4HEHHEHHDuHEH HEȋP0HEP0HEȋP4HEP4HEH:E܃}uHEHEHEH@HE HEH@ HEH}t HEH@ HuH}tHEHHEH@HHEHHEH@P@HEȋ@(9HEH@HEHEH@HEHEH@HI*HEHEHPHEHHEHPHUHtHEHPHEH< tHEHHEHH9tqLOHEHxHEHpHEHHEHHE@4LEE@0HWVQRPELh Hǂ HƿAH02HEHPHEH@H9tsL:OHEHxHEHpHEHHHEHPHE@4LEE@0HWVQRPEL H? HƿAH0HEHPHEH@HHC.t`LNHEHHHEHPHE@4Huv0HQRPAL H HƿAH +HEHPHEH@HH-HEȋLNHEHPHE@4HMI0RPAL9 H8 HƿAHLMHEH@ILu H HƿALMHEH@ILM H HƿALLMHEHPHE@4HMI0RPAL Hq HƿAHLLHEH@IL H3 HƿALLHEH@IL H HƿAkHEH@ HEHEH@ HEH}t H}HEP0HEP0HEP4HEP4HEPHq HƿAу}HEm9^HEHEu9HEtHEt HE uHEȋ@HEȉP&=uHE6H=HEIHE@0~ H=? H= HE@0~HE@4u H5 H5 HE@4IAHE@0~ H H HE@0IAHE@0~ H H HELHEL`0HELcLHLHIH :IHAQWVASQARRAUATIL8{ HHGo HƿHP1H;HEIHE@0~ H= H= HE@0~HE@4u H5 H5 HE@4IAHE@0~ H H HE@0IAHE@0~ HU HU HELHEL`0HELcLHLHIH8IHAQWVASQARRAUATILz THn HƿHPHEHE}tT|tKHEHu;L b:Ly mHm HƿAHEH?HEHUH։t)HEtHEHUH։t HEHEHմHe[A\A]A^A_]UHV]UHH}HE]UHATSHPH}dH%(HE1EEHEH@HuHEH@HEHEHHu HEHHEHEvBL'9HEALx H^l HƿAҸHEHcHHHHHH6EHEuHEH@HtHEHNpHEu*H}u#H}uHE@0HEHU;HEuHEtHEHaHEuHEtHEHuEHEHL 7L H9k HƿAѸOEă}0HE!L7HE@0~ L s L HE@0~HE@4u L L HE@4IHE@0~ H= H=h HE@0IAHE@0~ H59 H59 HUHuH) H}t H { H  HEHuH DeHAQAPSWASVRQPELv Hi HƿAHPR =H}MuHEIHHEH}uLEt/HEu$HEtE}w @ HEH)HE@%t}HEƒu<к<HHЃHt ==HEH議,L 5Lv Hh HƿAHEtHE@,%uEHEtHE@, EHEHH HH H>HE}H}rHEc}YMHEDHDHED@@HEP"=L3(1"=ALSi H HƿAҐ]UH!=u1L 'L?i H HƿAG!=!=L'!=AL6i "Hh HƿA]UHi!=]UH}Ec]UHc]UHH }iHEH}u?L 'ALh ;H HƿAҸhuEHEHL &L BH HƿAѸHEUHE@4HE@0HE@8HE@<HE@@HE@DHE@|HE@HHE@LHE@,HEǀHEǀHEǀHEǀHEǀHEǀHEUHSHH $HH(H HdH%(HE1Dž4HAHH8H8HA%HAt H HM HRH RPL `AL gH HƿH H@HHHHHH HH0HHH HHHHHIH@HH HǸhu;L7$HHIL< sH HƿA]HPHHH:u?HxH9(u0HHHH HHfDž4(H8H'H@H@H8HtPHh#C:PH> PL ?L H HƿH4HUdH+%(tH]UHHE}/~}9~2}@~}Z~&}`~}z~EH HHtUHH H}HuU}ucHEH HHoHtHLc"HEHuIL>d H HƿAHUHHPH}HuHUHMLEDMEH}tH}u HEtH}u H}w9L !Lc Hy HƿAѸE}uEHEHED}HUHEH<\utHEHPHEHHUdH+%(tUHH H}HuHE/HHEH}tHEHPHMHEHHHMHEHHUHH}HEH@PH0]UHH@H}HuHUHMDEHEHHDEHMHUHuHEEIHHH@E}y^}tHEH9 HEH+HEH}u/L LX H HƿAHEUHH@H}HuHUHMDEE}uGHEHHDEHMHUHuHEEIHHHRE}y^}tHEHe HEHWHEH}u/L ELX H HƿAHEUHHHXdH%(HE1HXHH`HpH`AȹH56 HHhHhu9LH`ILoV HY HƿAHhHUdH+%(tUHHHXdH%(HE1HXHIH`HpH`AȹH5h HHhHhu9LH`ILV H HƿAHhHUdH+%(tUHH}HEH@PH]UHHHXdH%(HE1HXHH`HpH`AȹH5 HFHhHhu9LH`ILU H HƿAHhHUdH+%(tUHHHXdH%(HE1HXHH` HpH`AȹH5 H?HhHhu9LH`ILYU H HƿAHhHUdH+%(tEUHHHXHPdH%(HE1JlDžhHP/H^HtCLbHPILS H# HƿAҸHPHGHvCL HPILx H HƿAҸPHPu9L L2T H HƿAѸ lHPH  HHu9L ]Lc H( HƿAѸlHPH?HƋlHpHPAAHHH5 HhhyCL HPILSS !H HƿAҸ htkLx lu H H HpRPILS &H HƿAHHpHPHXH@XH!HPHHHXHPXHXH@XHu@L HPILR .H HƿAҸHXǀHUdH+%(tUHHHXHPdH%(HE1lDžhHXHH1HXHǀHXHH HXHǀlHPH S HHu9L L CHx HƿAѸlHPHHƋlHpHPAAHHH5» HhhyCL HPIL3P HHռ HƿAҸUhL lu H H@ HpRPILP MHe HƿAHHpH_HHXHHXHHu@L4 HpILcP RH HƿAҸxHPHHHXHHXHHu@L HPILO XH HƿAҸHUdH+%(tUHH}uHEUP0HE@8]UHH}uHEUP4]UHH}uUMHEUP0HEUP4HEUP8]UHH}uHEUP<]UHH}uHEUP@]UHH}uHEUPD]UHH}HEǀ]UHH@H}HuHUHMLEHMHUHuHEHHEH}u6L L# H HƿAѸLHEH@HuHEHUHP HEHP HEHPHEH@ HUHP HEHUHP UHSH(H}uHUHU؋MHEHtSHhC:HUHPILM H HƿHH]UH#=u===]UHSH(H}؉udH%(HE1HE H}HUMHE؉Hu9L yL HD HƿAѸ7L@HEHUHPILL H HƿAH/L LL HƷ HƿAHEHHHHEHuH) t H H HEHuH HQH QRILN H* HƿH HEHHEHHUdH+%(t|H]UHSH(H}؉udH%(HE1HE WHUMHE؉Hu9L L Hc HƿAѸL_HEHUHPIL(K H HƿAHHUHEHH_HHHEt H/ H HMHRHl RPIL H{ HƿH HEH HEHHUdH+%(tH]UH]UHH}}tEtjFtUHSHH $HH840,D(D$dH%(HE104HH ‹0H H%H HHH8HH&u9L _Le H* HƿAѸHPHHHdh%=`tCLHILH H HƿAҸHxH9Hu kHHnLH8ILH (H@ HƿAҸEt9L.HILH -H HƿAH`HD$`HHHHtwHulHP8IL7 5HF HƿHDSRD-,(,HHy}HHt H$ H HHRH RPIL >Hm HƿH >LiHIL= BH* HƿAҸHUdH+%(tH]UHHH $HHXTdH%(HE1HXHHu9L L MH HƿAѸH`HHHpy Tt9LJHILE QH HƿAHHyLt@LHXIL!E VH HƿAҸ>LHIL ZHs HƿAҸHUdH+%(tUHSHH $HH $HhHHdH%(HE1HHHtHHHu9L Lۛ iH HƿAѸHPHHHGh%=HHHHuHHH5Ht Hs HA HHRHN RPIL pH HƿH HPHH@%=`tCLHILB wHR HƿAҸ9 HPHHH'yu LHHHPILB H HƿAHHHHH|ou bLwHILA H8 HƿAҸtIL#HHHPILvB Hث HƿAHHHHHyZtNLHHIL~B Hh HƿAHNLcHHHPILA H HƿAHHUdH+%(tH]UHSHH $H8HdH%(HE1DžHHHju HHǸqyvHkF=Ht H Hw HHRH RPIL H HƿH HUdH+%(tbH]UHSHhH}uUHMdH%(HE1EHE#i}_UEAAH#HH@ H¾H^<HǸvwy9L FLK H HƿAѸH<HǸE}nHMЋEHΉ#Eă}|HH<t H H~ HRH5 RPL <Lq HM HƿH EmEHDHEHXHEL'HEHUHPEPEPIL. Hا HƿAH EtPHPH PL <L Hy HƿHE:HtOFPH< PL V<L) H! HƿHHEu9L LR> H HƿAѸHEHE}y9L Lѓ H HƿAѸXHUȋEcǸaHrMDHHEt H H~| HMHRH{ RPIL H HƿH HEEQHEȉHELHEHUHPIL H HƿAHEhtPHh_HUPHѢ PILB H: HƿHEHUdH+%(tH]UHSHhH}uUMdH%(HE1EEHELHUHEPEPEPIL3< H HƿAH j}`UEAAHHH; H¾Ha<HǸyry9L ILN H HƿAѸsEHEЉH. HǸrE}y9L L: &H HƿAѸH<HǸ~Eă}EHcHMЋEHΉ*H‹EHH9}zHV1(H><t H Hby HRH# RPL <L ,H HƿH EEĉtPHPH PL <L 1H{ HƿHEHvQHPH> PL X<L+ 6H# HƿHHEu9L LT9 ;H HƿAѸEHEHEă}y9L Lӎ @H HƿAѸHUȋEľbǸctzHxSJHHEt H Hw HMHRH RPIL& CH HƿH EEĉtPHHUPH4 PIL HH HƿHEHUdH+%(tH]UHH0H}uUMDEdH%(HE1}u }uEE؃HMUuHEHAu6L L [Hݟ HƿAѸfE;ErILEHMURPILN7 ^H HƿAHM܋UuHEHVHUdH+%(tUHH }HuUMDEDM}t~}}tV}}t}t-sDMDEMUuHEH}0WHHMU0HEH:U0HMHEHH_"}(M UuHEAHUHSH(H}HuHUHEHHUHH_HEHHEHHEHHEHH{HHHEHH]UHHH}HEpHH<HHH< HEHHEHUH}E,E;Et EHH<tE}vθ]UHH H}HuHE@Lt H Hs HEHE@Ht Hܞ Hus HEHE@?t tyrLHEx0HEp,HEH(HEP$HE@ LEM@uuWVQRPuML~4 H HƿAH@LHEH@HuuuIL H8 HƿAH L5HEH@HUHR@uuPuILʝ H HƿAH \LHEP8HE@4HMHIHuuRPuIL3 H HƿAH0UHSHh}HuUMDEDMHEHEdH%(HE1HEHvHHEHgHHHE؃}E@HHEHEHHEfHEHEHEHPHEHHiu0HEHH H4HEH~Et%HEHEHEHHEHH9EuKE}~<HkHEHEHHEjHEHEHE@uCHEHPHEHHu(HEHH HzHEHHEHEHEHHEHH9Eu}uHHEHEHHEXHEHEHEHPHEHH!u"HEHHU HHEH6HEHEHEHHEHaH9Eu}uE8E0HEHPH西HEH}u9L L,1 Hޘ HƿAѸHEHPHEHEUPHEUP HEUP$HEUP(HEUP,HEUP0HEU P4HEU(P8HEU8PL}8uE0HUBHHEHHHUHEHHHEHH@HUHEHHEHH,<HEHH< HEHHHHEHH HJHUdH+%(tH HƿH HEHHEHEH9Es1L LF" EHh HƿA:H}t HEHPHEHHUHEHH0EH}HEH¶tsHHHEt HU H#^ HMHRHހ RPILł NH HƿH HEH迯HEH賯EH]UHSH8H}ȉuĉUdH%(HE1HEH0 HH>HEH}u HMHUHEH5  HǸyuE9EuE9EuEHEH艵tsH蹳谰HHEt H H\ HMHRH RPIL dHh HƿH EHUdH+%(t۳H]UHSHH $H HHdH%(HE1Dž_t.HHMHH4 HǸSy9L Lˆ tH HƿAѸHHH H 1HiD;Ht H Hu[ HHRH RPIL yH HƿH JH(HH0H0HEx HHUzH0HZ HH4YH0HIHHH4 HǸR>LRH0IL H HƿA HHtt+HH0HHH]HƄHPHHH[h%=@FHH֫H8H8HZ5,HPH! PIL | H HƿHH@HHHHHH^v HHnHHHX HHMHHH HH,HHHx HH HHH HHHHH HHɯaHHHs HH訯@HHH HH臯HHH@ HHfHHH7t HHEHHHr{ HH$HHHX HHHHHà HHzHHH HHYHHHE HH蠮8HHH%s HHHHHO HH^HHH4 HH=HHH0HIIHHH HǸNuIL[H0HHIL  H HƿAHJ HHrt)HHHHHHY%H8HPH@H@H8HtYHlcH0PH` PILCx H; HƿHu$H H跰H(H("H H胮tSHӫʨHPHǒ PILw H~ HƿHHUdH+%(tH]UHSHX}uHUHMHEEؤHEH}täHEH}u4L 1L* H} HƿAVMUHEAAHMHHx HǸKy4L L H} HƿAHMHEкHHqHEH}MtxH_:1HHEt H HkS HMHRH RPIL x H| HƿH @H©蹦HUPHV PILu H| HƿHHMHUuE4EHUHEHHEȾ/HbHEH}u8LPHEIL H| HƿAqHEHEH+EHUH)HBHEHEH9Es1L L H{ HƿAHUHEHH襩EHEH£HEH趣EH]UHH }uUHMLEuxEW?tU}uOHMHUuEtDL #L)h Hz HƿAHMHUuEZUHSHH $HLHdH%(HE1u HLHAAHHH} HǸHy9L QL" Hz HƿAѸHPHHHVtfݦtSHʦHPH* PILr &Hy HƿHHHVHUdH+%(tH]UHSHH $HH(dH%(HE1Dž<HHHH{ HǸ*Gy9L L 6Hx HƿAѸoHHH@H@tSHlcHPHX PILCq <H;x HƿHHHHHk HH讥,HHHH&N HH艥HHHHH(HIIH+HHz HǸEy4L Lu FHow HƿAHPHHH讟uDž<&tVH8 HPHs PILo PHv HƿH%H@HjHHHHH@H6tSH膣}H(PHz PIL]o VHUv HƿHttt]UHH}Et1L Lq L Hn HƿA/L ڼLq N Hn HƿAѐUH!]UHSH}HuE=M tKLwUHEPAL Y H4n HƿAHE_HUHEx t tKLUHEPAL e Hm HƿAHLUHEPAL k H_m HƿAHLH_:1UPEPAL q Hm HƿHH]UHSH8}̉udH%(HE1fEfEfEHMEȺHΉ蕛yUH蕙茖UPEPAL Hll HƿHEȺ ǸE܃}yRHCUPEPALk Hk HƿHFLŰEPEPAL\  Hk HƿAHHUdH+%(tH]UHSH8}̉udH%(HE1fEfEfEEȺ Ǹ E܃}yUH; UPEPALc Hj HƿH HMEȺHΉ觙誗 uCLUHEPALW Hyj HƿAHLHyTKUPEPALq H+j HƿHIL&E܃UPEPAL  Hi HƿAHHUdH+%(tPH]UHSH}uEǸYyRHi`UPEPAL H@i HƿHFL<UHEPAL  Hh HƿAHH]UHSHHH}HudH%(HE1HM HǸ誒Eԃ}yCL LK Huh HƿAHEHM΋EԺHΉ討Ht4L KL, Hh HƿAE M EEfEغ.EЃ}輔tN} tusfEL L Hg HƿAYL L HKg HƿA%HL'IL Hg HƿEfLUHEPAL  Hf HƿAHEHUEHѺǸZy_HjaUHPALi HAf HƿHUЋE؉։r Eк ǸސE܃}yPHUPEPAL6  He HƿHLU؋EPEPAL)  H{e HƿAHEԉJt/L oLuR  H:e HƿAHEUЉHEU؉LEԉt/L LR  Hd HƿAHEHUdH+%(tNH]UHH H}dH%(HE1$uHEHUHEHHHUdH+%(tUH}}EHH'F HHF H>Hcg H^g H c HMg H~ Hc |H7g sH3g jHb aH | XHҫ OHd FH g =H g 4Hg +Hg "Hg H g H g HS ]UHAWAVAUATSHH}HufEdH%(HE1UHEHu"HEHEǀHEtLHEHUH։;uL ϰLO h Hb HƿAHUHEHHu4L LO j HOb HƿA`UHE։6uLL:HEHUHPAL7 m Ha HƿAHHEP,HE HEP,HEǀHǯHHEEEfy L5Le L57 E%@t L=LD; MHR HƿAѸILHEЋAL@QH~R HƿA HUdH+%(t2{UHHĀH}uHUMdH%(HE1E 9O‰EHEH}u rEEHD EE;E|EHDHEH@ HtHEH@ @t HC# H># HEHEH@ HtHEH@ @tEHEH@Ht4HEH@HHt$HEH@LHEHPHMHEHHAHEH8u9L |L9 qHP HƿAѸ^HEH#H&xHu6HEH"H xHuHEH!HwHHEHHdHHPHHоHHkHHHH)H9tHH$HH)HHt%HHHHHHHHEHE"HEHHUHHH#HEHfsHUHкH }% HH8|H}u HEHHEHUH}HH!r HƸu9L ژL7 xHYO HƿAѸHEHEH@ HHEH HHǸu9L iLo7 |HN HƿAѸKHUHEHHu9L L7 ~HN HƿAѸEHHEH@HUHu9L L6 H HƿAѸHE؋@uHEؾH LHE؋@(HUHJHUHH)HQHPILiH>> HƿAH&HEؾH& ubLmHE؋@(HUHJHUHH)HQHPIL1kH= HƿAHHEHHEHP@HEHHEH}u6L L% nHd= HƿAѸSHEH@ Ht6LHEILpH= HƿAHEHUHP HEUHH0H}HEHEHE؋@bHEؾHZLHE؋@(HUHJHUHH)HQHPIL}Hk< HƿAH8HEH.HEH}u9L L$ H< HƿAѸH}u HEHE HEHUHPHEHEHE؋@ uwHEؾ HubLHE؋@(HUHJHUHH)HQHPILHs; HƿAH@HE؋@ HEؾ HKubLHE؋@(HUHJHUHH)HQHPILVH: HƿAHH}HEH@0H HEH}u6L L: H: HƿAѸ]HEMHEHGHEH}u6L L" H0: HƿAѸHEUHH H}HEH@0H HEH}u9L JL9: H9 HƿAѸHE@DHH/ HH# H>HEaHEH@HfaHUHBaza"u}HEH@@HtpHEH@@HHl HauRHEH@[HE@HHHUJHujL @LH8 HƿA9L L9 H8 HƿAѸHEHz_LHE@(HUHJHUHH)HQHPILH8 HƿAHHE3`HEH@HdZHE@`t9L L@8 H7 HƿAѸHEHlLǀHE@(HUHJHUHH)HQHPILH!7 HƿAHHEHEHHUHBHEH@Hu9L :L@ H6 HƿAѸHEHLHE@(HUHJHUHH)HQHPILHB6 HƿAH9HEHEH HUHBHEH@Hu9L [La H5 HƿAѸHEHL HE@(HUHJHUHH)HQHPILHc5 HƿAHZHEHEHHEH}u9L ~L H5 HƿAѸHEH1 HEHUHPHEHL~HE@(HUHJHUHH)HQHPILHv4 HƿAHpL}HE@(HUHJHUHH)HQHPILH4 HƿAH HEUHHH}uHE@9EtUHEHUHH H}uEHEHP HEHPHEH>HEHPHEH@H9tHEH@uHE@ }t }t} uEHE@HEH@ HEHE"[HH HH H>HE@HE~HE@HEiHE@HETHE@ HE?HE@ HE*HE@HEHE@HE9HE<\u)HEHPHEH@H9tHEHtHEHEHEH@H9EtHEt HE<"uHEH@H9EHE~HEtHE@HEHEHEH@H9EtHEt HE<'uHEH@H9E*HEHEHE@}tkK;UHHEHHH%u#HE<.u0HE@t$HE@HEHEH@H9EuHE@ HEHEH@H9Et_HEtTTHHEHHH% u,HE<#t!HE<=tHE<{t HE<}u}tHE@HEHUHP UHHH}HEH@ <#uOHEH@ HPHEHP HEHP HEH@H9HEH@ < twHEH@ ufSHHEH@ HHH% 4HEH@ < uHE@(PHEP(HEH@ HPHEHP HEHP HEH@H9t,=SHHEH@ HHH% uHEHP HEHPHEHPHEH@H9UHHH}HE H9UHHH}HE0Hh9UHH0H}HuHUHEH+EHEHEHPHEHH0HEH}u6L wL/ HC. HƿAѸ)HUHMHEHHZHUHEHHEUHHH}HEHP HEHHHEH@0HH&UHHPH}HudH%(HE1f)E)E)EHEHEHUHEHƿHUdH+%(tLVUHH H}HuHEHEHE3HEHHUHHYHEH}tHEHEH@HEH}uƸUHH@H}HuHUHMDEHUHEHMHHHEH}HEH@ HHEH@ u*}uHEH@ H@tHEH@ H@HEH@ u }u=H}t6LuHEILH+, HƿAH}tALvuHEHuILH+ HƿAHHEUHH H}HuHUHMHUHEAH5HUHH H}HuHUHMHUHEAH5H_UHH0H}HuHUHMHUHEHMHHHEH}t)HEH@ HtHEH@ uHEH@ H@ELUtHEHuILH* HƿAHHEUHH0H}HuHUEHUHEHMHHHEH}t+HEH@ HtHEH@ uHEH@ @NLsfZMfH~HUfHnIL>H * HƿAEUHH H}HuE5EHHHEHHHEHHJu%EEHHHEHHHuUHHpH}udH%(HE1HT HEHR HEH- HEH* HEHEH HEHH HEH, HEH) HEHEHUHEHHt!HUHEHHtEHUdH+%(tQUHH@H}HuHUȉMHUHEHMHHHEH}tSHEH@ HEHEtt7HEH@HEEcHEH@UĉHEEFLuqHUHEPILG=H' HƿAHEUHHH}HuHUHEHHUHH H}HuUEHcHUHEH5HUHH H}HuHUHMHUHEH5vHUHH H}HuEMHUHEfnH =HHRUHH H}HuUMHUHEH5H*UHHH}H}u=HEtt '%HEH@HUHHH}HuHUHEHHUHH H}HuHUHMHUHEAH5HUHH H}HuHUHMHUHEAH5vHUHH H}HuUEHcHUHEH5@HBUHH H}HuHUHMHUHEH5 H UHH H}HuEMHUHEfnH HH|UHH H}HuUMHUHEH5HTUHH0H}HuHUHUHEHHHEH}tHEH@ HtHEH@ t H}tHEH@ H@HE؉UHH0H}HuHUHUHEHHHEH}tHEH@ HtHEH@ t"H}tHEH@ H@HHEHUHH0H}HuHUHUHEHHHEH}tHEH@ HtHEH@ tH}tHEH@ HPHEHUHH0H}HuHUHUHEHHHEH}t HEH@ HuH}tHEHP HEHUHH0H}HuHUHUHEHH%HEH}t HEH@ HtH}t HEHUHUHHH}HuHUHEHHHUH}}t}t { }]UHH H}uUEEUMHEHHUHH}HEH@Ht HEH@HH ]UHH H}uMHEHmEMHEHTE}t}tE;EuUHH H}HuHEHzHEH}u9L jL(" 5H>! HƿAѸHEHEHEueHEHPHEHH*HUHBHEH@HuIL CjLT<H HƿAѸHEHUHRHPHEH@HtbHEHPHEHHHUHBHEH@Hu6L iL CH@ HƿAѸHEUHH0H}HuUH}u9L giLMH HƿAѸHEHHEH}u9L iL RH HƿAѸsHEHHtbHEHHEHH-)HUHHEHHu9L hLWH( HƿAѸHEP(HEP(HEH@ Ht0HEHP HEHHTHUHB HEH@ HHEH@Ht1HEHHHEHHwHUHBHEH@HtB}trHEH@HteHEHHUHEHH5HUHBHEH@Hu6L gL `H$ HƿAѸHEUHH H}HuUHEH@UHMHHUHH H}HuHEH@HHEH}u6L gL oH HƿAѸ|HEH@HUHH+'HUHHEHHu6L fL(sH& HƿAѸHEH@HEH@ HEUHHH}HEH@HUHH}uH}t HEUP]UHH}H}uHE@]UHH}HEH@]UHHpH}HuHUdH%(HE1HEHEHEHHEHEH@HUHuH@HEH}u6L qeLw H HƿAѸvHEHP HEH@HH6HUHB HEH@ Hu6L eL H HƿAѸHUHEHHUdH+%(t8DUHH0H}HuHUHMdH%(HE1HE$HEHHUHEH5J HǸ(y9L PdLV H HƿAѸHEH@HtQHEHpHEHMHUH?uL cL Hi HƿAxHEHUHMLEHHAЅu1L cL H HƿA*HEH=HEH@HEH}HEH\=HUdH+%(tBUHH0H}CHEHEHEH}L bL He HƿAѸaHEHE HEH@HEHEH@H9EuHEHHUHHHH HHEHEHEH;EuHEUHH}HuHEH@HEHENHEH;Eu0H}tHEHPHEHPHEHPHEHP HEHEHEH@HEH}u]UH}E%UUUU‹E%UUUUЉEE%3333‹E%3333ЉEE%‹E%ЉEE%‹E%ЉEEU]UHHH< HHEH}tHEHm"HEH}uLL aL gH HƿAH}t HEH,>HEHUHPHEH`HdxHEHpHTxHEǀHEǀ HEHUHHEHǀ=mHUHBHEH@HuEL 9`L3 vH HƿAHEHHcxlHUHBHEH@HuUL _L~|H HƿAHEH@HmHEHHHEUHHH}H}t1HEH@HmHEH@HmHEHHUHH}uHEHU]UHH}HEH]UHH}HEHǀ]UHH}HEHǀ ]UHH}HEHǀ]UHH}HuHEH@HHE HEH@H9Eu!HEHHEHUHEHHH9uϸ]UHH H}HuHEHHHHEH}u6L ^L H HƿAѸ$HEHUHPHUHEHHuUHHH}HuHUHEHHtIHEHPHHEHH%u'HEHPXHEHHuUHH H}HuHEHHE'HEH@H9EuHEHuHEHHEHEH9EuϐUHHH}HuHUHEHHt0HEHPHHEHHhHEHPXHEHHQUHHH}HEHHPHEHHUHHH}HEHHPHEHHLUHHH}HEHHPHEHHLUHHH}HEHHPHEHHUHHH}HuHEHHH9EuHEHG tXHEH-HEHHH9EuHEH tHEHMHUHEHHUHSHXH}HuHUHMLEDfEdH%(HE1HEHH=HEH}tVHEHHUHH1HUHBHEH@Ht+HEHHUHHHUHBHEH@Hu9L ZLIHK HƿAѸHEHUHHEHUH HZHHHX HJHZHH(HX0HJ HZ(HH8HX@HEHUHPxHEUfPpHEHHHqHEHXHqHEHHqHE@HE@HH HE@H H%H HEHEH@HUHuHѺHOiuOL aYLR.H, HƿAHEHHUHHHEHEH@HUHMHHLjuhL XL4H HƿAHEH@HMغHHNiHEHHUHH)HEHUdH+%(t7H]UHH H}uUdH%(HE1EUHH ‹EH H%H HEHEH@HMHHgHUdH+%(tl7UHH}HuHEHUH]UHHH(H dH%(HE1Dž<H(HH@H(H@H HHhHHHHtELHWH ILp XH  HƿAHHkvHPHPH1HXH@KH -H1H`H`"H`HPHhHH6tH HpHH7H`H+ ƄpH(H@HpHHZgHHHHLVHpHhILFhH HƿAHHH.LTH ILuxH HƿAҸHUdH+%(t 4UHHH}HEp4HEH0HEH@Ht HEH@H HUHHAAHH H¾By9L TLH HƿAHEH@ HEHHUHAUATSHH}؉fEHE@pf9EtVHSDmHE@pDHEHAUATILFHH HƿHHEUfPpHe[A\A]]UHH}uUHEU􉐌HEU]UHH}HuHEHUH]UHH}HE@t HEH@H ]UHH}HE@t HEH@H ]UHH}HEH]UHH}HEH@x]UHH}HE]UHHH}u}t7HEHHPHEHHtGHEHXHl5HEHHPHEHHNtHEHHH]lUHH0H}HuHU*qHEHEH+HEH}u HUHMHEHH)u H}wyHUHMHEHH)uWHUHMHEHH)t5HEH+EHHMHEHHEHH\)uUHH@H}؉uHUHM}t6HEHHPHEHHt VHEHXHE4HEHHPHEHHt  HEHHHEHEHHEHEH@HpHEH}u4L PL#H HƿAHUHMHEHHtxHEH@HH9EtfHEH@HHEH}u6L OL Hi HƿAѸ4HE@u "HEHHEHEH9EUHHH}uU}u}u HEHUMHEHUHHH}HuH}t HEu HEHHUHEHHUHH0H}HuUHEHE}tHEHXHE HEHHHEHEHHuHEHhHUHHEHHEHHhHUHHEHHt HEHH@UHH0H}HuUMLELMHE0H]$HEH HHEH HHE HEuHEUPHEUPH&HUHHEHHu9L fMLlWH1 HƿAѸUHEHHCtUHEHHCuFLLUHEPALZH HƿAH}tYHEHHuFLLUHEPAL`H[ HƿAHHEHHuFLELUHEPALfH HƿAH`HEHHUHHuFLKUHEPALXlH HƿAHHEHE@9EtJLKHE@UHPALsH> HƿAHHE@9EtGL/KHE@UHPALxH HƿAHIHEHH6HUHHEHHO9HUHHEHHHU HHEHHsHEHUHH@}uUHMLELME#HEH}u9L AJLGH  HƿAѸUHEH@tUHEH@u4L ILH HƿA}u?HEHu/L IL-'H_ HƿAHEHu4L UIL[H  HƿA$HUHEHHu4L ILH HƿAH}tbHEH3HHEHH" HUHHEHHu1L HL Hi HƿApH}tbHEH6HHEHHHUHHEHHu1L 5HL H HƿAEHEHEUHH H}HuHEu yfu"HE@u HA HEWHEPHE@։~t H HE/HEPHE@։耄t H HEVL?GHEPHE@HMHuRPIL H HƿAH UHHĀH}HuHUdH%(HE1HEH@XHEHEH@HHEH}u4L FLH_ HƿARHUHMHEHH/HEH@HHEH}u9L &FL,H HƿAѸHEpHE@HUHjAAHѺLbHc HƿAEEȅEЅHEHUHMHHTHXHHU܋uHEAAHuDL=U܋EHMRPILϛmH HƿAHEąthHE9hH}t HEHJHEHt HEH5lHUdH+%(tUHHĀH}HuHUMDEDMU HEHEfEdH%(HE1f)E)E)EH}tH}u9L <LH HƿAѸ&HUHEHHHEH}H}HMHUHuHEAIH)HEH}u9L J<LPH HƿAѸHEHtHEHu9L ;LH HƿAѸBHEUHEUHEHPHEHHtjHEHHUHHHUHHEHHu9L M;L H HƿAѸ}HEHEǀHEǀ}tLUHEHu6L :LH HƿAѸHEHUHPxHEUfPpHEHUdH+%(tUHH0H}HuHUMDEDMDMDEMHUHuHEHju}WHH UHHH}Hu|xDDpftdH%(HE1HEHEHEHEHEEx|HEH!HEH}HEH0LMLEx|HEHH}WH}WjH+H u9L 19L7H HƿAѸUtHUHuHMHEAAHHEH}u4L 8LH HƿAEHEpPl.pu%HE@ltHEtfPpHE@lHUHEHHsu}0HE@tHEHt HEuPHEHL 7LH HƿAHEEtHEUHDHEUHDH % HEUHDH%HuHEAAHHu9HEL 7L H HƿAEHE9ELHEHt HEH芲HEHUdH+%(tUHHH}uUHEHpMUHEAAHFHUHH H}uUfE}HEHpMUHEAAHHUHH@H}HuU܉MLEDfEEL5HUHuEPEPIL~ H HƿAH HHEH}u@Ln5HEILH2 HƿAҸHUHEHHu;L5HEILH HƿAHUHEHH %u1L 4LH HƿAlHEHu/L 4LHO HƿAUHMHEHHۂtHEHEHEHEUHH@H}uUMDELMЋEfEEL3HUEPEPIL 2H HƿAHk HEH}u@L3HEIL35HU HƿAҸ:HUHEHHu;L:3HEIL;H HƿAUHEH)tUHEH)u;L2HEILϑ@H HƿAtHEHu/L 2L#EHU HƿAыU؋MHEH葿u/L C2LtHH HƿAUHMHEHH蚀u4L 1LKH HƿAHEHE}u1L 1LNH{ HƿAY} t| HUHEHHE}u1L X1L^TH# HƿAHEHEUHH0H}uUMDELMEL0}t H H }t H H HMRPEPEPIL bH{ HƿAH B HEH}u@Lh0HEILhH, HƿAҸpUHEH&tUHEH&u;L/HEILxmH HƿAHEHu/L /LL rH~ HƿAу}t?HEHu/L n/LuH9 HƿAу}t?HEHPu/L )/L xH HƿAHEHTE}tHUHEHHmEHEH螪EUHH }u iHEH}u9L .LHZ HƿAѸUHEH$tUHEH$u4L ,.Lf H HƿAHEHu/L -LH HƿAHEHu1L -LHt HƿAHEHEHIUHATSHPH}HudH%(HE1EHEHEHEP4HE@0։UHEH}u9L -LH HƿAѸSH}HuHMHUHEIIHgHEHtHEH3 HH t\L%},H]HuH HEHHSILH$ HƿAHHEHUHHhu1L ,LH HƿAVH+LeHEH@HUHATPILH HƿHEHEHZEHUdH+%(t He[A\]UHATSHPH}HudH%(HE1EHEHEHEP4HE@0։MHEH}u9L *LH HƿAѸ?H}HuHMHUHEIIH_HEHtHEH HH t\L%u*H]HuH HEHHSILH HƿAHL*HEILq H HƿAHEHUHƿ,t1L )LH HƿAEHEHfEHUdH+%(tHe[A\]UHH0}uUHMEHEH}u9L .)L4H HƿAѸUHEH~tUHEHu4L (LH HƿAHUHEHHVu1L (LHK HƿA\HEU䉐HEHu8L2(HEILH HƿAEHEHʣEUHATSHpH}HudH%(HE1HEHHEHE3HH' HH H>HEH HEPHEAȉH @HǸzEHEPHEH @HǸLEHEPHEH @HǸEHEHHHEHPHEIHHx @HǸEKHEHq @HǸE)HEHe @HǸ蟦EE}y9L a&L1 (H, HƿAѸyHEP(HEp4HE@0HMLHEH%HED`HEHDHATILՆ7H HƿHL%HE@ALن?HS HƿALY%HE@ALAH HƿAL %L!CH HƿAѸ;L $LHH HƿAѸHUdH+%(t"He[A\]UHSHH}HEHH=tDHk$HEHILD SH' HƿӸHEHH>H]UHAVAUATSHĀHxHpldH%(HE1HUHxHHdu9L #LdH HƿAѸHpHPH<EHUHpH`H9uoHxǀ}tNH8#LeHxHHATIL]jH HƿHHEHPHpH`H9toH"HpH`EHH)ILeHxHAUATILrH] HƿHS}t lu :EȃuEuEȃL5"Eȃt L- L-9 Et L% L%" Eȃt H H HxH7HAUATSILm{H HƿAH tHpHPHE-HUHxHHhu9L F!LLH HƿAѸ HE@HUHxHHu9L LH HƿAѸHUHEH@ H9t[H HELh LeHxHAUATIL`HB HƿH;HEHHEHUHpHPH9HxǀHUdH+%(tvHe[A\A]A^]UHH@HHdH%(HE1DžDžDžHHHH"u9L uL{H@ HƿAѸHtHE@u"DžHE@t DžHtHE@u"DžHE@t DžLHEPHE@HRRPALɁHc HƿAH t{Ht H H Hr4Hz0Hu4L LH HƿAtxHt H5 H9 Hr4Hz0H2u1L LH\ HƿA DžHEHHnHEHbHUdH+%(tUHH0H}HuHU؉MHE@t HE@ u @HEH HEH}u9L LӻH HƿAѸHUHMHEHHu@LyHEIL H= HƿAҸHEHHEH}u6L "L(H HƿAѸHHE@ tt0UHMHEHHUHMHEHHUHHH}HuHxtdH%(HE1EHEHEHEHEHHEH}u4L <LBH HƿAhHEHHEH}u4L LH HƿAHEHHEH}u4L LHq HƿAHxHMHEHHHEpHE@HUHjAAHѺHu9L LH HƿAѸfE'EЅttHEHX HHHHEHuNLU܋EHMRPIL|HI HƿAHEHUHEHH@u;L (L.'H HƿAEMHEHHHEHHxHMHHu[tLU܋EHMRPIL|4Hc HƿAHEHEHHt"HxHMHEHHHEHDHE@pHEHHU܋uHEEAHuNLU܋EHMRPILv{CH HƿAHEEąt EȅtHEHHtWHEHHEHHEHхu/L KLQOH HƿAHEHtgtHHxHuHEHEuCL LXH HƿAѸ7 HMHEHHHEH}&EHUdH+%(tUHH H}HuHUHUHuHEHUHSHHHH@H8dH%(HE1DžTHDžXHHH`H`H4HpHpu4L LtH| HƿAHH`HHxHxu4L ]LcyH( HƿAH`HbHhHhu4L L~H HƿAH8H@HhHHqH8H@H`HJHppHp@HUHjAAHѺHu9L BLHH HƿAѸSEEH`TH8H@H`HTTu4L LHj HƿA6HkH`HӾIL"wH$ HƿH`PH`H`H H`HŰuLEHxMAHuQLŰEHxRPILQ H HƿAHDžT@H`HMH]HHHX HMH]HH(HX0HMH]HH8HX@HHHXHHlH`H`1HDžXH`H`HHhHhu4L LðH HƿAH8H@HhHH覿tuH`Ht^H8H@H`HHu:L )L/H HƿAѸ=HHHXHH&H`H`THUdH+%(t)H]UHHPH}HuHUdH%(HE1HEHEHHEHEH}L HLNH HƿAѸHEH;EHEHHEH}u1L LH HƿA@HEHHUHH6u"HEHHt HE-HMHEغHHHEH}CHUdH+%(tUHSHhH}HuHUdH%(HE1EEHEHEHEHEH(HEH}u4L LۭH HƿAHUHMHEHHǼtiHEоH+tUHUHMHEHH#u:L VL\H! HƿAѸHMHEȺHHYHEH} HEEREHEЋ@h9EHEHHEH}u4L LHy HƿAHUHMHEHH蠻HEHmHEH}u4L D LJH HƿALHEHHHUHMHEHHItEt E HE@pHEHLHEЋH4HEЋP0HEHHEAHudL HEHHEЋP4HEЋ@0HuHQRPILvp*H0 HƿAH HEHHEHPHEHǀHEЋ@$uHEЋ@'HED@HE@pHEHLHELXHEDHEЋHEЋP4HEЋp0HEH@HAPWAQMEHjH uFHy HEHIL$ 9H5 HƿEo}tiHEЋvZHUHuHEйHE}u8L LGH HƿAHMHEȺHHHEH}}tmE}EHUdH+%(tH]UHH H}HuELM HEH@IL UH HƿAҿHEH}uDL HEH@IL,nXH HƿAҸnHEHPHEHHuu?L HEH@ILm]H_ HƿAHEHPHEHHu?LE HEH@IL bH HƿAHE苀t{HE苀HEHxtHE苀HEHu?LHEH@IL:miH| HƿA"HE苀tOHEH菕u?L_HEH@IL mnH HƿAHEHUu/L LsHۿ HƿAHEH;E}tZHEHPHEHHUE}u:LHEH@ILl}Hl HƿA҃}tHEǀHEH2EUHH H}HuHUHEH4HEP0HEHEHDubLHEH4HEP0HEH@HuHvHQRPILkH HƿAH UHH`H}HuHUHMLEdH%(HE1EHEH@(HEHE@HEH@HHEHHUHH)HEHcHEHH˙ HHǸ-E؃}y9L LHý HƿAѸ7HEEHEHEHPHE HFu9L LHW HƿAѸHEHHUHH)HEHcHEH<HEHHH¸AEԃ}y9L LH׼ HƿAѸKHEEHE HEHPHE HZu9L LHk HƿAѸHEL@}t H H HUHcHMH)HHUHcHUH<HUMIHH H¸0E܃}y6L LHƻ HƿAѸ=HEEHEEHEHHEHUHEH(H9/HUdH+%(tUHHH}HuHxHpdH%(HE1EEEEEEEHUHMHEHHmu9L LH HƿAѸ_HE@tt,E‹E‹E=v EEHE@ltiHEH@xHu9L gLmH2 HƿAѸE‹E‹E=vEEHE@t+E}tmHE@ttmHE@lE}EHHpHH)EHcHxHH HHǸ譁E}y9L xL~ HC HƿAѸUEЉEEHEH@`Hu Hk HEeHHEEHEHP`HE Hu9L L+ H HƿAѸU}HEHHxEHHpHH)ƋEHcHxH<HUEIIȉH{ H¸胀E}y9L NLT/ H HƿAѸUEЉEEHHpHH)ƋEHcHxH<UHEAHH H¸E}y9L L2 H HƿAѸ%UEЉEHEH@`HEHHpHH)ƋEHcHxH<HEHHH¸QE}y9L L"5 H HƿAѸUEЉEHE@hUHcHpHH)֋UHcHxH<HH¸~Eă}y9L L7 HY HƿAѸUEЉEHE@l}HEH@xUHcHpH)H΋UHcHxH<HHfH¸~Eȃ}y9L L: H HƿAѸRUEЉEHE@tEHHpHH)EHcHxHH HHǸ}EЃ}y9L MLS= H HƿAѸUEЉEHE@tEHHpHH)EHcHxHH]/ HHǸ|Ẽ}y9L L? H{ HƿAѸUEЉE}EHHpHH)EHcHxHH9 HHǸU|Eԃ}y9L L&B H HƿAѸUEЉEHE@pUHcHpHH)֋UHcHxH<Hչ H¸{E؃}y9L LD H] HƿAѸUEЉEH}HpHxHuHEIHu9L %L+G H HƿAѸ}EHHpHH)EHcHxHH HHǸzE܃}y6L LJ Hk HƿAѸUEЉEHUdH+%(tUH}}t]UHHH}EEVEHHHEHHEЉEEHHHEHHH EЉEEPUuEUHH@H}HuHUHMEHELrHEILq H6 HƿAҿHEH}u9L 'L-s H HƿAѸ\HEHHudLHEIL0^v H HƿAHEHEHEȉHEȋHEЉEHEHMHEHEHPHEHHHEPHEЉHEPHEȉHEP HELHEHEȋHEЋHuHQRPIL] Hʯ HƿAH E"HEHEHEHEHEH;E HHHBhHcHMHH)֋hHcH8H<|EAHH} H¸IuE}y9L L H߬ HƿAѸ hEЉhHlHpHtHHC2 Hu9L L Hj HƿAѸtw)tPpvp 6HH@thHHUHH)hHcH8HH+ HHǸ tE}y9L Lޒ H HƿAѸhEЉhHH@thHHUHH)hHcH8HH% HHǸdsE}y9L /L5 H HƿAѸ$hEЉhDžxxHHHHTx?HHЃHhHHUHH)ƋhHcH8H<xHí H¸rE}y9L QLW H HƿAѸFhEЉhxx;EHHHHhHcHMHH)֋hHcH8H<H H¸qE}y9L L HT HƿAѸ~hEЉhHH HH hHcHMHH)֋hHcH8H<Hk H¸ qEă}y9L Lݏ H HƿAѸ hEЉhDžxxHHHHTx?HHЃHhHHUHH)ƋhHcH8H<xH H¸.pE܃}y9L L Hħ HƿAѸ hEЉhxx;EHHHHhHcHMHH)֋hHcH8H<H H¸foEȃ}y9L 1L7 H HƿAѸ& hEЉhHH@hHH@hhHcHMHH)֋hHcH8H<HU H¸nẼ}y9L L HP HƿAѸz hEЉhHH}HHhHcHMHH)֋hHcH8H<H H¸mEЃ}y9L LΌ H HƿAѸ hEЉhHHHHhHcHMHH)֋hHcH8H<H H¸KmEԃ}y9L L H HƿAѸ hEЉhHHHHtHHhHcHMHH)֋hHcH8H<HM H¸lE؃}y9L KLQ H HƿAѸ@ hEЉh1HH}HHhHcHMHH)֋hHcH8H<Hi H¸kE}y9L L HT HƿAѸ~hEЉhHH@thHHUHH)hHcH8HH8 HHǸkE}y9L L H HƿAѸhEЉhHH@thHHUHH)hHcH8HH HHǸqjE}y9L <LB H HƿAѸ1hEЉhHH@hHH@hhHcHMHH)֋hHcH8H<H` H¸iE}y9L L H[ HƿAѸhEЉhHHHHtHHhHcHMHH)֋hHcH8H<HǤ H¸hE}y9L Lˇ H HƿAѸhEЉhHHHHhHcHMHH)֋hHcH8H<H H¸HhE}y9L L Hޟ HƿAѸhEЉhDžxxHHHHTx?HHЃHhHHUHH)ƋhHcH8H<xH H¸jgE}y9L 5L; H HƿAѸ*hEЉhxx;EDžxxHHHHTx?HHЃHhHHUHH)ƋhHcH8H<xH H¸vfE}y9L ALG H HƿAѸ6hEЉhxx;EHHHHhHcHMH)H΋hHcH8H<H4 H¸eE}y9L yL HD HƿAѸnhEЉhHH HH hHcHMHH)֋hHcH8H<H[ H¸dE}y9L L̓ H HƿAѸhEЉhHHHHhHcHMH)H΋hHcH8H<H H¸JdE}y9L L H HƿAѸ hEЉhhHHUHH)ƋhHcH8H<EH׿H¸cE}y6L L HN HƿAѸ{hEЉhHhHMH8HHHXIHlu6L L Hؚ HƿAѸHUdH+%(tEH]UHHHxHpHhH`dH%(HE1EHpH@HE Hu9L TLZ$ H HƿAѸHpH8HE޾ Hu9L L( HÙ HƿAѸXHpHPPHEѾ HYu9L L, Hj HƿAѸEHH`HH)ƋEHcHhH<HMHUHEIIHHʑ H¸FaE}y9L L. Hܘ HƿAѸqEEHppUHcH`HH)֋UHcHhH<HּH¸`E}y9L L1 HM HƿAѸEEEHp@ttEEHH`HH)ƋEHcHhH<EH6H¸`E}y9L L~: H HƿAѸBEEHp@tEHH`HH)EHcHhHHa HHǸ_E}y9L LLR~= H HƿAѸEEHp@tEHH`HH)EHcHhHH֚ HHǸ^E}y9L L}@ H HƿAѸEEHp@tEHH`HH)EHcHhHHH HHǸP^E}y9L L!}B H HƿAѸ{EEEHH`HH)EHcHhHH͙ HHǸ]E}y9L L|D H` HƿAѸEEHpHHuHHEȋEHH`HH)ƋEHcHhH<HEHHrH¸&]E}y9L L{I H HƿAѸQEEHpHpt=tЍEHH`HH)ƋEHcHhHȉHHǸt\E}y9L ?LE{L H HƿAѸEEHpt=HptUHcH`HH)֋UHcHhH<Hۗ H¸[E}y9L LzN Hc HƿAѸEEHpHHHpHH@HEHEH@ HHEH@ L@HEHUHcH`H)H΋UHcHhH<HH H¸ZE}y6L LyR H HƿAѸ"EEHEH@HEH}EHUdH+%(tڹUHHĀH}HuHUHMdH%(HE1EEHEHPPHE Hu9L Lyb HƑ HƿAѸ$HEHHE޾ H\u9L Lxe Hm HƿAѸHE@tEHE@tEHE@tEHE@tEHE@tEHE@ tEHE@@tEHE@tHE(tEHEAtEHEH0HtEHEE}uEHEt H' HUHcHMHH)֋UHcHUH<LEHMURURMIHHX H¸*XHE}y9L Lv H HƿAѸEEHE@HEHUHcHMHH)֋UHcHUH<HHœ H¸WE}y9L SLYv H HƿAѸ|EEHE@HEHUHcHMHH)֋UHcHUH<HH< H¸VE}y9L Lu H HƿAѸEEHE@HEHUHcHMHH)֋UHcHUH<HH H¸LVE}y9L Lu H HƿAѸ@EEHE@HEHUHcHMHH)֋UHcHUH<HH) H¸UE}y9L yLt HD HƿAѸEEHE@HEHUHcHMHH)֋UHcHUH<HH H¸UEă}y9L Ls H HƿAѸEEHE@ t{EHHUHH)EHcHEHH/ HHǸTEȃ}y9L NLTs H HƿAѸwEEHE@@t{EHHUHH)EHcHEHH HHǸSẼ}y9L Lr H HƿAѸEEHE@HE(t{EHHUHH)EHcHEHH HHǸWSEЃ}y9L "L(r H HƿAѸKEEHEAHE,UHcHMHH)֋UHcHUH<Hy H¸REԃ}y9L Lq HQ HƿAѸEEHEH0HHEL8HEH0UHcHMHH)֋UHcHUH<HHH¸RE؃}y6L Lp H HƿAѸ EEHUdH+%(tUHHĀH}HuHUHMdH%(HE1HEHXHEEHEHPPHE Hu9L +L1p H HƿAѸ:HEHPHtYHEHPHE޾ H|u9L Lo H HƿAѸEHEHPHtEHEtEHE@8tEHE@8tEHE@8tEHE@8tEHE@8tEHE@8 tEHE@8@tEHEHHHEЋP LMHED@EHHuH)ƋEHcHEHHEHQRURHHB5H¸OH E}y9L qLwn H< HƿAѸEEHEHPHEHHUHH)ƋEHcHEH<HEHH܋ H¸OE}y9L Lm H HƿAѸEEHEt{EHHUHH)EHcHEHHf HHǸNE}y9L TLZm H HƿAѸcEEHE@8HEЋ@UHcHMHH)֋UHcHUH<Hڊ H¸ME}y9L Ll H HƿAѸEEHE@8HEЋ@UHcHMHH)֋UHcHUH<HX H¸]ME}y9L (L.l H HƿAѸ7EEHE@8HEЋ@ UHcHMHH)֋UHcHUH<Hډ H¸LE}y9L Lk H] HƿAѸEEHE@8HEЋ@$UHcHMH)H΋UHcHUH<HW H¸1LE}y9L Lk Hǃ HƿAѸ EEHE@8HEЋ@(UHcHMHH)֋UHcHUH<H׈ H¸KEă}y9L fLlj H1 HƿAѸuEEHE@8 HEЋ@,UHcHMH)H΋UHcHUH<HQ H¸KEȃ}y9L Li H HƿAѸEEHE@8@HEH@0UHcHMHH)֋UHcHUH<HHӇ H¸mJẼ}y6L 8L>i H HƿAѸJEEHEHp\u/L Lh H HƿAѸHUdH+%(t+UHAUATSHXH}HuHUHMdH%(HE1EHEHEHE|HEHExЉEHEH8HE Hu9L Lg H HƿAѸHEH@HE˾ HGu9L Lg HX HƿAѸTHEt H=څ H=uP HEt H5Dž H5WP HEt H H 9P HE|t H HP HExt H HO LEMhLMEpDMMcLULL)DMMcLMO LeLUHWVQRPEPAPEMLHS HHL߸zGH@E}y6L ALGf H  HƿAѸ EEHUdH+%(tsHe[A\A]]UHAWAVAUATSHHHHHdH%(HE1Dž(HHH3 H(u9L nLte- H9~ HƿAѸHHP4H@H HǸ.FyCLH3IL+0 H} HƿAҸ6HDHDHDHHDHDHDHDHHHt?Ht$Hu H H H H uHt H5* H50 HDHHHH HHHHH(HcHH)H(HcHH<H@HAPAQARRAWAVAUATSQVASDLHH*HH DHp,,y6L Lb4 H{ HƿAѸ,(HUdH+%(tHe[A\A]A^A_]UHHPH}HuHUHMdH%(HE1EHEH@HEݾ Hʻu9L LbU Hz HƿAѸ HEHHHuEaE HEHHHEH HSu9L La] Hdz HƿAѸHEEHHUHH)ƋEHcHEH<HUHEIAHH8 H¸@BE؃}y6L La` Hy HƿAѸ EEԸHUdH+%(t=UHSHxH}uUHMLELMdH%(HE1EEHE@ BHHZ HHY H>HMHUHuHEH跽L !L'`v Hx HƿAѸ$ HEHPPHE۾ H腹u9L L_{ Hx HƿAѸHEHPHHEξ H/u9L uL{_} H@x HƿAѸxHEP@HE@E}y9L SLY] Hv HƿAѸVUEЉEHMHUHuHEHL L\ Hu HƿAѸHEHHt HEHHEHHELHEHHuHE HUHHt H5Q H5E HUHHuHrE H}HHt H=P H=RE LMMDMMcL]LL)DMMcLMMQAPPVIILH{ HHL߸<H Eȃ}y9L L[ Ht HƿAѸUEЉEIELEH}HMUuHEHuMIHHL -L3[ Hs HƿAѸ0HMHUHuHEH:L ԻLZ Hs HƿAѸHMHUHuHEH!OL {LZ HFs HƿAѸ~HMHUHuHEHrL "L(Z Hr HƿAѸ%HMHUHuHEHL ɺLY Hr HƿAѸHMHUHuHEHuQL tLzY H?r HƿAѸw HE@ „HHH>H„% HH}HMHUHuHEIHu9L LX H|q HƿAѸHEupLmHE@HHHHHO HHPEPEPIL Hq HƿAH<L}u'HE@HHHHHN HHHYHUHJHUHuHuPQREPAL^ Hpp HƿAH0}u'HE@HHHHHN HHHHUHRHMH1HMH}IH輯u6L LW Ho HƿAѸHEHHEH@HHEHHUdH+%(t7H]UHH@H}؉uԉUHMLEHEHEHHEH}u9L mLN H8o HƿAѸHELEH}HMȋUЋuHEHuMIHNHEHEH}u/L LU Hn HƿAу}xE|LHEIL Hsn HƿAHeH}L gL H2n HƿAѸUHATSH@H}dH%(HE1EHEHHEHkaIL(t  Hm Hƿӿ舎HEH}uGHHEHaIL  Hjm HƿӸHE@0HE؉HtHE@4HE؉HuBH1HEH`IL Hl HƿXHEtRHEHBuBHѴHEH<`IL% Hl HƿHEHFu/L L* HJl HƿAHEHHEhHEP4HEp0H}HMHEIHpu4L LS/ Hk HƿAKHEHHEHUHEHH9uHEH/Au/L L2 Hk HƿAHEt HEHAHEHyEă}HEHPHEHH6Eă}tHHE@$u=H'HEH^ILQ: Hj HƿHEH`HEHEH9EtHEH;Es HUHEH}uHEtHEǀL%tHEt H: Hp HEH]HUHMHSPRILI Hj HƿAH H}tYHEtKHHEH[]ILrU Hi HƿHEǀHEǀHEHn-EHUdH+%(tHe[A\]UHSH8H}dH%(HE1HEHE$HEHHtLHHEH\ILgo m Hh HƿHEHǀHаHEH;\IL5o q Hh HƿHE@pHEHHHEP4HEp0HEH@AAHkuGHOHEH[ILn t H h HƿӸHEH]tFHEH|u6L LN{ Hg HƿAѸ,HMHEغHH`HEH}HHUdH+%(tH]UHHH}HEH>P1u/L @LFN H g HƿAHEHOHEHUHSHXH}HuHUdH%(HE1EEHEEHEvHEHEHE@uHE@0HE@t#HEH@HUHMHH\HEH[tTHUHMHEHHu9L LM He HƿAѸHE@uUHUHEHHNEЃ}u9L LL Hxe HƿAѸ"HEtHEǀHE@$HEHEHuzL 'L-L Hd HƿAHEHu/L LK Hd HƿAEHEHRZHEHE@$uHE@HED@HE@pHEHLHELXHEDHEHEP4HEp0HEH@HAPWAQMEHwH HHEH\WILf Hc HƿHEHAu/L LJ Hoc HƿAE}HEHUHuHEHuwL 0L6J Hb HƿAHEHu/L LI Hb HƿAE$HEtE HMHEغHH[HEH}}u-} HE@HEHHHEH"Ku/L $L*I Ha HƿAHEHJ}HE@uzHEHHtjHEHHEHHEHхuBHEH L LH HVa HƿAѸEHUdH+%(tňH]UHSHHH}HuHUdH%(HE1HEHEHEHEH7VHEH}uDHHEHOTIL H` HƿӸzHUHMHEHHVtXHEؾH#VtHUHMHEHHHMHEкHHYHEH}0HUdH+%(t虇H]UHH0H}uHUHEHHH:iHEH}u6L ӧL H_ HƿAѸ[HEUPHEHUHPHEH(H=HEHUH HHMHE苀PHE艐HEUHH0H}HuHUHUHEHHEH}u9L LF3 H^ HƿAѸHEHHUHHWHEH}u=LHEIL6 Hr^ HƿAҸwHEHUHPPHUHEHHJu6L NLTE< H^ HƿAѸHE@hHEǀUHH`H}HuHUHMLEDMH}uEHUMHEȉHHEH}u9L LDY Hi] HƿAѸ1HEHHUHH_VHEH}u@LDHEILV\ H] HƿAҸHEHUHPPHUHEHHIu9L LCb H\ HƿAѸtHEHHUHHUHEH}u@LHEIL e HK\ HƿAҸHEHUHPHHUHEHHaHu9L $L*Ck H[ HƿAѸ}HEP HW HƿAѸH}wHEHHHUHH_HUHBxHEH@xHu9L IL] HW HƿAѸIEЃt6HEH HHzHtHE艐HEHHUHHOHEH}u@LHEILA HsV HƿAҸ}tHEǀHEǀHUHEHHsBu6L 6L<= HV HƿAѸ9HEHUHP`HEUPhHEUPlHEUԉPpHEUЉPtUHHH}HuHUHEHHu6L L<HbU HƿAѸUHH0H}HuHUHEEUHHHHH2 HHPHEHHH|utUHHHHHH2 HUHEHHEH}u9L L;HT HƿAѸ-E}#w H}BH}uCLiHEHIL[ !H*T HƿAҸHE؋PHEPhHE؋PHEP8HE@ HEH HjrHEHPHEHHEH H;rHEHP HEHHE؋P(HEHE؋P4HEHE؋P0HE HEH@@HEPtUHHH}HuHUMDELxdH%(HE1f)E)E)E)E)EHEHEEEEEHxHEHEHEHUHMHEHHnHUdH+%(t;zUHH0H}HuHUHEEUHHHHH50 HHPHEHHHyutUHHHHHH/ HUHEHHEH}u9L L9ZHQ HƿAѸFE}#w H}BH}uCLHEHILnX \HQ HƿAҸHE؋PHEPhHE؋PHEP8HE@ HE؋PHEHE؋PHEHEHH HEH HH:|HEHH@HEH HH|HE؋P`HEHE؋PdHEHE؋PpHEHE؋PlHE HEH@xHEPtUHH@H}HuHUHMLELMH}v@LjHEIL$H.P HƿAҸHZ1 H#EHtHw=HtHtq/HEHT HHwuUH1 HHEHM@L֗HEILHO HƿAҸQ}@?wILE@Hj@ALHNO HƿAH}@ vLL=E@Hh ALwHN HƿAHHUHEHHEH}u9L іL5HN HƿAѸSHEHHUHHGHUH@HEH@Hu@LgHEIL1U H+N HƿAҸHEH@HEHHF:u9L L5HM HƿAѸHEHHUHHFHUH8HEH8Hu@LHEILHcM HƿAҸHEH8HEHH~9u9L ALG4H M HƿAѸHEHHUHHFHUHBPHEH@PHu@LݔHEILwHL HƿAҸXHEHPPHEHH8u9L L3HML HƿAѸHEHU HHEHU(H HEHU0H(HEHU8H0HEU@pHE؉HEPtHEHUHHEǀtH}YHEHHHMHH(*HUHHEHHu9L L2H]K HƿAѸHEHH@HEHEH@ HtHEH@ tCL&HEHILHJ HƿAҸHEHH>HHaru&HEH@ H@HEtHEH@ HEPHEHEH@HEH}1HEtE@9sE@HEtUHH@H}HuHUHMDEDMHUHE HHEH}u9L L1HI HƿAѸ/HEỦHEUȉHEHHUHHBHUHHEHHu@L{HEILmH?I HƿAҸHEHHEHHZ5u9L L#0HH HƿAѸMHEHHUHHAHUHBPHEH@PHu@LHEILH}H HƿAҸHEHPPHEHH4u9L ^Ld/H)H HƿAѸHEHHEPHH-sHEH@8Ht]HEH@@HtPHEHP8HEHHHH@PHUH0HEHP@HEHHHHPHUH8UHH@H}HuHUHMLEDMHUHE HPHEH}u9L QLW.HG HƿAѸH}u9L LN HF HƿAѸHEHHUHH?HUHPHEHPHu@LHEIL$HkF HƿAҸRHEHPHEHH2u9L ILO-)HF HƿAѸHEHHUHH ?HUHBPHEH@PHu@LHEILO,HE HƿAҸHEHPPHEHH1u6L L,1HUE HƿAѸ?HEHXHEȺ@HH\pHEUĉHEǀUHH0H}HuHUHMDEDML LFHD HƿAѸUHH0H}HuHUHMLEDML LVUH`D HƿAѸUHH H}uHEHgHEH}u9L 5L;+_HD HƿAѸHE苀t[LUHHHHH! HHILcHC HƿAҸHE@9ELHE@HHHHH$! HHHUHHHHH! HHHQIL=J iHC HƿAHHEUHH}}vILފEHhALuHB HƿAHUHH0H}HuHUHMLEDMDMLEHMHUHuHEHj}WuHH UHHPH}HuHUHMLEDMHE}wLLEHhALHA HƿAH} vLLEHh ALHlA HƿAHHHUHEؾ HCHEH}u9L DLJ(HA HƿAѸHEHHUHH:HUH8HEH8Hu@LڈHEILG H@ HƿAҸ~HEH8HEHH,u9L |L'HG@ HƿAѸ'} HEH8HHEHEH@HEH}v_LHEH-IL9G H? HƿAHEH@H+EHHEHPHEHEHHEHUHEH8HH9bHEHHUHHz8HUH@HEH@Hu@LOHEILF H? HƿAҸHEH@HEHH.+u9L L%H> HƿAѸHEH8ǀHEH@ǀHEǀH}HE؉HEHUH`HEHUHhHEUpHEUxHEHPHUHH0H}uHUHMHE HHEH}u9L L$H= HƿAѸ9HEHH0HFHEH}u9L LHS= HƿAѸ}}W}=}C}t}.HEH;Eu9L LaH< HƿAѸ^HE؉tHEЉu9L L#H|< HƿAѸHE؉HEPHEЉHEPHE؉Xu9L JLP#H< HƿAѸHE؉HEPHE@(LHE؉u9L L"H; HƿAѸ;HE؉HEPHE@(=HEHH9Et9L LHL; HƿAѸHEH`H9Et9L 7LH; HƿAѸHEHUHPHEHUHP LD <H 9 HƿAѸHEU䉐UHH0H}HuHU؉MHEHHUHH1HEH}u@LHEIL:@ LH|8 HƿAҸ HUHEHH$u9L aLgQH,8 HƿAѸEԉ(u6L L TH7 HƿAѸwHUHE HHEH}u6L LWH7 HƿAѸ!HEHUH@HEUԉUHH H}HuHE HHEH}u9L ;LAfH7 HƿAѸHEHHUHH/HEH}u=L~HEILjH6 HƿAҸaHUHEHH"u6L ~LpHX6 HƿAѸHEHUHHUHH0H}HuHUHMHEHH Hj?HEH}u6L ~L|H5 HƿAѸEHEHUHPHEHUHPHEHUH(HH莕HE@ PHEP UHHHHH@H8H0dH%(HE1H@tH@uQH8tH8u9L }L]H4 HƿAѸH8HHHH8HH-HPHPuCL|H8ILB< Hi4 HƿAҸ_HPHHHH L D|LJH4 HƿAѸH`H@HHIVyCL{H@ILd H3 HƿAҸx%=`tCL{H@ILHZ3 HƿAҸPHEHUH  ЉHEH%HHHHHAAH@HPHPu9L zLH2 HƿAѸHHHVHXHXu6L zLHj2 HƿAѸcH0HPHXHHHu6L AzLGH 2 HƿAѸHUdH+%(tyYUHH H}HuHEH>UHEH}u9L yLH1 HƿAѸHE@ws@ v6L qyLH<1 HƿAѸ\HUHuHEHѺHu6L yL H0 HƿAѸUHH}HuHUHEHUHHEHUH]UHSHHH}HuHUHMLELMHUHEؾHbHEH}u9L cxLiH.0 HƿAѸHEHHUHH$)HUHHEHHu@LwHEIL7 H/ HƿAҸ:HUHEHH ~t9L wLHj/ HƿAѸHEHHEHHu9L HwLNH/ HƿAѸHEHUH HZHHHJHZHHHJ HZ(HHHJ0HZ8HHHEHUHHEHUHHEǀH]UHSHHHdH%(HE1HPHHHHPH2v URHHHt Hm? H;HHHRHH;RPIL"H5 HƿH Wh%=@t@LuHHIL!Ha5 HƿAҸHUdH+%(tTH]UHSH8H}EL)uHEIL5 .H4 HƿAHEHSHEHEHEH}XL tL2H4 HƿAѸRHEHEHEH7XE܃}ESuHHEHL CtLI=H4 HƿARHsROHHEt H== H HMHRH/RPIL @H3 HƿH /HEHPHU/HE/H^QHEH}HEȾHWE܃}RuHHEHL sL MH2 HƿAQHrQNHHEt H< HHMHRHRPILPH`2 HƿH EHEHoLEH]UHHHXdH%(HE1HXu H`HXHH@Lux%=@uNHXH|u6L qLfH1 HƿAѸHUdH+%(tPUHSH(H}HEHKHEH}H}wP}@t&}@wD}t} t 6H&4HjG+H0_"HHBHn H]UHH H}HEEZUHHHHHHEHHH#1H9Es*UHHHHHHEHHH0HEEUHHHHHHEHH@PHuHEUHATSH@H}HuHUMDEHHEEZUHHHHHHEHHHj0H9Es*UHHHHHHEHHH>0HEEUHHHHHHEHH@PHuHEH@pHE7HEH@H/HH9EsHEH@H/HHEHE HEH@HuE(UHHHHHHEHЋHEȉHHEH}u4L IULH= HƿAHEH@Ht HEH@H2HEHEH;EZHEt/L TLH HƿALTHEIL H HƿAHuTHEH.D`HEH.PHPATAL H= HƿH}HE؋=tuHTHEAHEH@H.D)ЃHEHPHH  PHPQIL H HƿH L%S}t HH}t.UHHHHHHEHЋ@%rHH r}t8UHHHHHHEHЋ@%t Hy H6H-}t H5h H5}HHHHHHEHL@X}HHHHHHEHHH}SQRVAPPAL H HƿAH0HEHEEUHHHHHHEHH@PHHe[A\]UHH H}uUHEHTHHEHEH9EsHEHEHEH@`HHEHEH9EsHEHEHEHp`}MHUHEAH L QLH HƿAH5S}MHUHEAHUHH0H}HuU܉M؃}u HEH@`HSHEHEU܉PUHHHHHHEHЋP HEPUHHHHHHEHЋP HEPUHHHHHHEHЋ@%HEP(HEU؉P,UHHHHHHEHЋHEHHUHB HEH@ HuWLMPUHHHHHHEHHIL2H  HƿAҸUHH0H}uUMHEH0HHEH}u9L OLAH HƿAѸMUHuHEH uLL dOLjGHX HƿAHEHHUHH WHE@( E܉HEP(HE@(%tHEHUH@HHOgHEHUH@HHfHEUHH@H}HuHUHMLEEHEHE<_u EnHEHH;ErDHELbNHEIL jHO HƿAҸ_HEHPHUHUHHEHEHmHEt H}^HUHEHH}t HEȋUUHH0H}HuHUHUHEHHp%uYHEH'HHEHUHMHEHH,u%HUHEHHEHH%uUHHpH}uHUHMLEdH%(HE1HUHuHEA H'HEH 'HEHEHEHEH@H&HHEHEH@HUHMHH+uX}t HEH;Et4HUHEHкH ;HH+u"HEHH9EuHEHE HEHE HEH@H[HEdH+%(t+UHH0H}HuHUdH%(HE1EEHEH HH+uQH}uJHEH@ H%HEH}uHE@uIBEHEH@ HEHE@EHEH@pH}HMHUuIH EHUdH+%(t*UHH H}uEMHEHH`UHHHHHȋ#Et%uHEHHu-EHEHH`UHHHHHH@PHuUHHpH}HuHUHMLEdH%(HE1H}u bHUHuHEA Hqu9L ,JL2H HƿAѸEZHEHH H5jLUHHHHHHxHEHHtHEỦHEEH LUHHHHHH@PHuENHEHP HEH@hMHHHHMHHttHEỦHE-EHEHH`UHHHHHH@PHuHUdH+%(t`(UHH@H}HuHUȉMdH%(HE1H}u H}HMHUHuHEIH}t]HE؋PEt H JEHHHHHȋHEHH`EHHHHHȋ HE؉PzUuHEعH HXHUHMHEHHE}t3}tHE؋@ EHE؉PUHE؉H|HUdH+%(t 'UHH@H}؉uԉUЉMDEHE}u HEH@`HIHEHEH@@HE-HE@,9EuHE@9Eu HEHEHEHHEHUHEH@H9uH}}t0HE؋HUHHHHHHEHЋ HE؉P[UЋuHEعHHEH}u9L FLH HƿAѸ}t HE@(% tWL:FUHHHHHHEHHIL2$H  HƿAҸCHE@( HEP(HE؋@8HHU؉J8HUBHE@( ẺHEP(UHH`H}HuHUMdH%(HE1H}u HE<+uHEHmE@%HE<-uHEHmEE@H}u9L ELbFH  HƿAѸtHUHuHEA Hu9L DLKH HƿAѸEaHEHH H5FUHHHHHHxHEHHt$MŰuHEAȉѺHEH FUHHHHHH@PHxEUHEHP HEH@hMHHHHMHHt!MŰuHEAȉѺH-EHEHH`UHHHHHH@PHuHUdH+%(t"UHH0H}HuUHEHEHEHEt HE<,tHEHEHEHEt HE<,uHEH+EHNjUHuHEHHHEHL BLjH HƿALBHEH+EHuAL kHd HƿAHHEUHH0H}HuUHEHEH}HEHEt HE<,tHEHEHEHEt HE<,uHEH+EHNjUHuHEHHHEHGL kALH_ HƿALBHE@HHHHHHHHHt:HBHE@HHHHHHH.HHu%HEHHEHUHEH@H9ZUHH`H}dH%(HE1HEHEHEHH`HUHHHHH@uHEHHEHHHHUHBhHEH@hHu9L >LHHƿAѸuHEUHEHH`HUHHHHHHHXHHEHH`HUHHHHHHxHUHEIй H'u9L =LHHƿAѸEtsHEHHUHHHEH}u6L =LHuHƿAѸjHEH@hHUHHHEH6HEHH`HUHHHHHHEH@hHUHHHQHHEHEH;EHUdH+%(tTUHH@H}HuHUHMLEDMHEHt9L <LHHƿAѸ4=HEH}u9L I<LH=HƿAѸH}t HEHEPHEHUHP0HEHUHP`HEHUHPpHEHUHPxHEP(E HEP(Eă t:EăuHE@(HEP(EătHE@(HEP(EătHE@(HEP(HE@(HEP(HEH@HRHEHPHRHEPHEHHEH}tHEH@HtHEHPHEHP HEHHP (HϾH:HUHHEHHuEL :LHHƿAHEH>HEHHuHEH$HMHEHHtHMHEHHuHEHHMHEHHtHMHEHHuHEHHUHEHHVHEHtXHEHLL p9L;HdHƿAHE@(HEP(HEUHHH}HEHHtHEHHHZHEHHtHEHH GHEHH(HEHUHH H}HEHEHEHEHEHPHUuHEUHH H}HuHEHHUHHHEH}u6L 28Lð\H&HƿAѸHEH?HUHBUHH0H}HuHUHE@,u HEH@`H<:HEHEH@ HPHEHHEH}u,HE@HHHHHHEHЋ@HEHUHH H}HuHUH9HE@HHHHHHHHHuHEUHEME\E~ fT f/]UHHEMEf/Ev"EHEf(fHnuUHHEMEf/Ev"EHEf(fHn@uUHHEMEHEf(fHn=uEHEf(fHntUHHEMEHEf(fHn.uEHEf(fHntUHH0}HuUHMLEH}tHEH@H@HtEE%====@9@ }}t}HEHHEHH9rHEHHUHHH9sIH}HEH@HHEHH9jHEH@H@HHEHHH9G.}tyHEHHEHH9rHEHHUHHH9sEH}HEH@HHEHH9HEH@HHUHHH9}tuHEHHEHH9rHEHHUHH9sEH}lHEH@HHEHH9QHEH@H@HHUHH924HEHHEHH9t&H} HEH@HHEHH9HUHEHHt-H}HEH@HHUHH]}}HEHEHf(fHn`t%HEHHEHf(fHnueH}#HEHEH@Hf(fHn9HEHHEH@H@Hf(fHn}HEHEHf(fHnt%HEHHEHf(fHnuaH}sHEHEH@Hf(fHnLJHEHHEH@Hf(fHny}HEHEHf(fHnt!HEHEHf(fHnu]H}HEHEH@Hf(fHnHEHEH@H@Hf(fHntjiHEHEHf(fHnnu,H}t;HEHEH@Hf(fHnBt UHH@H}؉uԉUHMLEHEHHEH}HEHEEHE%uBHEH@HEHE9EucHEHpH}HMȋUEIt?SHE#EЅt+HEHpH}HMȋUEItHE HEH@HDUHHPH}؉uHUHMLEHEH@H@HEHEH@HHE}tHEH@H@HHEHE@%= =  =k====== t =`tF}t(HEH;ErHEH9Er HEH9E}t(HEH;Er HEH9Es HEH9EpHMHUuHEIHѺ Hzt @}tHEH9E'HEH9EHMHUuHEIHѺ Ht HEH;EHMHUuHEIHѺ Ht HEH;EHMHUuHEIHѺ Hta}tHEH9EKHEH9E;L|,HEILF'HiHƿAҸUHHPH}؉uHUEHMHEH@H@HEHEH@E}tHEH@H@fEHE@%= F= ====t==^= t =`tqK}tJHEEf(fHnt%HEEf(fHn]t @6HEEf(fHn}tJHEEf(fHntHEEf(fHnu HEEf(fHnHMHUuHEIHѺ@HGt v}tHEEf(fHnxTHEEf(fHn\8HMHUuHEIHѺ@Ht HEEf(fHnHMHUuHEIHѺ@Ht HEEf(fHnHMHUuHEIHѺ@HAts}tHEEf(fHneTHEEf(fHnL;L)HEIL-THHƿAҸUHH@H}uHUHMLEHEH@HHEHEȋ@%= t =`t2HUHEHHPHUHEHH;LZ(HEILԡgHGHƿAҸUHHPH}؉uHUHMLEHEH@H@HEHEH@HHE}tHEH@H@HHEHE@%= =  = k= ===== t =`tF}t(HEH9EHEH9E| HEH9E}t(HEH9EHEH9E| HEH9EpHMHUuHEIHѺHt @}tHEH9E'HEH9EHMHUuHEIHѺH+t HEH9EHMHUuHEIHѺHt HEH9EHMHUuHEIHѺHta}tHEH9EKHEH9E;L%HEILcHvHƿAҸUHH H}HuHEH?EEHEH@H@Hu;}u+HEH>HEHEH@HEH@HPEH9t HEHHEHEH@HHHEH@MHHH@H9uMHEH@UHHHPHEHHEH@uHHHHEH@HHt"EHEHHEHEH;EaUHH0H}HuHEHz>EEEHEH@H@Hu;}u+HEHn=HEHEH@HEHHEEEEHEH@HHHEH@MHHH@H9uZHEH@UHHHPHEHHEH@uHHHHEH@HHcu EEEEEHUHRHRH9\}tHEHHEHEH;E+EUHH H}HuHEH@H@HuHHEHHE'HEH@u HEHHEHEH;EuϸHEHHEEHEH@H6HHEH@MHHH@H9uTHEH@UHHHPHEHHEH@uHHHHEH@HHu:EEHUHRHRH9bHEHHEHEH;E=UHH@H}uHUHMLEHEH@HHEHE@%=t =t EBE9L L&HHƿAѸHE@tt5K}tHUHEHHHUHEHH,EUHUHEHHE=L[ HEILŚHHHƿAҸHEȋ@%@t }EUHH H}HuHEH@HHUHHEHE@%@t }EUHH@H}HuHUHEH@@,u HEH@`H!HEHEH@@HHHHHHEHHHEEHEH@ HuGL'HEH@@AL+H HƿAҸHEȋ@%tHEH@ HUHHEHEH@@(%=>=e==O=t,==@tn@/ t"HEH@ HH=v 8HEH@ HHEH@pH}HUHEIHEHEH@ H8HEH@pHMHUHEfHnHEHEHH HEH@pH}HUHEIHEHEHH HEH@pH}HUHEIH EhHEH@ HHEH@pH}HUHEIHE6L&HEILPLHHƿAҋEUHH@H}HuHUHEЋ@4t!EHEHHELHEH@HHEH@H9u(HEHPHMHEHHu EHEHHEHEH9EuEHEH@HE+HUHMHEHH E}u!HEHHEHUHEHH9uEHEH@HE+HUHMHEHH!E}tHEHHEHUHEHH9u96L L`qHwHƿAѸHEЋ@%t }EUHHH}HuHEHHtHEHH@Hu"HEHHHHUHEHHUHHPH}HuUHMHEHEEH}u9L LHHƿAѸ }u@H}u9L JL H>HƿAѸHEȋ@(%t HEH@H?HEH}u9L LHHƿAѸhHEH@Hu HEHUHPHEHUHPHEȋ@(%tlHEȋ@8HHEHHHHUHB(HEH@(Hu4L 2LH&HƿAHEHH0HE@0HEH@@HE3HEH(HHEH}u4L LLHHƿAHE@,tSHHEHE@HHHHHHEHHHHHuHEHUHP8 HEH@`HEHEHUHPHE@,tHUHMHEHHHUHMHEHHHEH}u[LHE@HHHHHHEHHILuHHƿAHE@HHHHHHEHLHPHEHxxHEH0HMHUHEIHAхu[LHE@HHHHHHEHHILHHƿAQHEHUHHH.HEHHEHUHEH@H9EHEHPHEHH@HE@0HEH@8HuHEȋ@(@HEH@8HtzHHEH@8H@@HHHHHLHPHEHxxHEHP8HEH0HMHEIHAHEH@8H@@(%tHEȋ@(@t<}t9HEHUHPHH-HEȋ@(uHEHCH}t HEP0HE}t}uHEHHUHHEUHH0H}؉uH}u9L L\ HHƿAѸ@HE؋@(tHEHPH.t HEH@@HEIHE@(%u-}uHE@(%tHE@( HEP(HEHHEHUHEH@H9uHEH@PHEHEH@HEWHEH@Ht?HEH@t0HEH@@(%tHEH@P(HEH@P(HEHHEHUHEHH9uHEHHEHUHEHPH9jUHHH}HEHJUHH@H}HuHUdH%(HE1H}HMHUHuHEIHtdHEH@@HE>HEP,E9u%HEPE9uHE@( HEP(HEHHEHUHEH@H9uHUdH+%(t=UHH H}HuHEHEH}HEHEt HE<,tHEHEHEHEt HE<,uHEH+EHHMHEHHuLL!HEH+EHuALcHHƿAHHEHUHHH}HuHUHEHHu6L LnHHƿAѸHEHUHHH}HuHuHEHTUHH H}HuUHMHMUHuHEH UHHH}HEHEt(WHHEHHH% uHEUHH0H}HuHU؉MHEHHEm}tHE@#EԅtSHEHH~HEHEHHUHEHHu#H}tHUHEHHEHHE@)HEHEHHuH}t HEHUHUHH H}HuUMHUHEHHH UHHH}HuHUHEHHHUHH}EHEH<"tHEH<'uHEHEHEHHPHEHE]UHH0H}HuHUEHEHUHHE}uHE<.u E}ubHHEHHH%uHEHUHHEHHEHH9uHEUHH@H}HuHU؉DELMȈEEHEHUH}HEHEt HE8EuHE8Et6L L HHƿAѸuHEHUHHE_UHEѺHHHE}uHE< tHEHEuHEHUHH}t HEȋUHEUHH`H}HuHUMLELMdH%(HE1HEHEH@HEDHEHHEH9Eu*HEHHUHMHHeu HEHHEHEHHuHEH}t HEH@HEH@HEHUHEHEHEHEHUHEHHEHH0H}HMUHELUIIȹHA҉Eԃ}}u{L3 HEHH`UHHHHHHPHE%t HHHRIL5 HHƿAHyL HEHH`UHHHHHHPHE%t HHHRIL: HfHƿAHHUHEHEӈ}tHEHtHEHUdH+%(tUHHĀH}uUMLELMHEHEHEHEdH%(HE1}u HEHHEHEHEHEHEHEHEH@H}u HEVHEHEMHEHUHuAA HHEHEHHE HE%uWHEH@HEHE9EHUHEH)IH}؋MHUHuHEMIH[HEH}tLcHE#Et=HUHEH)HHM؋UHuHEIIȉѺHHEH}uHE HEH@H:H}t5HUHEHHUHEHHEHEHEHUHPHEHUHHEHUdH+%(tUH}f*E (^fX]UHH}uEf~E} vE EHH  5 YEf*ME/v$}~EHHQ EBf*E \M/v'}ͧ \E ^EEUHH}HuH}u H}u HEH;Eu HEHx fH*HHH fH*XHEHx fH*HHH fH*Xf(^t Y,E}t}u E]UHH H}HuHUHEHHu[?HUHHEHHu6L L< HHƿAѸHEHHUHMHHUHHH}HuHEHHtHEHHUHHcUHH0H}HuH}u iHEHEFHE%t{HEB !Ѕt'HEHEB !ЅLHEAL\ HHƿAҸHEH@HEHEHHHHHHEHHEHEP B !ЅtHEthHEA !ЅuVLHEHPHE@%HRAL HHƿAHHE HEH@HUHH@H}HuHUHMLELMHEH@HEH{HEHEuDLSHEHILك H<HƿAҸHE{t+{>[t'[4(t(*"t'tE)E}E]HEEEM}t HEHHEHUHuAA HHEH}uALzHEHIL8 HcHƿAҸHEHEHEUHH H}HuHEHEHEHEHEHHPHEHH@HHtUHH0H}HuHUHMHEH HEH}tFHEH;Et HEH+EHHMHEHHOHHUHBHEH@Hu6L ]L^, HQHƿAѸHUHEHHUHHH}HuHUHMLxLpdH%(HE1HEHEHEEEHE H萺HEH}u4L L؁P HHƿAHEHHE@HUHEHHEHMHHIE}HEHEMHEHUHuAA HdHEHEHu?LHEHIL [ HHƿATHMHUHuHEHu4L yL_ HmHƿAHE@}uEE HEHHEHEHHEHEH|EMHE}HUHuAAHEHEHEHu?LHEHIL t HHƿA5HEHHEHEUHMHHxE}u4L GLz H;HƿAE% EE;EE&UHHHHHH<9Et)EUHHHHHHHHuLUHHHHHHHIL3 HnHƿAHE@tH}upHE@#EubL 'L HHƿA}t}uHEP HEUPHMHUHuHEHu4L L HHƿA4HEHE}uHESE% u?LIHEHILw~ H2HƿA}uHE@ HEPHE@ HEPHEHaHEH}u4L L~ HHƿAGH}HEHHHEH}u4L bL~ HVHƿAEHEHHE,EPUHHEHHEHHEHHEHEH;EuHuHEHHѺHHEHE+EHHEHHHHEHHyEEH;ErHEHHUHxHHptHpHUHHEDHUHxHH}tHUHEHH迵HptHpHHEHUdH+%(tpUHH}HEHuMHMH ףp= ףHHH HHHH?H)HHHHHHH)HHuMHMH ףp= ףHHH HHHH?H)HHHHHHH)HHu]UHHH}HuH}u/HEHtHEHHH6 HEHHHm6 UHH`H}HuHUdH%(HE1EHEHEHEHEHEHHEHHH%u aHMHE HHHEHE<-HEH+EHHEH)HHEHEHHEHHEHHH%HMHE HHHEHEH+EHHEH)HHEHE<-uBHEHHEHMHE HHFHEHEH+EHHEH)HHEHUHEHH+EHEH}RH}H}uEHEHEHE$H}EHEHMH ףp= ףHHH HHHH?H)HHHHHHH)HHUHMH ףp= ףHHH HH?HH)HEH}EHMH ףp= ףHHH HHHH?H)HHHHHHH)HHUHMH ףp= ףHHH HHHH?HH)H ףp= ףHHH HHH?H)HEHUHHHHHHH)HHUHMHKY8m4HHHH H?HH)HEL [LԐ 5 HOHƿAѸBH}uEHE9L L > HHƿAѸH}~H} ~9L LE HHƿAѸH}~HUHEHHIHH9E~6L hLJ H\HƿAѸR}uEHE-lHEPHE؃HEPHEHEP HEUĉHEHHUdH+%(tSUHH`H}HuHUdH%(HE1EHEHEHEHEHEHHEHHH%u6HEHEHEPHEPHEPHEH<HMHE HHHEHE<:HEH+EHHEH)HHEHEHHE_HHEHHH%HMHE HHpHEHEH+EHHEH)HHEHE<:uBHEHHEHMHE HH#HEHEH+EHHEH)HHEHUHEHH+EHEH}RH}H}uEHEHEHE$H}EHEHMH ףp= ףHHH HHHH?H)HHHHHHH)HHUHMH ףp= ףHHH HH?HH)HEH}EHMH ףp= ףHHH HHHH?H)HHHHHHH)HHUHMH ףp= ףHHH HHHH?HH)H ףp= ףHHH HHH?H)HEHUHHHHHHH)HHUHMHKY8m4HHHH H?HH)HEL 8Lы H,HƿAѸH}uEHE9L L H۱HƿAѸOH}xH}~9L L HHƿAѸH}xH}<~9L YLzr HMHƿAѸH}xH}<~6L LSr HHƿAѸ}HEt6L L2r HŰHƿAѸE: EEmE: EEZE EEG]EHcЋEHHH 9} EEE  EE EăE}HEHEHtHUHBHEH`HPHEHP}tCHEH@H!)EHEHPEHH)HEHPHEHPEHH)HEHPHEdH+%(tH]UHH`H}HudH%(HE1Ef)E)E)EfEEEЉE̋ẺEEEEċEĉEEE܉E؋E؉EHUHMHEHH)HEH}u HUHMHEHHHEH}u[HUHMHEHHLHEH}u2HEt MUEH}HuI'HUdH+%(tUHHPH}HuHUHMLELMHEHEHEHHEHE<@xHEHHHUHEHHHEHEHu4L LƇq HHƿACHEHHEHH)HEHHEHH9HEH}u4L ZLjt HNHƿAHE HHEH}u["uOLHEHHoHMHPIIйz H˨HƿAHVHEHUHEHPHEH@HEHE'HEHEMHEHUHuAA HHEHEHu4L 0L6 H$HƿAHEHHEHH)HEHHEHH詧HEH}u1L Lsi HHƿAPHUHEHH u1L L HvHƿAHEHEH}tHUHEHHՠHEUHHĀH}HuUMLELMHEHEHEHEHE HEHE(HEHE0HEdH%(HE1HE@%EHEHHEH}uLEMUHEuuMIHHHEHEH@HtQ}uHE%HE} uHE%HEHEE HEHE}}}}}Ԁ}Ԁ}@}@u}t} u`HEH2EEHEHUHuAA HHEHEHuDLhHEHIL.g HQHƿAҸHEHEHEHEH}u4L L HHƿAHULEH}HMHuHEMIHHEHEHHuDLHEHILf H~HƿAҸ@HEHEHEHUHMHHHEHEHuDLHEHILUf HHƿAҸHE<%HEHHEE%}ԀWLHEHP} u HzHYHRILf HuHƿAH3HEHEH}u4L 5L; H)HƿAHEHUHuHѺHhuHUHHEHHtqHEHE}@ttLHEHP} u HH HRILge HHƿAHP}@u HEHHEE HEHE%HEHEHEH}u4L L H HƿAHULEH}HMHuHEMIHHEHEHuALHEHILd HHƿAҸ_HEHEHE%HEHE4L ELd& H9HƿAѸHUdH+%(t脿UHH0H}HuHUHEHHEHEHUHHEHEE}t,CHHUHHuˀ}_tŀ}-tHEHUHHEHHEHH9uHEUHH@H}؉uHUdH%(HE1HEH@HuHEH@HEH@%tHEH@H@HEHEH@H@H@HEHEH@ SHEHEHEHHEHH0H}UHELUIIȹHA҉E} }uLsHEHH`UHHHHHHPHEH@%t HLHQHRILb] HHƿAH}LHEHH`UHHHHHHPHEH@%t H͟HҟHRIL[b HHƿAHHUHEHPHUdH+%(tҼUHSHH}uUHMLED|HEHpHEHhdH%(HE1}u HEH@`HsHEHEHEH@@HE-HE@,9EuHE@9Eu HEHEHEHHEHUHEH@H9uH}HEH@t_UuHEHiHEH}u HEHUHHHHHHEHЋ HEPL}t H UHHHHHHHEHH`UHHHHHHIL` HHƿAҸ0 HE@HHHHHHEHHHEHE@(#|%u@LQHEIL` H>HƿAҸ HEHHHRHEH}u@LHEILu` H؛HƿAҸL HEHHHHUHBHEH@Hu>L{H HUII HeHƿA HpH@HtHpH@u-|%=Hht{HhtnHEHHHUHZH%HCHCHu>LHMHUII HHƿA HEHUHHEЋ|PHpMHEHu;LJHEIL$_ H7HƿA |%HEHHsHEHEHu;LHEIL _ H̙HƿA# HEHUHMHH贻HUHEHHEHHHUHZHMHHHHEHmHEH@HH| L2HEIL^ HHƿAv HEHHHUHMHH誘HEHEHu;LHEIL^ HHƿA |%=B=u=u=_==I@@7t $HpH@HtjHEH@HpHRHHpH@tHpHPHEH@H@HRHHUHEHHHHMHEH@HUHHEH@HuHEAHѺHVLcHEH@HILV] HIHƿAHpH@HtWHpHPHEH@HHHpH@HpH@HPHEH@H@HH蜴HEHUHZ H(HHHuUg"uILyHUHHuII H\HƿAHHEH@H‹uHEAHѺ HtBLHEH@HIL'\ HHƿAAHUHEHHHHKHpH@Ht[HpHPHEH@HpH@HpH@HPHEH@H@}HEHUHZH舷fH~H"uILHUHHuIIHHƿAH3Hht^HhHHEH}tIHEH@HEHx fH*HHH fH*XHEH@YHEH@HEH@ /s ^HEH@H‹uHEAHѺ@HtDL HEH@HfHnLUZHHƿA7HUHEHHHHAHpH@HtWHpHPHEH@HHHpH@HpH@HPHEH@H@HHrHEHUHZH肵fH~H"t,HEH@ff/wHEH@f/r vILHUHPHuIIHHƿAHHEH@q Y,HEH@HcHHEH@H‹uHEAHѺHkL(HEILXHHƿAlHhu4L Lo%HבHƿAHEH@HhHHHEH@HuHEAHѺH]L jL;X(H^HƿAHpH@HtWHpHPHEH@HHHpH@>HpH@HPHEH@H@HHHhHEH}u4L Ln3HHƿAHEH@HUHRHHE؋tHEH@H@HUHRHHEH@H‹uHEAHѺHtrL )L2W8HHƿAwLHEIL*W>HHƿA?HEQL L9WFHHƿAHEHHHUHH HUdH+%(tҭH]UHH H}uHE(H}HEH}u6L LVRH HƿAѸ4HEHHEUPEuHEHHvHEUHSHHH}HEL LgHHƿAL bL+hHVHƿAL 3L$ViH'HƿAL L%VjHHƿAL L.VkHɍHƿAL LgVlHHƿAL wLVmHkHƿAL HLVnH<HƿAL LVoH HƿAL LVpHތHƿAL LSqHHƿAHEHHL xL sHlHƿAL ILtH=HƿAHEHHE\HEHEH@HE#HEHHHUHHHEHEHEHHuHEH9EsHEHEHE HEȋuHEHHEHEHHu4L wLUHkHƿAHEH@HEHEH@H9Et"HEHH HH耆t/HEHH*HHEHHEHHHQu4L Ld HNJHƿA0HEHEHHXHEHH ޕHHu4L hL!d H\HƿAHEHHHEH!HEȋ@qHUHRHMHPRuALHHƿH HEHHUHHZHE HEȋL LPHHƿAL oL#HcHƿAL @LH4HƿAL LHHƿAHHEOLHEH@HUHHPILHHƿAHHEHEHHuL zLOHnHƿAL KLRH?HƿAH|HEOLHEH@HUHHPILHHƿAHHEHEHHuL LNHHƿAѐH]UHHHHH@H8dH%(HE1HEHDžxf)EfEHEHUHMH@HHHpHpHu4L LHHƿA]HUHEH)HHuHTHXHHIHHHzHESHEHEHEHHH)sL MLzMHAHƿALHEILPH HƿAHESqTHPXHHHHHHEHE@%HESHEHEHEHHH8rL \LLHPHƿAL-HEILOHHƿAHESHHHP`XHHHHHHEHEHpHH\\uJHHHLHEILOHvHƿAHpHuCHHHL 3LXH'HƿA\%HpL\LxHMHuHHHH}WHHHpHpHL LaHHƿA\%t^HE@%HHHL6HEILXN H#HƿA\%tZHE@%uJHHH#LHEIL7NHHƿA-HE@@tHE@ tHE@=u H`HE=HE@%t HEHE#HE@=u HhHEHEHHHH8LpTXLMHuHHHuWH}WH\WHxWHH0HpHpHu4L L_$HHƿAHpH良H8HD\HxHEH)IHMTXHHuH}WEMHHHEH}u9L L_+HHƿAѸHHHHHvHEH}u9L L^/HHƿAѸHEHUHPHE~LeH@ILX 6HOHƿAL ,LX 7H HƿAH8H@HHUdH+%(tZUHH@H}HuHUdH%(HE1HEHEHMHEкHH誮E}HEHHMHHu>LSHEHILBY OH=HƿAHuHUHEعHHEH}`HE@HEPHEHHM HHu>LHEHILX VH~HƿAHUHEH}HEH0HUHEعHHEH}HEHMȺ HHELHEHILDX _H}HƿAQHEHHEH}tHUHMHEHH.HEHEHEHUHHEHEHUHHUdH+%(tUHH@H}HuHUHMdH%(HE1HEHUHMHEHHHHEH}HEHHMHHu-H}u HEHEHUHHHHErH}u&HEHHHWHEH}t4HEHUHHHjHuHMHUHEHHEHUHHUdH+%(t迚UHH@H}HuHUHMdH%(HE1HEHUHuHEعHHEH}HEHHMHHu-H}u HEHEHUHHHHErH}u&HEHHH(HEH}t4HEHUHHH;HuHMHUHEHHEHUHHUdH+%(t萙UHSHH}HEHH>{HUHHEHHt*HEH(H}H"qHHHucL L>FHzHƿAHEHHtHEHHEHHHsH]UHH@H}HuЉUdH%(HE1HEHEHHtQHEHH@Ht(HEHHPHEHHHH[sHEHH@DHEHu4L LWHyHƿAH}t%HEtHEHHH u HEHỦPHEHHHHEH}u BHMHUHuHEHHu4L ȷLVHxHƿAHEH衦HEHEL uLzHixHƿALFHEILP H3xHƿAL LP HxHƿAHEHHUHP"HEHHHUHHNqHUdH+%(tUHH}HEH@@HEHEPHEPHEHHEHUHEH@H9uHE@(HEP(]UHH H}HuHMHEHHu9L L UHvHƿAѸHEH1HEH@PHEHEHPHEHHjHUB0HEH@8HtTH HEH@8H@@HHHHHLHPHEHxxHEHP8HEH0HMHEIHAHEHHEHUHEHPH9aUHH@H}HuHUHMLEDMH# HdDEH}HMHUHuHEu(uEIHwHHEH}u H}t HEuHEHǀHEqHU HEHH%u8L OL AHCuHƿAHE"HEHU HHEHWHHɋtHEHJHHoujHEHaL L;&HtHƿAHEHHE@(HEP(HEuHMHEHH#uBL NLTR-HBtHƿAHEHyHUHEHHrHEUHH@H}HEHEHEȋ@(HEȉP(HEȋ@(u HEHHnu9L L?HHsHƿAѸHEH@@HE)HEHE؋@9} HE؋@HHEHEHHEHUHEH@H9uHEHEH腊HEH}u4L L|?UHrHƿAHEH@@HE HE؋@(%HE؋@,u HEH@`H HEHE؋@HHHHHHEHH0HEHEȋ@(HE؋HHE؋PH}HuHEIAȉHtHǸ61y4L L>dHqHƿAHE؋@HcHEHHMHH,mL L>hHqHƿAHEHHMHHlu4L WLH>lHKqHƿAXHEHUH@HHuXHEHH0HEHHHclu5L L=rHpHƿAHEHHEHUHEH@H9HEHH {HHku1L nL_=wHbpHƿArHEHHmHEL*HEILY}HpHƿAHEHHUHHiHEH HEHHEHHlUHH}HEH@8Hu HE@0t]UHH0H}HEH@PHEHEH@HEHE؋@(%t1HEH@@(% tHEH@(HUHRRHUHHEHOt1HEH@HEHEH@@9E~HEH@UPHEHHEHUHEHH9^HEHHEHUHEHPH9-HE؋@(HE؉P(UHHH}HE@( t(HE@(%t HEHHEH-UHH`H}HuHEHHEHEHHEERHEH@(UHHEHEH@(UHHEHEH@@( u&HEH@@(@uHEH@@(%t|HEH@ HHEHEH@ HHEHEH;EHEH@@(%@tHEH9Es HEH;Es HEH@ HEHEH@ HEHUHEHHzE}t?HEH@@(%@t}~<5}y(!EHEH@@89EUHH0H}EHEHPHHHEHHH.dHEH}u9L -L^9H!lHƿAѸHEH@PHE"EPUHUHEHHEHHEHUHEHPH9u͋uHEHHѺH茉HEHPHK!HEUHHHEHPHHEPUuҸUHH}HEHHtHEHH@u]UHH}HEHHtHEHH@u]UHHPH}HuHEH@@,u HEH@`H)HEHEHEHEHl HEHH 5HHeHEH@@HHHHHHEHHHHEHHHetjHEHH W5HHeetHHEHH 40HHCet&HEHH 5HH!efL L6/HiHƿAѸ{HE@(HEH@@HHHHHHEHHH+HEH}u9L L64H iHƿAѸHEHHHEHHH;duEL L69HhHƿAHEH詁HEHnHHEHHHcuEL NL5?HBhHƿAHEH:HEH$HEHH )gHHYcu9L ۦL45GHgHƿAѸHE@(u[HEHH tnHHbu9L rL4MHfgHƿAѸNHEH@HEHEH@@EHE@(HEHzHEHEHEH9Es^HEH+EHHEHHMHH;bu9L L4[HfHƿAѸHEHH hHHat"HEHH 1HHau9L @L3aH4fHƿAѸHEHHEHEȾ"HHEH}HEHHMȺHH:aL L3hHeHƿAѸHEHHMHH`sL \L2mHPeHƿAѸ8HEH@@(E}u3HEH@@( uHEH@@(@tEEăHHEHEHH|HEH}u9L L_2zHdHƿAѸEH}MċUHuHEIAȉHfHǸm#y4L =L&2H1dHƿA EHcHEHHMHHg_L L>1HcHƿAEH}MċUHuHEIAȉHcHǸ"y4L qL1HecHƿAAEHcHEHHMHH^u4L Lv0HcHƿAHE@(tiHE@(HEHH iHH%^L L/HbHƿAvHEHXtSHEHH -HH]u1L @L/H4bHƿAHEH*{HEH{UHHH}HEH@HtHEHPHEHHHX[HEH@HEHPH\HEHUHSH8H}HEH@@HE/HEЋ@(%tOHEH@PHE+HEHHHEHEHHEHHEHUHEHPH9uHEЋ@,u HEH@`HyHEHEHHQ[u9L ΟL/H`HƿAѸHEȋ@(HEЋ@HHHHHHEHHH0HEHHH[u4L DL.H8`HƿAHEHH0HEHHHk[u4L L.H_HƿAHEH@PHEHEHHXHEH}t'HUHEHHdHEHVHEHUHPHHuWHEHH0HEHHHZu4L (L,H_HƿAHEHHEHUHEHPH9,HEHH (jHH0Zu1L L-H^HƿAtHHEHHM[ILGHc^HƿHEHHEHUHEH@H9HEH,HEHH9[H]UHATSH`H}HEHE@(%u HEHHEHPH蜶HEHEH@PHEHEHHE?HEHEHEHHEHHWu9L XL+HL]HƿAѸHEHtVHEHH .HHkXu4L LF*H\HƿAEHEH@HEHEHHE_HEHEHEH@@(%+}HEHRt|HEHH ZHHWt&HEHH b#HHWL Lm)'H\HƿAHEHH0HEHHH;Wu;L L),H[HƿApEHUHEHHMHE@(@uHEH=HEHEHEHHEHEHH9EHEH HEHH PHHmVu4L LH(<HZHƿAHEH;EtVHEHH jXHH Vu4L L'AHZHƿABHEHH eHHUu4L 9L:)GH-ZHƿAHEHHVHEHHEHHt$HEHH@D` HEHrDHuALE'LHYHƿHHE@(@uHEHSHEHEHEHHEHEHPH9EHE@(@u HEH8HEHHEVHe[A\]UHHH}HEHPH6UHH H}H}t*HEHHuHEHHWHEHEHEUHHH}HE@ u@L hLoH\XHƿAHE@ PHEP UHATSH H}HuHEH@8HEHEؾ HpRu9L LF%zHWHƿAѸHHEغH #HHStqHMHEغHHRtUHEغH YHHRt6HEغH bHHRtHEHTHEH}uFL $L}$HWHƿAѐHEH#TrHEH@(@ tPLϕHEH@@ PHH{TPALH$HVHƿAHHEH@(H@(HtzHEH@(H@8HtiL]HEH@@ PHHoPAL#H4VHƿAHHEH@P HEH@P HHEH@D` HEH oDHuALe#HUHƿHHEH@P HEH@P HUHEHHOHe[A\]UHHH}HEHH@HHEH@0tHEHPHpt  HEHH@HHHEHH9t9L ޓL$HTHƿAѸHEH@0t6L L$HTHƿAѸqHEHHEHHHu6L 8L>2H,THƿAѸHEHP0P0UHH0H}HEHH@8HEHEHlHEHEHPHEHHHSHEH}u9L L1HSHƿAѸHUHE=HhHEHH@(@ t6L*L [L<HSHƿALHEILN<HRHƿALHEIL<HRHƿAHEHHUHHLUHH H}EHEH:tIHEHu9L 4L:0H(RHƿAѸHEHPHEt EHE@(%t HEHHHE@(%t HEH(HEHItAHEHu1L L/HwQHƿA.HE@( tHEHEHEH4E}t%HEHHtHEHP0P0EUHHH}HEHUHH0}HuоH@SH(GHEH}u9L Ld HPHƿAѸHE(HPHEH}u4L NLO HBPHƿAHEHUHPHEU܉HEHH軦HE@H@PHEH}u1L َL HOHƿAHEHUHHHHEHEHFUHH H}HuEHEH@H@HEHEH@HtEHEHHEHUHEH@HH9uσ}v6L LHOHƿAѸUHHH}HuHEH@Ht-HEH@@(ugHEH@P(HEH@⿉P(LH}uEHEH@(@ t6LsL L7*H`NHƿAҸUHHH}HuH}tiHEH@H@HUHHqMHUHB8HEH@8Hu9L L3HMHƿAѸHEH@Ht7HEH@P(HEH@ډP(HEH@P(HEH@P(HEH@HH}t\HEH@H@HUHHKL 4L:+@H(MHƿAѸ3HEH@(H@(Hu9L LCHLHƿAѸHEH@(@ tPLHEH@@ PHHNJPALGHyLHƿAHLRHEH@@ PHHdPALHH)LHƿAHHEH@P HEH@P HEP0P0HEP0P0UHH0H}HuHUH}u vHEH@@HKHEH}u9L }L[HqKHƿAѸHEHUHPHEH@HtHEP(HEP HEHUHHEHUHPHEHUHP8HEH@HE&HEH@HuHEHUHP(HEHHEHUHEHH9uHEHUHHH HEt tTHUHEHHL YL_(sHMJHƿAHUHEHH;L L(wHIHƿAHUHEHHuhL L'{HIHƿA?L L'~HIHƿA(HEH3HEH@HUHHBUHH}]UHH}]UHHH}HE@0"HE@0HEH@8HtiHEH@P HEH@P LHEH@@ PHHPALHzHHƿAHHEH@(H@8HtzHEH@(H@(HtiHEH@P HEH@P LHEH@@ PHH=PALHGHƿAHHEP0P0UHH H}H}u HEHHEH}u9L {LHoGHƿAѸHEt tRHEHL L%HFHƿAѸHEHL L$HFHƿAѸHEHwuFL rLx$HfFHƿAѸHEHHEH@Ht%HEH@HUR P(HEH@HǀHEH@(HtHEH@(P P HEH@HUHH^?UHH H}HEH@HEHEHHEHEH@(HuHE@ HEH@HtMHEH@Hu9L GLM#H;EHƿAѸHEHOu9L L#HDHƿAѸHEHEHEHHEHUHEHH9HEuLHEHL L=:HzDHƿAHE@ PHEP UHH H}EH}u*HEH]uEHEH@H[;EUHHH}HuHEHEtHEHU҅uHEUHH}/]HUHcHH% UHH0H}uUHMEsHEH HHMHEHEtXEHHEHHEHHEH\HHHEHEt HEHEEE;ErEUHH}HEHEHEHEEHEHtHE<-uHEH<-u)HEHEHEHEHEHEuHEt HEHHEHEHEHE]UHH0H}HuHUHMLEH}tH}tH}u9L LcHvDHƿAѸH}tfH}t&HUHEHHAHUHHEHHu9L L7DhH DHƿAѸHEHHu6L LLDkHCHƿAѸ@HEHH9HUHHEHH#HUHHEHH UHHHHHHhLpLxt )E)M)U)])e)m)u)}dH%(HH1Dž0Dž40HEH8HPH@H0HHHH{],,x,H;r,HHdH+%(tW^UHH H}HE/HYHEH}t HEHHEUHH`H}HuHUdH%(HE1EEHHVHEHEHH}u EHMHuHHVHHQHFHAEHcHMHUHEH_\Eԃ}xE;E|JHEHX}yEEԃEЋEHH?VHEH}udEm}~CHEH\HHEHHEHHuHEHWHEH|W HEHUHEԃHUdH+%(t\UHHHHH`HhLpLxt )E)M)U)])e)m)u)}dH%(HH1Dž0Dž40HEH8HPH@H0HHHH,,HHdH+%(t[UHH}HuHU؉MDEHEHEDHE9EtHE9EuHE؋PHE؉HEHEHHPHEHHEu]UHH}HuUEHEHUHEH9EuEHEHEH;Er׋E]UHH0H}dH%(HE1HEEHUHuHEA\"HEHcHEHHUdH+%(tZUHH}HuUMDE^HE9EtHE9Eu}tHEHHHHUH UHUHBHEHEHHpHMH1HEu]UHH}ЉʈUEE:EHEEE:Et E:EHEHPHUHEHEHPE@E:Eu(HEEE:Et E:Eu EEHEHEUHEHEHPHUE}uHEHEHPHUE}6]UHH}HuHU؉LEȈEHEHEEUHEHEE:Eu*HEEE:Et E:EuEEHETH}t<E:Eu3EHHEHHHuEHHEHHEHEEH;EiHEHPHUUHEHPHUE}/HE]UHHH}HuHuHEA--HUUHHPH}HuHUHMdH%(HE1HEEHUHuHEA-HHUHuHEA-HH}t3HEt(HUHuHEA-HoE܃E܋EHcHEHHEHUHEHH0HEH}uQLwHEHuuuIL _H:HƿAH HEHEHUHEHH|HEHPHU-HUHEHHZH}t8HEt-HE<_tHEHPHU-HUHEHHHEHEHUdH+%(tVUHSH8H}HuHUHMH}u HHEHEHPHHEHPHHEHrPHHHEHUHEHH/HEH}uGLvHEuuIL~ H}9HƿAHIHEt Ht HHuHMHUH}IIH%7HƸ]PHEH]UHH H}HudH%(HE1HEHEHuHEA\"H HEHEHUdH+%(tTUHHH}HE\"HbUHHPH}HuHUdH%(HE1H8HEHEHEHEHUHuHEIй\HH}t HUHEHH}t HUHEHHEdH+%(tSUHH H}HuHUHUHuHEHѺHTHtH}tHEHPHEHUHEME\E~  fT f/]UHHHhH`ЉXLPDL\dH%(HE1DžtHDžHDžHDžƅsHcHHH HHHHHhH+HHu;L rLHT6HƿAHXunDžxT\J‹xHHHHHH-@H9uDžtxxvDžxBxHHHHHH-@H8\u DžtxxvtuWDžxBxHHHHHH-@H8\u DžtxxvtufDžxQ\H‹xHHHHHH-@H9u DžtxxvH`uytu DžxLt)txЋUHHHHHŰHHHH4HHϸdKHH` tHP\ƅHsHHHPHPts8\tXL ps\HPAL8Hi3HƿAHHHPH\Ht \RuHDžDžtHDžDžtXu DžtHHHHHHHHDžx!HHHxxwH`H;rƃx\Rt \rH`Hx fH*HHH fH*X  YHHx fH*HHH fH*X^݅Hd$<$\OHݝ@݅Hd$<$_IHݝ88@uH0HDžLtxЉHHHHHH-@HEBtSu Dž| Dž|Lt)txЋUHHHHHŰH }H`Hx fH*HHH fH*XHHx fH*HHH fH*X^fH~Ƌ|HHIfHnAHH0HǸACHHUdH+%(tLUHHPH}HuUHMdH%(HE1HEfEH}t HEHUHFHHEHHH%HUHEHHhOfH~HEHEH9Eu HEȺ HUJHEHEHxfH*fH~HHH fH*XfH~Ef(fHnt fEHEHEHE}t$HEtHEHt H}uHEHEHEUHEB2HH^ HHR H>HEHEHEHEHEHEHEHEHEHE@HHExHHEhHHEXHENHE@BDHEʚ;:HHE*HƤ~HEHd HE H}tHEHPHEHHEffHnt HEHEaHEHx fH*HHH fH*XYEf/l sH, [ \H,HH1HUdH+%(tHUHH0H}HuHUH}u9L iLH-HƿAѸHE H+*HEH}u9L hLH-HƿAѸ@HEHpHEHHHUHEIH5k-HǸsEE}t}u!}HEуP ʈPHEH/-HHGuHEPPHEH -HHGuHEPPzHEH,HHVGuHEPPPHUHEHH>"LgHEIL0HV,HƿAҸHEHUHUHHH}uHEH}t)EPUtHE HEHEH}uHEUHH H}EH}t HEu #EHEHkHEH}uEUHH`H}HuHUdH%(HE1HHEHEEHEH^Eԃ}w4L NfLTiH+HƿAH?+HEHEHHEH}t$HUHEH EHHǸBt4L eLnH*HƿAHHEHEHH&HEH}u4L teLzrH9*HƿAHEH+EHHEHH&HUHB(HEH@(Hu4L eLuH)HƿAWẼHcHEHH!&HUHB0HEH@0Hu4L dLxHu)HƿAH HEHEHpHEL@HEHx0HEHH HEHP(HEHVMIH5h)HǸ=AHt4L dL#H(HƿAc}HHEHEHzHEH}tHEH^HEH}u4L cLHa(HƿAHEH+EHHEHH$HUHB8HEH@8Hu4L 9cL?H'HƿAHEHHHEHP8HEH50HǸ?t4L bLH'HƿA}v\H'HEHEH9HEH}HEHP@HEH #HHǸg?HEHUHHEHPHEH@H9HEHP0EHHL&^HHƿAH@HERL=HEH@ HUHPILveHMHƿAHHEHHEHUH#@H9uH7:Ho L h=LiHHƿAUHH}HE@<]UHHH}uHE@HE@$t%HEHP0HEHH0HEH@0HHX=HEH@0HHEH@0HHHEH@0HHHrHE@$t%HEHP8HEHH8HEH@8HH=HEH@8HHEH@8HHHEH@8HHHHE@$tHE@$tHE؉P$iHEH@0HHEH@0HHHEH@0HHHHEH@8HHEH@8HHHEH@8HHH]HEP$HE؉P$HEHP0HEHH0HEH@0HHΖHEHP8HEHH8HEH@8HH論HE@$u HE@$tHE؉P$hHEH@0HHEH@0HHHEH@0HHHHEH@8HHEH@8HHHEH@8HHH\HE@$HEHP0HE؋@ HHHʋ2HU؋R HUHR0HH ΉHEHP8HE؋@ HHHʋ2HU؋R HUHR8HH ΉHE@$/L v2LHGHƿAHE؋t'EsHEH@(UHHHHEHEH@8UHHЋUЃ!Ѕt#HEHP0HEHH@HEH@@HHzEHE@ 9ErEsHEH@(UHHHHEHEH@8UHHЋUЃ!Ѕt#HEHP0HEHH@HEH@@HHEHE@ 9ErEHE@9EUHHH}HEH1UHH H}HuHUHEHEHHUHBHEH@Hu6L 0LHcHƿAѸOHEHHEHHHEH@HHHNHEHHE@HEUHH@H}HuЉUEHEH@HEHE؋UHcHH HEH@HUHH HEH@H}E}u"HEH@(UHcHHHP(HEЉPHEH@(UHcHHHHP@HEHPHEHPHHEHEH@UHܒE}o}HEHPHPHEHHHH)HEH};HEH@8HHEH}u9L .LHHƿAѸ<HEHPHHHEHHHUHH)HEHPHEH@0HMHHYHEH}u9L !.L'HHƿAѸHEHXHu'HEHUH`HEH`HEHX!HEH`HUHHEHUH`HEЋUHcHJHUHTHEHPHHEHPHHUHH0H}HuHE؋@ EHEH@0UH)HUHHHEHHHu9L ,LHHƿAѸ`HE؋P HEH@0HHUHPHEHPHu9L x,L~HIHƿAѸEHE؋P HEH@0HuHU؋MHcHHHE؋UHcHHHu9L +LHHƿAѸoE}tEHEH@UHHHHEHEHEH@HAE}HE؋UHcHHHE@ HHHʋ2HUR HU؋MHcHHʃHH HEH@UH譎E}yEHE؋@9E(HEH@8HHEH}u9L *L(H|HƿAѸ&HEHUHHEH@0HHHEHHHUHH%HEHP0HEH@0HMHHOHUH`HEH`HEHXHEHXHu6L )L/HHƿAѸoHE؋P HEH@0HHUH@HEH@Hu6L )L2HXHƿAѸUHH H}HEHXHHEHXHEHPHHEHPHHjETUHMHEHHu6L (LIHHƿAѸ,E}~HEHXHEH}.UHH`H}HuUHEHEHEHEhHHEH}u9L (LZHHƿAѸ@E0EHHEHHHHUHHHE؃EE;ErHEHPHEHH~HEHEHEH}u4L u'L{cHFHƿAEVEHHEHHHEйH5!HǸHHEЋE9EsHEHPHU|EE;ErHUHMHEHH,HEH}u4L &LmHHƿAHEHUHP8HEHUHP0HEHHEPHEH HUB HEHHE@HHEHHHUHBHEH@Hu4L &L wHHƿAHE@ HHEHHHUHB(HEH@(Hu4L %LzHkHƿAHUHEHHYHEHXu1L C%LIHHƿAZHEHHUHEHHu1L $LHHƿAHEHUHEHHKUHH0H}uHUHMЋEHEHcHHDHEH}EHMHEHH:u9L A$LGHHƿAѸEHEHcHHDHEH}u HE@uRHMHEHHu6L #LHHƿAѸ-HE@tHEPHEЋ9~ HEPHEЉHEUHH0H}HudH%(HE1HEHHEEHEHPHHEHPHHiHMHUHEؾH+HEH}tV.HEHMHUHEHHEH}t.HEHEuHMHUHEؾHEHUdH+%(tUH}EEE]UHH}HuHU-HEH@H9EuHEHEHEH@HEH}u̸]UHH0H}HudH%(HE1HEH@HUHMHHquHEH@HUHMHHRtEHEHHUHEH}u6L T!LZH%HƿAѸLHE؋@PHE؉PHE؋PHEHEHUHPHEHPHEHPHEHUHPHEHUdH+%(tEUHH}HEHEH@HtDHEH@HEHEHPHEHPHEHPHEHPHEHUHPHEH@HEHE]UHSH}uEËE1H]UHH H}EkHE@H‰‹E։EE7HEUHcHHTHEHH‹E։_EE}~HEHHEH}zEUHHPH}dH%(HE1EH|HHEH}u9L ;LA-H HƿAѸHEHu1L L0HHƿAyHEHEHEHEEHEHHEHHu1L L8HYHƿAHEH'EHEHEHUdH+%(tUHH H}uHUHE@HEHPHEHPHEH@HHEH@HHEHEHPEHHHʋ2UHUHRHH ΉUHH0H}EEEHEH@HEHEH@ H9EuHE@+HE^8$]$:QHHWHHKH>| HEHE<^ucHEH@HHEH@HHHEH@HHEH@HEHEHEH@HHEH@HHqHE<\uLHEHEtt#t'ntrt E E E HEEzHE<-ue}t_EHEHEH@ H9Eu9L LHHƿAѸpHEE HEE}E:EEEEEEE}tOHEHPEHHHʋ2U҉HUHRHH!ΉKHEHPEHHHʋ2UHUHRHH ΉEEE:EIE}tOHEHPEHHHʋ2U҉HUHRHH!ΉKHEHPEHHHʋ2UHUHRHH ΉHEEEHEH@ H9EsHE<]rHEH@ H9ErHE@zHE@HEHPHEHPUHEHE؉PHEHPHEHP/HUHEؾHHUHEؾHHE@HEHPHEHPHEH@HHEH@HH/HEH@HHEH@HHEH@HHEH@H߉HEH@HHEH@HKHEHEH@ H9ErDL 3LHHƿAHE@HE@HEHPHEHPHEH@HHEH@HH(HEttYtuntrt&iHEH@HHEH@HHEH@HHEH@H HEH@HHEH@HgHEHPHEHHЋHEHEHHHEHH HE@HEHPHEHPHEH@HHEH@HHHEHPHEHHЋHEHEHHHEHH UHH0H}uHUHMHEHH$HEH}tg}u@HEHvHUHBHEH@HuHUHEHH$%HEUHEHUHPHEHUHPHEUHH H}HE@t(HEHHHEH}u9L L4HNHƿAѸHEH@HHEH@HHHEH@HHHHEH tHEHHEH3HEHE@)t6L RL>HHƿAѸHEHHEHEUHH H}HEHHEH}u HE@?tW?u*t+t%iHEHHUHHELHEHHUH~HE)HEHHUH[HEHEVH}u6L <LBeHHƿAѸHEHHEHEUHH0H}HEHHEH}u HE؋@|uHEwHEHHEH}uHEZHEHHMHUH{HEH}u/L dLj|HHƿAHEUHH0H}HEH(HEH}u HE؋@|t HEHEHkHEHHEH}u6L LHHƿAѸZHEHHMHUHHEH}u/L iLoHHƿAHEUHH}uE E}t HEH@HEH@HEHEt3}tHEH@HuHEH@Ht}uHEuE]UHHH}HuHEHE9t HEHH­HHH>HEHPHEH@HHt)HEHPHEH@HHft HEHPHEH@HH3vHEH@Hu&HEHPHEH@HHqt;4L LHHƿAѸUHH@H}HuHUȉMHEH@HEHEH@HEUHEHEUHEHE }t HEH@HEH@HEmE9Es-HEu }t HEH@HEH@HEmE9Es HEu͋E;EHEufHEu\}t HEHPHEHP}t HEH@HEH@HHtHEHUHHEHUHaHEtQHEtF}t HEH@HEH@HE}t HEH@HEH@HEm}4UHH}uHEu}t HEH@HEH@t }t HEH@HEH@HE}tn}t HEH@HEH@HUHB}t HEH@HEH@HUHB}t HEH@HEH@HUHBHEHUHPl}t HEH@HEH@HUHB}t HEH@HEH@HUHB}t HEH@HEH@HUHBHEHUHP]UHH@H}HuHUHMDẼ}t6}t HEH@HEH@HUH}HH¾4HE1}t HEH@HEH@HUH}HHEH}u6L LH:HƿAѸ\}t HEH@HEH@HMغHHH}t HEH@HEH@HMкHHHHEUHH@H}HuHUdH%(HE1HEЋHH~HHrH>HEHHHUHEHHHUHBHEH@Hu9L Lө1HHƿAѸzHEHHHUHEHH#HUHBHEH@H;L ` Lf4HHƿAѸ HEHHHUHEHHHUHBHEH@HL L<HCHƿAѸHEHHHUHEHHIHUHBHEH@Hu9L LBHڢHƿAѸ7HEHHHUHEHHHUHBHEH@Hu9L ! L'EHqHƿAѸHUHuHEйH]tCHEоHu"HMHUHuHEAHHEHEiHUHuHEйHtLHEоHu"HMHUHuHEAHHEHE HEHUdH+%(tUHH H}HudH%(HE1EHUHMHEHHmHEH}tEuHEHUdH+%(t UHH0H}HuHUHE(HHEH}u9L cLi}HHƿAѸlHEHUHHEHfhHUHBHEH@HuLL LҠHIHƿAHUHEHH]HEHUHPHEHUHP HEHHEHNHEH}uIL rLHŸHƿAHUHEHHkHUHEHHHEH}uIL LH[HƿAHUHEHHoHEUHHH}HuHEHHUHHMHEHHUHH}uOHEH9EsHEHHHE0HEH;EsHEHHHEHEHHHE HEHHuHE]UHH H}HuHEHHEHEE$HEHPHUHEHGHEmHEHHt}uHEHHt HEHH@ UHH H}uHE(HHEH}t HEUHEUHH0H}HuHUHEHHEHEEHEHPHUEUHEHHEmHEHHt}uHEHHEHEH@UH+HUHHEHHu6L L[H/HƿAѸK}t HEHPHUEHEHHHEEPUkHEHHUHP UHH H}uHEHZHEH}u6L LmH}HƿAѸUHEHEHUHPHEUHHH}HEHƿUHH}HuHU.HEtHEHE8t HEHEHEH;EuHE]UHH(H}HuHUHEHEEPEHHHtHHMHEHHTt!EHHHUHEE}vUHH(H}HuHUHEHEE_UHHHHHHHMHEHHt*UHHHHHHHEE}vUHH(H}HuHUHEHEHMHEHHHOt HE.HMHEHqHH(t HEUHH(H}HuHUHEHEE_UHHHHH7HHMHEHHt*UHHHHHH HEE}vUHH0H}HuHUHEHEHE^cHHEHHH%uIHUHHHHHHE0HHHEHEHEH;EuHEHUHUHHH}HuHEHEH;Et(HHEHHH% uHEUHH H}HuHEHEHEHEH;Et(iHHEHHH% tHEH;EtHEUHHH(H H`HhLpLxt )E)M)U)])e)m)u)}dH%(HH1Dž0Dž40HEH8HPH@H(H0H HAHHdH+%(tIUHH@H}HuHUHMLELMHEHHUHHHEH}u&HUHEH 1HHǸhHEHHUHMLEHHAЃt&HUHEH HHǸ{HUHEHHHUHUHHPH}HuHUdH%(HE1HEHEHEHHUHHEH}u (HEȾ(HݽHEH}u%HEH`HHǸHEHUHHHEHEHUHH#HEH}u HEHHHǸiH}uHEHUH)HEHHBHEHUH)HEHH赴HUHHEHHu HEHHHǸHUHEHH"HEHEHPHMHuHEILxHH&H\HEHP HMHuHEILHHHJ!HEHPHMHuHEILHHGHHEHPHMHuHEILHHHHEHPHMHuHEILHHfHutHEHP HMHuHEILHH/Hbu=HEH9EtHEHmHHǸ^HEHUH.H}t"H}uHEHHHEHHUdH+%(t#UHH H}HuEHEtGHEtUHH}HEHUHPHEHPHEH]UHHH}HuHEHHu(H(H$HiHHwH菿HEHUHHEHPHEHPHEH@HUHHEHUHPUHHH}HuHEHHu(HH3HHHHHEHHEHHEHUHPHEHHUHPHEHUHUHH}HEHHUHRHPHEH@HUHH]UHHH}HuHEHHUHEHHUHH}HEHH9E]UHH}HuHEH@H9E]UHH}HuHEHH9E]UHHH}HEH~u HEHUHHH}HEHNu HEH@UHHH}HuHUHEHH1u HEH@UHHH}HuHUHEHHu HEHUHH}EHEHHEEHEHHEHEH;EuE]UHHH}HuHEHHu(HbHHHHH詼HEHHu(H.HHOHHeHuHEHuRHEH@HUHHEHHUHRHPHEH@HUHHHEHPHEHPHEHUHHH}HEHƿUHH H}Hu(蓼HEH}t-HEHE@HEHUHPHEHUHP HEUHHH}HuHEH@HtHEHHHEH@ HUHHѐUHH`H}HHHHHEHUEE!HHHHH>HUHEHHWEHEHEHEHHEHH-HEHHPHEHPEHEHHEHEHEHPHEHEHEHü]HEHEE*HEUHHЋHHPHEHẼEHE9ErHEHlHEHEE.HEUHHHЋHHPHEHvẼEHE9ErHEHHEHEE.HE؋UHHHЋHHPHEHẼEHE؋9ErHEH趻SHEHEE*HEЋUHHЋHHPHEHẼE}vHEHdEUHHH}HEHHPHEHzHEH'UHH}HE]UHH@H}HuHUHMLEHEH+E؉E}u*HEHEHUHPHEPHEEHH6HEH}udHEHEHUHPHEUPUHEHHHEHHZHEHEHUHPHEPHEUHH@H}HuHUHMLEHEH+E؉E}uHEHUHP~uHEH}ugHEHUHRHHEHpH}HMHUHEIH tHEH莹HEHEHUHPUHH@H}HuHUHMLEHEH@HEHEHpH}HMHUHEIHUH}uE9ErEE]UHHPH}HuHUHMLEHEH@HEHE@uHEHEHUHPHEHE@8FHEH+EȉHE@։]EE!UHEHHUED8uEE;ErHE@‹EH)HBHHEH}u HE@+EHEPHE@HEHPEH HEHHHH荻HMHEHPHHHQHEHEHUHPHEUPUHEH<HuHMHUHEIHHHIAHEHT0HHEH}u HEPHEPHE@u%HMHEHPHHAHQHEHSHE@HEHHHHEHHH耺HE@PHEPHMHEHPHHAHQHEHEPHEHxHEHHpHMHUHEIHHH7tHEHF%HEHEHEHUHPUHH@H}HuHUHMLEHEH@HEHEcHEH}u 4HEHEHHUHHEHHHEH@HH耾HEHEPHEHxHEHHp@HMHUHEIHHHtHEH.HEHHEHEHUHPqHEHxHEHPHEHH4HMHUHEIHHHt+HEHEHEɈTHEPHEUHHPH}HuHUHMLEHEH@HEHE5HEH}u HEHEH0HjEWHUEDUHUHLHEUHHH HEUHHHHPH@HAHQE}vHEHUHDHEHxHEHHHMHUHEIHHH7tHEHFHEH0HEHEHUHPqHEHxHEHPHEHH4HMHUHEIHHHt+HEHEHEɈTHEPHEUHHPH}HuHUHMLEHEH@HEHE0HEH}u mHE1ESHUEDH}HMHUHuHEIHH}HMHUHuHEIHH}HMHUHuHEIH7H}HMHUHuHEIHH}HMHUHuHEIHAhH}HMHUHuHEIHGH}HMHUHuHEIHw&H}HMHUHuHEIHUHSHhH}HuHUHEH;Eu HMH]HEHH%rHHrH>HEH@HEHEHHHUHEHHwHHkHEH@HEHEH+EHHE@H9} HMH]9E/UHEH0HUED@8t HMH]EHE@9ErHE@HEH HEHUHHHHHEH@HEEPHU؋ETHE8u5HEHpHEHPEHH HEHHqHHeEHE؋9ErIHEH@HEEPHUЋETHE8u5HEHpHEHPEHH HEHHHHEHEЋ9ErHEH@HEHEHUHDE}/HEHpHEHEHH HEHHHHvHEH@HEHEHEHcHHHt?HEHpHEHPHEHH HEHHHHHMH]HHH]UHH0H}HuHUHMHEHHHUHEHHHEHUHUHuH}HMHEIHbUHH H}HuHHEH}u(HoH9HSmHHʘHѧHEHEHEHEHHHEHHHHEHHHEHHHEHHHزHEH̩HEHEHUHPUHH H}HuEHEH}u(HnHIH}lHHHHEHEEkHUEDHEH@HEHEHpHMHUHEHEǀ}t0HE@u%HEHEHUHHPHEH褥E HEH@HEHEH+EHHE@H9} E+UHEHHUED8t EHE@9ErHE@HEH<HuHUHEHHHEǀ}t HEuHEHEHؤETHEH@HEEHUETHE8HEHxHEHPEHH4HUHEHHHcEǀ}HEUHHHuxHE9Es>HEHUHzUȉщ¾yHEHUHzUȉщ¾ZHEPHEHEuHEHأHEEJEHE9E-HEH@HEEHUETHE8HEHxHEHPEHH4HUHEHHHHEHUHzUȉщ¾NHEHUHzUȉщ¾/HEPHEHEwHUHEHH#E!EHE9EHEH@HEHEHUHDEȃ}/"HEHxHEHEHH4HUHEHHHEǀ}HE؋UHHHHHEHUHD0EBHU؋EDHEH@HEHEHpH}HMHUHEIH1EÀ}t0HE@u%HEHEHUHHPHEH膞EsHEH@HEHEH+EHE@։>EE+UHEHHUED8t EE;ErHE@9ErHE@HEHHEHuHMHUH}IHHJEÀ}t HEuHEHEH话EHEH@HEEHUETHE8HEHxHEHPEHH4HMHUHEIHHHEÀ}HEUHHHuxHE9Es>HEHUHzUĉщ¾IHEHUHzUĉщ¾*HEPHEHEuHEH訜HEEEHE9EnHEH@HEEHUETHE8HEHxHEHPEHH4HMHUHEIHHHEÀ}HEUHHHHuvHE9Es>HEHUHzUĉщ¾HEHUHzUĉщ¾HEPHEHEwHUHEHHE[EHE9E>HEH@HEHEHUHDEă}/)HEHxHEHEHH4HMHUHEIHHHNEÀ}HE؋UHHHHHEHUHD0EBHU؋EDHELHEHPHEHѺHAHEH@HEHELHEHHEHѺHAЄt"HEHPHEHHCtHEH@HEHEHUHH HEH@HEE6HEHPEHHHEHHt OEHE9Er6HEH@HEE6HEHPEHHHEHHqt EHE9ErHEH@HEE9HEHEHHHEHHt EHE؋9ErvHEH@HEEKHEЋUHHHt/HEHPEHHHEHHtE}vUHH@H}HuHUHMdH%(HE1HEHHHUHEHH%HEHUHEH9EtHUHEHHtHEHUHHHEdH+%(t!UHH`H}HuHEHHYHHYH>HEPHEHEPHEHEH@HEHEHPHEHHejHEH@HEHEHUHHAFHEH@HEE6HEHPEHHHEHHt EHE9ErHEELHEUHHHt0H+ HHHVH<E}vHEH@HEE6HEHPEHHHEHHIt BEHE9ErHEEPHEUHHHHt0Hj HH HVH{E}vHEHEH@HEEE$HU؋EDHUHEH |HHǸΕHEHEHEHHEH l|HHǸ蟕EHHEpHPHEHXHEHEHEH H-|HՔE3HEHPEHHEH |HHǸEHE@9ErHEHH{HmEHHE0HPHEH_HEHEHEHH{H$E.HUEDHEH e{HHǸqEHE9ErHEHH{H“E+EHHEUHHЋpHPHEHEHE9ErHEHEHEHHzHVE.HUEDHEH zHHǸ裓EHE9ErHEHH6zHE/EHHEUHHHЋpHPHEHEHE9ErHEHEHEHHyH脒E2HU؋ED 4096-byte blocks in a single bio, and are limited to 1500 at a time. Increasing this value may provide better overall performance, at the cost of increased latency for the individual discard requests. The default and minimum is 1. The maximum is UINT_MAX / 4096. Specified the emptry header size in KiB at the front and end of vdo pool device. Enable or disable LVM log reporting. If enabled, LVM will collect a log of operations, messages, per-object return codes with object identification and associated error numbers (errnos) during LVM command processing. Then the log is either reported solely or in addition to any existing reports, depending on LVM command used. If it is a reporting command (e.g. pvs, vgs, lvs, lvm fullreport), then the log is reported in addition to any existing reports. Otherwise, there's only log report on output. For all applicable LVM commands, you can request that the output has only log report by using --logonly command line option. Use log/command_log_cols and log/command_log_sort settings to define fields to display and sort fields for the log report. You can also use log/command_log_selection to define selection criteria used each time the log is reported. List of columns to sort by when reporting command log. See --logonly --configreport log -o help for the list of possible fields. log_seq_num,log_type,log_context,log_object_type,log_object_name,log_object_id,log_object_group,log_object_group_id,log_message,log_errno,log_ret_codeList of columns to report when reporting command log. See --logonly --configreport log -o help for the list of possible fields. !(log_type=status && message=success)Selection criteria used when reporting command log. You can define selection criteria that are applied each time log is reported. This way, it is possible to control the amount of log that is displayed on output and you can select only parts of the log that are important for you. To define selection criteria, use fields from log report. See also --logonly --configreport log -S help for the list of possible fields and selection operators. You can also define selection criteria for log report on command line directly using --configreport log -S which has precedence over log/command_log_selection setting. For more information about selection criteria in general, see lvm(8) man page. Controls the messages sent to stdout or stderr. Suppress all non-essential messages from stdout. This has the same effect as -qq. When enabled, the following commands still produce output: dumpconfig, lvdisplay, lvmdiskscan, lvs, pvck, pvdisplay, pvs, version, vgcfgrestore -l, vgdisplay, vgs. Non-essential messages are shifted from log level 4 to log level 5 for syslog and lvm2_log_fn purposes. Any 'yes' or 'no' questions not overridden by other arguments are suppressed and default to 'no'. Send log messages through syslog. Write error and debug log messages to a file specified here. Record lvm information in the systemd journal. command: record commands that are run. output: record default output from commands. debug: record debug messages from commands. Overwrite the log file each time the program is run. The level of log messages that are sent to the log file or syslog. There are 6 syslog-like log levels currently in use: 2 to 7 inclusive. 7 is the most verbose (LOG_DEBUG). Indent messages according to their severity. Display the command name on each line of output. A prefix to use before the log message text. (After the command name, if selected). Two spaces allows you to see/grep the severity of each message. To make the messages look similar to the original LVM tools use: indent = 0, command_names = 1, prefix = " -- " Log messages during activation. Don't use this in low memory situations (can deadlock). #Smemory#Sdevices#Sio#Sactivation#Sallocation#Smetadata#Scache#Slocking#Slvmpolld#SdbusSelect log messages by class. Some debugging messages are assigned to a class and only appear in debug output if the class is listed here. Classes currently available: memory, devices, io, activation, allocation, metadata, cache, locking, lvmpolld. Use "all" to see everything. #Stime#Scommand#Sfileline#SmessageThe fields included in debug output written to log file. Use "all" to include everything (the default). The fields included in debug output written to stderr. Use "all" to include everything (the default). Maintain a backup of the current metadata configuration. Think very hard before turning this off! Location of the metadata backup files. Remember to back up this directory regularly! Maintain an archive of old metadata configurations. Think very hard before turning this off. Location of the metdata archive files. Remember to back up this directory regularly! Minimum number of archives to keep. Minimum number of days to keep archive files. Number of lines of history to store in ~/.lvm_history. The file creation mask for any files and directories created. Interpreted as octal if the first digit is zero. No on-disk metadata changes will be made in test mode. Equivalent to having the -t option on every command. Default value for --units argument. Distinguish between powers of 1024 and 1000 bytes. The LVM commands distinguish between powers of 1024 bytes, e.g. KiB, MiB, GiB, and powers of 1000 bytes, e.g. KB, MB, GB. If scripts depend on the old behaviour, disable this setting temporarily until they are updated. Display unit suffix for sizes. This setting has no effect if the units are in human-readable form (global/units = "h") in which case the suffix is always displayed. Enable/disable communication with the kernel device-mapper. Disable to use the tools to manipulate LVM metadata without activating any logical volumes. If the device-mapper driver is not present in the kernel, disabling this should suppress the error messages. Location of /etc system configuration directory. When disabled, fail if a lock request would block. Directory to use for LVM command file locks. Local non-LV directory that holds file-based locks while commands are in progress. A directory like /tmp that may get wiped on reboot is OK. Allow quicker VG write access during high volume read access. When there are competing read-only and read-write access requests for a volume group's metadata, instead of always granting the read-only requests immediately, delay them to allow the read-write requests to be serviced. Without this setting, write access may be stalled by a high volume of read-only requests. This option only affects file locks. Search this directory first for shared libraries. Abort a command that encounters an internal error. Treat any internal errors as fatal errors, aborting the process that encountered the internal error. Please only enable for debugging. detect_internal_vg_cache_corruptionNo operations that change on-disk metadata are permitted. Additionally, read-only commands that encounter metadata in need of repair will still be allowed to proceed exactly as if the repair had been performed (except for the unchanged vg_seqno). Inappropriate use could mess up your system, so seek advice first! The segment type used by the short mirroring option -m. The --type mirror|raid1 option overrides this setting. # Accepted values: mirror The original RAID1 implementation from LVM/DM. It is characterized by a flexible log solution (core, disk, mirrored), and by the necessity to block I/O while handling a failure. There is an inherent race in the dmeventd failure handling logic with snapshots of devices using this type of RAID1 that in the worst case could cause a deadlock. (Also see devices/ignore_lvm_mirrors.) raid1 This is a newer RAID1 implementation using the MD RAID1 personality through device-mapper. It is characterized by a lack of log options. (A log is always allocated for every device and they are placed on the same device as the image, so no separate devices are required.) This mirror implementation does not require I/O to be blocked while handling a failure. This mirror implementation is not cluster-aware and cannot be used in a shared (active/active) fashion in a cluster. # Enable mirrored 'mirror' log type for testing. # This type is deprecated to create or convert to but can be enabled to test that activation of existing mirrored logs and conversion to disk/core works. # Not supported for regular operation! The segment type used by the -i -m combination. The --type raid10|mirror option overrides this setting. The --stripes/-i and --mirrors/-m options can both be specified during the creation of a logical volume to use both striping and mirroring for the LV. There are two different implementations. # Accepted values: raid10 LVM uses MD's RAID10 personality through DM. This is the preferred option. mirror LVM layers the 'mirror' and 'stripe' segment types. The layering is done by creating a mirror LV on top of striped sub-LVs, effectively creating a RAID 0+1 array. The layering is suboptimal in terms of providing redundancy and performance. # The segment type used by the -V -L combination. The --type snapshot|thin option overrides this setting. The combination of -V and -L options creates a sparse LV. There are two different implementations. # Accepted values: snapshot The original snapshot implementation from LVM/DM. It uses an old snapshot that mixes data and metadata within a single COW storage volume and performs poorly when the size of stored data passes hundreds of MB. thin A newer implementation that uses thin provisioning. It has a bigger minimal chunk size (64KiB) and uses a separate volume for metadata. It has better performance, especially when more data is used. It also supports full snapshots. # lvdisplay_shows_full_device_pathEnable this to reinstate the previous lvdisplay name format. The default format for displaying LV names in lvdisplay was changed in version 2.02.89 to show the LV name and path separately. Previously this was always shown as /dev/vgname/lvname even when that was never a valid path in the /dev filesystem. Disable event based autoactivation commands. WARNING: setting this to zero may cause machine startup to fail. Previously, setting this to zero would enable static autoactivation services (via the lvm2-activation-generator), but the autoactivation services and generator have been removed. Use async I/O when reading and writing devices. Use lvmlockd for locking among hosts using LVM on shared storage. Applicable only if LVM is compiled with lockd support in which case there is also lvmlockd(8) man page available for more information. Retry lvmlockd lock requests this many times. Applicable only if LVM is compiled with lockd support Size in MiB to extend the internal LV holding sanlock locks. The internal LV holds locks for each LV in the VG, and after enough LVs have been created, the internal LV needs to be extended. lvcreate will automatically extend the internal LV when needed by the amount specified here. Setting this to 0 disables the automatic extension and can cause lvcreate to fail. Applicable only if LVM is compiled with lockd support The command that lvmlockctl --kill should use to force LVs offline. The lvmlockctl --kill command is run when a shared VG has lost access to locks (e.g. when sanlock has lost access to storage.) An empty string means that there will be no automatic attempt by lvmlockctl --kill to forcibly shut down LVs in the VG, and the user can manually intervene as described in lvmlockd(8). The VG name will be appended to the command specified here. The full path to the thin_check command. LVM uses this command to check that a thin metadata device is in a usable state. When a thin pool is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see thin_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_dump command. LVM uses this command to dump thin pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_repair command. LVM uses this command to repair a thin metadata device if it is in an unusable state. Also see thin_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) #S-q#S--clear-needs-check-flagList of options passed to the thin_check command. With thin_check version 2.1 or newer you can add the option --ignore-non-fatal-errors to let it pass through ignorable errors and fix them later. With thin_check version 3.2 or newer you should include the option --clear-needs-check-flag. List of options passed to the thin_repair command. Features to not use in the thin driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: block_size, discards, discards_non_power_2, external_origin, metadata_resize, external_origin_extend, error_if_no_space. # Example thin_disabled_features = [ "discards", "block_size" ] # Features to not use in the cache driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: policy_mq, policy_smq, metadata2. # Example cache_disabled_features = [ "policy_smq" ] # The full path to the cache_check command. LVM uses this command to check that a cache metadata device is in a usable state. When a cached LV is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see cache_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_dump command. LVM uses this command to dump cache pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_repair command. LVM uses this command to repair a cache metadata device if it is in an unusable state. Also see cache_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) List of options passed to the cache_check command. With cache_check version 5.0 or newer you should include the option --clear-needs-check-flag. List of options passed to the cache_repair command. The full path to the vdoformat command. LVM uses this command to initial data volume for VDO type logical volume List of options passed added to standard vdoformat command. Features to not use in the vdo driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: online_rename # Example vdo_disabled_features = [ "online_rename" ] # The full path to the fsadm command. LVM uses this command to help with lvresize -r operations. The method LVM uses to set the local system ID. Volume Groups can also be given a system ID (by vgcreate, vgchange, or vgimport.) A VG on shared storage devices is accessible only to the host with a matching system ID. See 'man lvmsystemid' for information on limitations and correct usage. # Accepted values: none The host has no system ID. lvmlocal Obtain the system ID from the system_id setting in the 'local' section of an lvm configuration file, e.g. lvmlocal.conf. uname Set the system ID from the hostname (uname) of the system. System IDs beginning localhost are not permitted. appmachineid Use an LVM-specific derivation of the local machine-id as the system ID. See 'man machine-id'. machineid Use the contents of the machine-id file to set the system ID (appmachineid is recommended.) file Use the contents of another file (system_id_file) to set the system ID. # The full path to the file containing a system ID. This is used when system_id_source is set to 'file'. Comments starting with the character # are ignored. Perform internal checks of libdevmapper operations. Useful for debugging problems with activation. Some of the checks may be expensive, so it's best to use this only when there seems to be a problem. Use lvmpolld to supervise long running LVM commands. When enabled, control of long running LVM commands is transferred from the original LVM command to the lvmpolld daemon. This allows the operation to continue independent of the original LVM command. After lvmpolld takes over, the LVM command displays the progress of the ongoing operation. lvmpolld itself runs LVM commands to manage the progress of ongoing operations. lvmpolld can be used as a native systemd service, which allows it to be started on demand, and to use its own control group. When this option is disabled, LVM commands will supervise long running operations by forking themselves. Applicable only if LVM is compiled with lvmpolld support. Enable D-Bus notification from LVM commands. When enabled, an LVM command that changes PVs, changes VG metadata, or changes the activation state of an LV will send a notification. The amount of memory in KiB that LVM allocates to perform disk io. LVM performance may benefit from more io memory when there are many disks or VG metadata is large. Increasing this size may be necessary when a single copy of VG metadata is larger than the current setting. This value should usually not be decreased from the default; setting it too low can result in lvm failing to read VGs. Use udev notifications to synchronize udev and LVM. The --noudevsync option overrides this setting. When disabled, LVM commands will not wait for notifications from udev, but continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. If enabled when udev is not running, and LVM processes are waiting for udev, run the command 'dmsetup udevcomplete_all' to wake them up. Use udev rules to manage LV device nodes and symlinks. When disabled, LVM will manage the device nodes and symlinks for active LVs itself. Manual intervention may be required if this setting is changed while LVs are active. Use extra checks in LVM to verify udev operations. This enables additional checks (and if necessary, repairs) on entries in the device directory after udev has completed processing its events. Useful for diagnosing problems with LVM/udev interactions. Retry failed LV deactivation. If LV deactivation fails, LVM will retry for a few seconds before failing. This may happen because a process run from a quick udev rule temporarily opened the device. Method to fill missing stripes when activating an incomplete LV. Using 'error' will make inaccessible parts of the device return I/O errors on access. Using 'zero' will return success (and zero) on I/O You can instead use a device path, in which case, that device will be used in place of missing stripes. Using anything other than 'error' with mirrored or snapshotted volumes is likely to result in data corruption. Use the linear target to optimize single stripe LVs. When disabled, the striped target is used. The linear target is an optimised version of the striped target that only handles a single stripe. Stack size in KiB to reserve for use while devices are suspended. Insufficent reserve risks I/O deadlock during device suspension. Memory size in KiB to reserve for use while devices are suspended. Insufficent reserve risks I/O deadlock during device suspension. Nice value used while devices are suspended. Use a high priority so that LVs are suspended for the shortest possible time. Only LVs selected by this list are activated. If this list is defined, an LV is only activated if it matches an entry in this list. If this list is undefined, it imposes no limits on LV activation (all are allowed). # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # A list of VGs or LVs that should be autoactivated. Autoactivation is an activation command run with -aay, i.e. vgchange -aay, lvchange -aay, or pvscan --cache -aay. When this list is defined, an autoactivation command will only activate LVs included in the list. If this list is undefined, it has no effect. If this list is defined but empty, then no LVs will be autoactivated. LVs can be included in the list by LV name, VG name (applies to all LVs in the VG), or tag name. VGs and LVs can also have an autoactivation property set in metadata, see --setautoactivation. LVs included in this list will not be autoactivated if the VG or LV autoactivation property is disabled (see vgs or lvs "-o autoactivation"). The volume_list setting and the "activation skip" property also apply to autoactivation. The -aay option is meant to be used by activation commands that are run automatically by the system, e.g. from systemd services. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example auto_activation_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # LVs in this list are activated in read-only mode. If this list is defined, each LV that is to be activated is checked against this list, and if it matches, it is activated in read-only mode. This overrides the permission setting stored in the metadata, e.g. from --permission rw. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example read_only_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # This has been replaced by the activation/raid_region_size setting. Size in KiB of each raid or mirror synchronization region. Size in KiB of each raid or mirror synchronization region. The clean/dirty state of data is tracked for each region. The value is rounded down to a power of two if necessary, and is ignored if it is not a multiple of the machine memory page size. Return errors if a thin pool runs out of space. The --errorwhenfull option overrides this setting. When enabled, writes to thin LVs immediately return an error if the thin pool is out of data space. When disabled, writes to thin LVs are queued if the thin pool is out of space, and processed when the thin pool data space is extended. New thin pools are assigned the behavior defined here. Setting to use when there is no readahead setting in metadata. # Accepted values: none Disable readahead. auto Use default value chosen by kernel. # Defines how a device failure in a RAID LV is handled. This includes LVs that have the following segment types: raid1, raid4, raid5*, and raid6*. If a device in the LV fails, the policy determines the steps performed by dmeventd automatically, and the steps perfomed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: warn Use the system log to warn the user that a device in the RAID LV has failed. It is left to the user to run lvconvert --repair manually to remove or replace the failed device. As long as the number of failed devices does not exceed the redundancy of the LV (1 device for raid4/5, 2 for raid6), the LV will remain usable. allocate Attempt to use any extra physical volumes in the VG as spares and replace faulty devices. # Defines how a device failure in a 'mirror' LV is handled. An LV with the 'mirror' segment type is composed of mirror images (copies) and a mirror log. A disk log ensures that a mirror LV does not need to be re-synced (all copies made the same) every time a machine reboots or crashes. If a device in the LV fails, this policy determines the steps perfomed by dmeventd automatically, and the steps performed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: remove Simply remove the faulty device and run without it. If the log device fails, the mirror would convert to using an in-memory log. This means the mirror will not remember its sync status across crashes/reboots and the entire mirror will be re-synced. If a mirror image fails, the mirror will convert to a non-mirrored device if there is only one remaining good copy. allocate Remove the faulty device and try to allocate space on a new device to be a replacement for the failed device. Using this policy for the log is fast and maintains the ability to remember sync state through crashes/reboots. Using this policy for a mirror device is slow, as it requires the mirror to resynchronize the devices, but it will preserve the mirror characteristic of the device. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. allocate_anywhere Not yet implemented. Useful to place the log device temporarily on the same physical volume as one of the mirror images. This policy is not recommended for mirror devices since it would break the redundant nature of the mirror. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. # Defines how a device failure in a 'mirror' log LV is handled. The mirror_image_fault_policy description for mirrored LVs also applies to mirrored log LVs. This has been replaced by the activation/mirror_image_fault_policy setting. Define how a device failure affecting a mirror is handled. Auto-extend a snapshot when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see snapshot_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_threshold = 70 # Auto-extending a snapshot adds this percent extra space. The amount of additional space added to a snapshot is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_percent = 20 # thin_pool_autoextend_thresholdAuto-extend a thin pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see thin_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_threshold = 70 # Auto-extending a thin pool adds this percent extra space. The amount of additional space added to a thin pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_percent = 20 # Auto-extend a VDO pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see vdo_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: vdo_pool_autoextend_threshold = 70 # Auto-extending a VDO pool adds this percent extra space. The amount of additional space added to a VDO pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: Do not mlock these memory areas. While activating devices, I/O to devices being (re)configured is suspended. As a precaution against deadlocks, LVM pins memory it is using so it is not paged out, and will not require I/O to reread. Groups of pages that are known not to be accessed during activation do not need to be pinned into memory. Each string listed in this setting is compared against each line in /proc/self/maps, and the pages corresponding to lines that match are not pinned. On some systems, locale-archive was found to make up over 80% of the memory used by the process. # Example mlock_filter = [ "locale/locale-archive", "gconv/gconv-modules.cache" ] # Use the old behavior of mlockall to pin all memory. Prior to version 2.02.62, LVM used mlockall() to pin the whole process's memory while activating devices. Monitor LVs that are activated. The --ignoremonitoring option overrides this setting. When enabled, LVM will ask dmeventd to monitor activated LVs. Check pvmove or lvconvert progress at this interval (seconds). When pvmove or lvconvert must wait for the kernel to finish synchronising or merging data, they check and report progress at intervals of this number of seconds. If this is set to 0 and there is only one thing to wait for, there are no progress reports, but the process is awoken immediately once the operation is complete. Set the activation skip flag on new thin snapshot LVs. The --setactivationskip option overrides this setting. An LV can have a persistent 'activation skip' flag. The flag causes the LV to be skipped during normal activation. The lvchange/vgchange -K option is required to activate LVs that have the activation skip flag set. When this setting is enabled, the activation skip flag is set on new thin snapshot LVs. How LVs with missing devices are activated. The --activationmode option overrides this setting. # Accepted values: complete Only allow activation of an LV if all of the Physical Volumes it uses are present. Other PVs in the Volume Group may be missing. degraded Like complete, but additionally RAID LVs of segment type raid1, raid4, raid5, radid6 and raid10 will be activated if there is no data loss, i.e. they have sufficient redundancy to present the entire addressable range of the Logical Volume. partial Allows the activation of any LV even if a missing or failed PV could cause data loss with a portion of the LV inaccessible. This setting should not normally be used, but may sometimes assist with data recovery. # Locking is started only for VGs selected by this list. The rules are the same as those for volume_list. Locking is auto-started only for VGs selected by this list. The rules are the same as those for auto_activation_volume_list. Check device sizes are not smaller than corresponding PV sizes. If device size is less than corresponding PV size found in metadata, there is always a risk of data loss. If this option is set, then LVM issues a warning message each time it finds that the device size is less than corresponding PV size. You should not disable this unless you are absolutely sure about what you are doing! When enabled, LVM keeps history records about removed LVs in metadata. The information that is recorded in metadata for historical LVs is reduced when compared to original information kept in metadata for live LVs. Currently, this feature is supported for thin and thin snapshot LVs only. Retention time in seconds after which a record about individual historical logical volume is automatically destroyed. A value of 0 disables this feature. Number of copies of metadata to store on each PV. The --pvmetadatacopies option overrides this setting. # Accepted values: 2 Two copies of the VG metadata are stored on the PV, one at the front of the PV, and one at the end. 1 One copy of VG metadata is stored at the front of the PV. 0 No copies of VG metadata are stored on the PV. This may be useful for VGs containing large numbers of PVs. # Number of copies of metadata to maintain for each VG. The --vgmetadatacopies option overrides this setting. If set to a non-zero value, LVM automatically chooses which of the available metadata areas to use to achieve the requested number of copies of the VG metadata. If you set a value larger than the the total number of metadata areas available, then metadata is stored in them all. The value 0 (unmanaged) disables this automatic management and allows you to control which metadata areas are used at the individual PV level using pvchange --metadataignore y|n. The default size of the metadata area in units of 512 byte sectors. The metadata area begins at an offset of the page size from the start of the device. The first PE is by default at 1 MiB from the start of the device. The space between these is the default metadata area size. The actual size of the metadata area may be larger than what is set here due to default_data_alignment making the first PE a MiB multiple. The metadata area begins with a 512 byte header and is followed by a circular buffer used for VG metadata text. The maximum size of the VG metadata is about half the size of the metadata buffer. VGs with large numbers of PVs or LVs, or VGs containing complex LV structures, may need additional space for VG metadata. The --metadatasize option overrides this setting. Ignore metadata areas on a new PV. The --metadataignore option overrides this setting. If metadata areas on a PV are ignored, LVM will not store metadata in them. Format of LVM command's report output. If there is more than one report per command, then the format is applied for all reports. You can also change output format directly on command line using --reportformat option which has precedence over log/output_format setting. Accepted values: basic Original format with columns and rows. If there is more than one report per command, each report is prefixed with report's name for identification. json JSON format. Do not print empty values for all report fields. If enabled, all fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact only specified fields, use compact_output=0 and define report/compact_output_cols configuration setting instead. Do not print empty values for specified report fields. If defined, specified fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact all fields, use compact_output=1 instead in which case the compact_output_cols setting is then ignored. Align columns in report output. Buffer report output. When buffered reporting is used, the report's content is appended incrementally to include each object being reported until the report is flushed to output which normally happens at the end of command execution. Otherwise, if buffering is not used, each object is reported as soon as its processing is finished. Show headings for columns on report. A separator to use on report after each field. A separator to use for list items when reported. Use a field name prefix for each field reported. Quote field values when using field name prefixes. Output each column as a row. If set, this also implies report/prefixes=1. Use binary values 0 or 1 instead of descriptive literal values. For columns that have exactly two valid values to report (not counting the 'unknown' value which denotes that the value could not be determined). Set time format for fields reporting time values. Format specification is a string which may contain special character sequences and ordinary character sequences. Ordinary character sequences are copied verbatim. Each special character sequence is introduced by the '%' character and such sequence is then substituted with a value as described below. # Accepted values: %a The abbreviated name of the day of the week according to the current locale. %A The full name of the day of the week according to the current locale. %b The abbreviated month name according to the current locale. %B The full month name according to the current locale. %c The preferred date and time representation for the current locale (alt E) %C The century number (year/100) as a 2-digit integer. (alt E) %d The day of the month as a decimal number (range 01 to 31). (alt O) %D Equivalent to %m/%d/%y. (For Americans only. Americans should note that in other countries%d/%m/%y is rather common. This means that in international context this format is ambiguous and should not be used. %e Like %d, the day of the month as a decimal number, but a leading zero is replaced by a space. (alt O) %E Modifier: use alternative local-dependent representation if available. %F Equivalent to %Y-%m-%d (the ISO 8601 date format). %G The ISO 8601 week-based year with century as adecimal number. The 4-digit year corresponding to the ISO week number (see %V). This has the same format and value as %Y, except that if the ISO week number belongs to the previous or next year, that year is used instead. %g Like %G, but without century, that is, with a 2-digit year (00-99). %h Equivalent to %b. %H The hour as a decimal number using a 24-hour clock (range 00 to 23). (alt O) %I The hour as a decimal number using a 12-hour clock (range 01 to 12). (alt O) %j The day of the year as a decimal number (range 001 to 366). %k The hour (24-hour clock) as a decimal number (range 0 to 23); single digits are preceded by a blank. (See also %H.) %l The hour (12-hour clock) as a decimal number (range 1 to 12); single digits are preceded by a blank. (See also %I.) %m The month as a decimal number (range 01 to 12). (alt O) %M The minute as a decimal number (range 00 to 59). (alt O) %O Modifier: use alternative numeric symbols. %p Either "AM" or "PM" according to the given time value, or the corresponding strings for the current locale. Noon is treated as "PM" and midnight as "AM". %P Like %p but in lowercase: "am" or "pm" or a corresponding string for the current locale. %r The time in a.m. or p.m. notation. In the POSIX locale this is equivalent to %I:%M:%S %p. %R The time in 24-hour notation (%H:%M). For a version including the seconds, see %T below. %s The number of seconds since the Epoch, 1970-01-01 00:00:00 +0000 (UTC) %S The second as a decimal number (range 00 to 60). (The range is up to 60 to allow for occasional leap seconds.) (alt O) %t A tab character. %T The time in 24-hour notation (%H:%M:%S). %u The day of the week as a decimal, range 1 to 7, Monday being 1. See also %w. (alt O) %U The week number of the current year as a decimal number, range 00 to 53, starting with the first Sunday as the first day of week 01. See also %V and %W. (alt O) %V The ISO 8601 week number of the current year as a decimal number, range 01 to 53, where week 1 is the first week that has at least 4 days in the new year. See also %U and %W. (alt O) %w The day of the week as a decimal, range 0 to 6, Sunday being 0. See also %u. (alt O) %W The week number of the current year as a decimal number, range 00 to 53, starting with the first Monday as the first day of week 01. (alt O) %x The preferred date representation for the current locale without the time. (alt E) %X The preferred time representation for the current locale without the date. (alt E) %y The year as a decimal number without a century (range 00 to 99). (alt E, alt O) %Y The year as a decimal number including the century. (alt E) %z The +hhmm or -hhmm numeric timezone (that is, the hour and minute offset from UTC). %Z The timezone name or abbreviation. %% A literal '%' character. # List of columns to sort by when reporting 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. devtype_name,devtype_max_partitions,devtype_descriptionList of columns to report for 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. List of columns to report for 'lvm devtypes' command in verbose mode. See 'lvm devtypes -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,lv_attr,lv_size,pool_lv,origin,data_percent,metadata_percent,move_pv,mirror_log,copy_percent,convert_lvList of columns to report for 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,seg_count,lv_attr,lv_size,lv_major,lv_minor,lv_kernel_major,lv_kernel_minor,pool_lv,origin,data_percent,metadata_percent,move_pv,copy_percent,mirror_log,convert_lv,lv_uuid,lv_profileList of columns to report for 'lvs' command in verbose mode. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,pv_count,lv_count,snap_count,vg_attr,vg_size,vg_freeList of columns to report for 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,vg_attr,vg_extent_size,pv_count,lv_count,snap_count,vg_size,vg_free,vg_uuid,vg_profileList of columns to report for 'vgs' command in verbose mode. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_freeList of columns to report for 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,dev_size,pv_uuidList of columns to report for 'pvs' command in verbose mode. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,stripes,segtype,seg_sizeList of columns to report for 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,seg_start,seg_size,stripes,segtype,stripesize,chunksizeList of columns to report for 'lvs --segments' command in verbose mode. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs --segments' command. See 'pvs --segments -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_sizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_size,lv_name,seg_start_pe,segtype,seg_pe_rangesList of columns to sort by when reporting 'pvs --segments' command in verbose mode. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. Use brackets [] to mark hidden devices. Use the two words 'unknown device' in place of '[unknown]'. This is displayed when the device for a PV is not known. libdevmapper-event-lvm2mirror.soThe library dmeventd uses when monitoring a mirror device. libdevmapper-event-lvm2mirror.so attempts to recover from failures. It removes failed devices from a volume group and reconfigures a mirror as necessary. If no mirror library is provided, mirrors are not monitored through dmeventd. libdevmapper-event-lvm2raid.solibdevmapper-event-lvm2snapshot.soThe library dmeventd uses when monitoring a snapshot device. libdevmapper-event-lvm2snapshot.so monitors the filling of snapshots and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the snapshot is filled. libdevmapper-event-lvm2thin.soThe library dmeventd uses when monitoring a thin device. libdevmapper-event-lvm2thin.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when thin-pool data volume or metadata volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The library dmeventd uses when monitoring a VDO pool device. libdevmapper-event-lvm2vdo.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when VDO pool volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The full path to the dmeventd binary. Create a host tag using the machine name. The machine name is nodename returned by uname(2). Replace this subsection name with a custom tag name. Multiple subsections like this can be created. The '@' prefix for tags is optional. This subsection can contain host_list, which is a list of machine names. If the name of the local machine is found in host_list, then the name of this subsection is used as a tag and is applied to the local machine as a 'host tag'. If this subsection is empty (has no host_list), then the subsection name is always applied as a 'host tag'. # Example The host tag foo is given to all hosts, and the host tag bar is given to the hosts named machine1 and machine2. tags { foo { } bar { host_list = [ "machine1", "machine2" ] } } # A list of machine names. These machine names are compared to the nodename returned by uname(2). If the local machine name matches an entry in this list, the name of the subsection is applied to the machine as a 'host tag'. Defines the local system ID for lvmlocal mode. This is used when global/system_id_source is set to 'lvmlocal' in the main configuration file, e.g. lvm.conf. When used, it must be set to a unique value among all hosts sharing access to the storage, e.g. a host name. # Example Set no system ID: system_id = "" Set the system_id to a specific name: system_id = "host1" # A list of extra VG system IDs the local host can access. VGs with the system IDs listed here (in addition to the host's own system ID) can be fully accessed by the local host. (These are system IDs that the host sees in VGs, not system IDs that identify the local host, which is determined by system_id_source.) Use this only after consulting 'man lvmsystemid' to be certain of correct usage and possible dangers. The lvmlockd sanlock host_id. This must be unique among all hosts, and must be between 1 and 2000. Applicable only if LVM is compiled with lockd support Failed to allocate config source.Failed to allocate config file.Internal error: config_file_check: expected file, special file or profile config source, found %s config source.Internal error: config_file_changed: expected file config source, found %s config source.Config file %s has disappeared!Failed to reload configuration filesConfiguration file %s is not a regular fileDetected config file change to %sFailed to allocate configuration check handle.Internal error: override_config_tree_from_string: config cascade already contains a string config.Failed to set overridden configuration entries.Ignoring invalid configuration string.Internal error: _override_config_tree_from_command_profile: config cascade already contains a command profile config.Internal error: _override_config_tree_from_metadata_profile: config cascade already contains a metadata profile config.Internal error: override_config_tree_from_profile: incorrect profile source typeInternal error: config_file_read_fd: expected file, special file or profile config source, found %s config source.Failed to allocate circular buffer.WARNING: Metadata location on %s at offset %llu begins with invalid name.WARNING: Checksum error on %s at offset %llu.Internal error: _cfg_def_make_path: supplied buffer too small for %s/%sWARNING: Configuration setting "%s" has invalid type. Found%s but expected%s.Failed to create default empty array for %s._get_def_array_values: strdup failedFailed to create default config array value for %s.Failed to duplicate token for default array value of %s.Internal error: Default array value malformed for "%s", value: "%s", token: "%s".Configuration setting "%s" invalid. Empty value not allowed.Configuration setting "%s" invalid. Found string value "%s", expected boolean value: 0/1, "y/n", "yes/no", "on/off", "true/false".Configuration setting "%s" invalid. It cannot be set to an empty value.Internal error: inconsistent state reached in _check_value_differs_from_defaultConfiguration %s "%s" is not customizable by a profile.Configuration %s "%s" is customizable by metadata profile only, not command profile.Configuration %s "%s" is customizable by command profile only, not metadata profile.Configuration %s "%s" is not allowed here.Failed to construct path for configuration node %s.Configuration setting "%s" unknown.Configuration section "%s" unknown.Failed to create configuration definition hash.Failed to insert configuration to hash.Configuration setting "%s" invalid. It's not part of any section.WARNING: Configuration setting %s is disabled. Using default value.Internal error: %s cfg tree element not declared as string.Internal error: %s cfg tree element not declared to allow empty values.Internal error: %s cfg tree element not declared as integer.Internal error: %s cfg tree element not declared as float.Internal error: %s cfg tree element not declared as boolean.Failed to create default array node for %s._config_array_line: dm_pool_strdup failed_log_array_value_used: failed to write node value%s not found in config: defaulting to %sInternal error: %s cfg tree element not declared as array._get_config_node_version: couldn't create version string%s# This configuration %s is deprecated. %s# This configuration %s is advanced. %s# This configuration %s is not officially supported. %s# This configuration %s has variable name. %s# This configuration %s does not have a default value defined. %s# This configuration %s has an automatic default value. %s# Value defined in existing configuration has been used for this setting. %s# Available since version %s. %s# Deprecated since version %s. # This is an example configuration file for the LVM2 system. # It contains the default settings that would be used if there was no # @DEFAULT_SYS_DIR@/lvm.conf file. # # Refer to 'man lvm.conf' for further information including the file layout. # # Refer to 'man lvm.conf' for information about how settings configured in # this file are combined with built-in values and command line options to # arrive at the final values used by LVM. # # Refer to 'man lvmconfig' for information about displaying the built-in # and configured values used by LVM. # # If a default value is set in this file (not commented out), then a # new version of LVM using this file will continue using that value, # even if the new version of LVM changes the built-in default value. # # To put this file in a different directory and override @DEFAULT_SYS_DIR@ set # the environment variable LVM_SYSTEM_DIR before running the tools. # # N.B. Take care that each setting only appears once if uncommenting # example settings in this file. # This is a local configuration file template for the LVM2 system # which should be installed as @DEFAULT_SYS_DIR@/lvmlocal.conf . # # Refer to 'man lvm.conf' for information about the file layout. # # To put this file in a different directory and override # @DEFAULT_SYS_DIR@ set the environment variable LVM_SYSTEM_DIR before # running the tools. # # The lvmlocal.conf file is normally expected to contain only the # "local" section which contains settings that should not be shared or # repeated among different hosts. (But if other sections are present, # they *will* get processed. Settings in this file override equivalent # ones in lvm.conf and are in turn overridden by ones in any enabled # lvm_.conf files.) # # Please take care that each setting only appears once if uncommenting # example settings in this file and never copy this file between hosts. Configuration node %s not foundFailed to create default config setting node.Failed to create default config setting node value.Internal error: _add_def_node: unknown typeInternal error: couldn't determine missing config nodes - unknown status of last config check.Failed to create default config section node.Failed to create default config tree.Failed to create temporary config tree while creating full tree.Failed to clone current config tree.Failed to merge default and current config tree._check_profile: profile check handle allocation failedInternal error: Profile %s already added as %s type, but requested type is %s.Internal error: add_profile: incorrect configuration source, expected %s or %s but %s requested%s: bad profile name, it contains '/'.Internal error: add_profile: loaded profile has incorrect type, expected %s but %s foundInternal error: trying to load profile %s in critical section.LVM_SYSTEM_DIR or profile name too longPersistent cache directory name too long.@DEFAULT_SYS_DIR@/@DEFAULT_CACHE_SUBDIR@Persistent cache filename too long.Couldn't create default backup path '%s/%s'.@DEFAULT_SYS_DIR@/@DEFAULT_BACKUP_SUBDIR@Couldn't create default archive path '%s/%s'.@DEFAULT_SYS_DIR@/@DEFAULT_ARCHIVE_SUBDIR@Couldn't create default profile path '%s/%s'.@DEFAULT_SYS_DIR@/@DEFAULT_PROFILE_SUBDIR@WARNING: Configured cache_pool_max_chunks value %lu is higher then recommended %lu.str_list_to_str: string allocation failed.str_to_str_list: string list allocation failed.str_to_str_list: string list item allocation failed.WARNING: async io still in flight.Limit write at %llu len %llu beyond last byte %lluSkip extending write at %llu len %llu limit %llu extra %llu sector_size %lluLimit write at %llu len %llu to len %llu rounded to %lluLimit write at %llu len %llu to len %lluInvalid adjusted write at %llu len %llu adjusted %llu limit %llu extra %llu sector_size %llucouldn't allocate control block_SC_PAGESIZE returns negative value.couldn't create control block setDevice seek error %d for offset %lluDevice seek failed for offset %lluDevice read error %d offset %llu len %lluDevice write error %d offset %llu len %lluDevice read short %u bytes remainingDevice write short %u bytes remainingbcache no new blocks for di %d index %u with >%d errors.bcache no new blocks for di %d index %ubcache unable to insert block in radix tree (OOM?)concurrent write lock attemptedWARNING: _SC_PAGESIZE returns negative value.bcache must have at least one cache blockbcache must have a non zero block sizebcache block size must be a multiple of page sizebcache failed to get block %u di %dref count on bcache block already zerobcache_invalidate: block (%d, %llu) still heldWARNING: bcache_invalidate: block (%d, %llu) still dirty.WARNING: bcache_invalidate: block (%d, %llu) still held.bcache_abort: block (%d, %llu) still heldInternal error: Cannot change not opened DI with FD:%dstruct device allocation failedstruct dm_str_list allocation failedFailed to add allias to dev cache.Couldn't add name to hash in dev cache._get_sysfs_value: %s: no value%d:%d: dm_snprintf failed for path to sysfs dm directory.%s: failed to allocate device list for device cache index.%s: failed to insert device list to device cache index._insert_sysfs_dev: %s: dm_snprintf failedCouldn't add device to binary tree of sysfs-only devices in dev cache._get_device_for_sysfs_dev_name_using_devno: %s: dm_snprintf failed_get_device_for_sysfs_dev_name_using_devno: %s: failed to get major and minor number%s: dm_snprintf failed for path to holders directory.%s: path does not exist, skipping%s: dm_snprintf failed for holder %s device path.%s: failed to find associated device structure for holder %s.%s: failed to allocate dev list item.Found dev %d:%d %s - exists. %.8sCouldn't insert device into binary tree.Found dev %d:%d %s - new alias.Found dev %d:%d %s - new device, path was previously %d:%d.Found dev %d:%d %s - existing device, path was previously %d:%d.Found dev %d:%d %s - failed to use._dev_cache_iterate_sysfs_for_index: %s: failed to get major and minor numberdev_cache_index_devs: dm_snprintf failed.Failed to udev_enumerate_add_match_subsystem.Failed to udev_enumerate_scan_devices.udev failed to return a device for entry %s.udev failed to return a device node for entry %s.udev failed to return a symlink name for entry %s.WARNING: Cannot use dir %s, %s.%s: Failed to insert devices from udev-managed directory to device cache fully%s: Failed to insert devices to device cache fully%s: Symbolic link to directory%s: Different filesystem in directoryCreating list of system devices.devices/preferred_names %s: using built-in preferencespreferred_names patterns must be enclosed in quotesFailed to allocate preferred device name pattern list.Failed to allocate a preferred device name pattern.Preferred device name pattern matcher creation failed.Couldn't create binary tree for dev-cache.Couldn't create binary tree for sysfs-only devices in dev cache.Device '%s' has been left open (%d remaining references).Internal error: %d device(s) were left open and have been closed.Drop alias for %d:%d invalid path %s %d:%d.Ignoring dev with no valid paths for %s.Device path %s is invalid for %d:%d %s.Dropping aliases for device entry %d:%d %s for new device %d:%d %s.Dropping aliases for %d:%d before adding new path %s.dev_cache_get filter excludes %sInvalid devices file name from config setting "%s".Failed to copy devices dir pathFailed to copy devices file pathDevices file not found, ignoring.Failed to lock the devices file to create.Failed to lock the devices file.Failed to read the devices file.Failed to lock the devices file to read.%sdev/block/%d:%d/device/blockFound %s for %d:%d from sys dmCannot access device %s for %d:%d.No device name found from %d:%d.Cannot access device %s from %d:%d.Found %s devno %d:%d expected %d:%d.Device lookup failed for %d:%d %sFailed to create sysfs path for %sUsing primary device_id for partition %s.Cannot open devices file to read.WARNING: devices file has unmatching system id %s vs local %s.WARNING: failed to process devices file entry.device_ids_write create %d edit %d pending %d exists %d version %s devicesfile %sNot creating system devices file due to existing VGs.WARNING: not updating devices file with unparsed version.WARNING: not updating devices file with larger major version.Cannot open tmp devices_file to write.# LVM uses devices listed in this file. # Created by LVM command %s pid %d at %sIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s PART=%d IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s Failed to replace devices file errno %dSkip devices file update (busy).Skip devices file update (changed).WARNING: cannot open devices file to read.check devices file version %s prev %sWARNING: ignoring unknown device_id type %s.WARNING: ignoring device_id name %s.WARNING: ignoring deviceidtype %s which is not available for device.Missing support for DRBD idtypedevice_id_add %s pvid %s matches entry %p dev %sdevice_id_add %s pvid %s matches entry %p dev %s with same pvid %sdevice_id_add %s pvid %s matches entry %p dev %s with same device_id %d %sdevice_id_add %s pvid %s matches entry %p dev %s with same devname %sWARNING: adding device %s with PVID %s which is already used for %s.WARNING: adding device %s with idname %s which is already used for missing device.Using separate entries for partitions of same device %s part %d %s part %d.WARNING: adding device %s with idname %s which is already used for %s.Add device with duplicate PV to devices file?Adding new entry to devices file for %s PVID %s %s %s.Updating existing entry in devices file for %s that matches %s %s.WARNING: devices to use does not include %sdevice_id update %s pvid %s vgid %s to %sMatch device_id %s %s to %s: ignoring idname %sMatch device_id %s %s to %s: using other dm name, ignoring %sMatch device_id %s %s to %s: dm namescompare devices file entries to devicesdevices idname %s previously matched %sdevices entry %s %s devname found but not matchedDevice %s not matched to device_idDevices file PVID %s last seen on %s not found.Devices file PVID %s not found.Devices file %s %s PVID %s last seen on %s not found.Devices file %s %s PVID %s not found.validating devices file entriesDevices file %s is excluded: %s.Device %s has PVID %s (devices file %s)Device %s has no PVID (devices file %s)Device %s has updated name (devices file %s)du for pvid %s unexpected idname %s mismatch dev %sDevices file PVID %s not found on device %s (device PVID %s).Devices file PVID %s not found on device %s.device ids validate checked %d update disabled.device ids validate checked %d trying to update devices file.device ids validate checked %d found no update is needed.Search for PVIDs skipped for %sSearch for PVIDs reading labels on %d devs.WARNING: found PVID %s on multiple devices %s %s.WARNING: duplicate PVIDs should be changed to be unique.WARNING: use lvmdevices to select a device for PVID %s.Devices file PVID %s found on %s.Search for PVIDs other_pvid %d no_pvid %d other_idtype %d.Devices file PVID %s updating IDNAME to %s.WARNING: new device %s for PVID %s is excluded: %s.Search for PVIDs update disabledSearch for PVIDs updating devices fileSearch for PVIDs found no updatesCannot create devices file, missing devices directory %s.WARNING: devices file already locked %dWARNING: devices file lock file already open %dlock_devices_file open errno %dlock_devices_file flock errno %dWARNING: devices file unlock no fdWARNING: devices file unlock not lockedWARNING: devices file unlock errno %dUdev database has incomplete information about device %s.%s: Failed to get external handle [%s].%s: External handle [%s:%p] attached%s: Failed to release external handle [%s:%p]%s: External handle [%s:%p] detached%s: Failed to enable external handle [%s].%s: Failed to disable external handle [%s].%s: using cached size %lu sectorsWARNING: %s: ioctl BLKGETSIZE64 %sWARNING: Failed to open %s to get readahead %s.WARNING: %s: ioctl BLKRAGET %s.Discarding %lu bytes offset %lu bytes on %s. %sWARNING: %s: ioctl BLKDISCARD at offset %lu size %lu failed: %s.Cannot open device %d:%d with no valid paths.%s: Already opened read-only. Upgrading to read-write.dev_open(%s) called while suspendedFailed to open device path %s (%d).%s: fstat failed: Has device name changed?Attempt to close device '%s' which is not open.%s: Immediate close attempt while still referencedFound md ddf magic at %llu wrong crc %x disk %x %sFound md magic number at offset 0 of %s.Found md magic number at offset 4096 of %s.Found md magic number at offset %llu of %s.Found md imsm magic number at offset %llu of %s.Found md ddf magic number at offset %llu of %s._md_sysfs_attribute_scanf fopen failed %s_md_sysfs_attribute_scanf fgets failed %s%s sysfs attr %s not in expected format: %sDevice %s has an unknown md raid level: %dDevice %s stripe-width is %lu bytes.multipath config ignored %d wwidsIgnoring unknown multipath_wwids_file.multipath wwids file not foundmultipath wwids read %d from %smpath hash table creation failed.multipath wwids file disabled.Cannot find '/' in device name.Sysfs path string is too long.Cannot find device name in sysfs path.%s: Device is a partition, using primary device %s for mpath component detectionFailed to get primary device for %d:%d.Sysfs path to check mpath is too long.dm device path to check mpath is too long.dev_is_mpath_component %s holder %s stat result %ddev_is_mpath_component %s holder %s %d:%d does not have dm majordev_is_mpath_component %s holder %s %u:%u already checked as %sbeing mpath.dev_is_mpath_component %s holder %s %u:%u ignore mpath componentdev_is_mpath_component %s multipath wwid %sSysfs path to check mpath components is too long.Failed to create sysfs wwid path for %sDASD disk (IBM S/390, zSeries)User-mode virtual block deviceDistributed Replicated Block Device (DRBD)Ceph rados object as a Linux block deviceSUN's LDOM virtual block deviceStorage Class Memory (IBM S/390)Sysfs dm uuid path for %s is too long.Failed to allocate device type register.No proc filesystem found: using all block device typesFailed to create /proc/devices stringWARNING: /proc/devices line: %s, replacing major with %d.Expecting string in devices/types in config fileMax partition count missing for %s in devices/types in config fileZero partition count invalid for %s in devices/types in config file%sdev/block/%d:%d/loop/partscanSysfs path for partscan is too long.Failed to read sysfs path for %sFailed to read sysfs partition value for %sWARNING: %s: partition path is too long.WARNING: %s: major:minor sysfs path is too long.WARNING: Readlink of %s failed.WARNING: sysfs path for %s is too long.WARNING: sysfs file %s not in expected MAJ:MIN format: %sFound blkid BLOCK_SIZE %u for fs on %sNo blkid BLOCK_SIZE for fs on %sFailed to get offset of the %s signature on %s.WARNING: Failed to get offset of the %s signature on %s. Wiping skipped.Failed to get length of the %s signature on %s.WARNING: Failed to get length of the %s signature on %s. Wiping skipped.Found existing signature on %s at offset %s: LABEL="%s" UUID="%s" TYPE="%s" USAGE="%s"WARNING: %s signature detected on %s at offset %s. Wipe it? [y/n]: Failed to wipe %s signature on %s.Failed to create a new blkid probe for device %s.Failed to step back blkid probe to check just wiped signature.%d existing signature%s left on the device.Fatal error while trying to detect %s on %s.WARNING: %s detected on %s. Wipe it? [y/n]: WARNING: allocation/use_blkid_wiping=1 configuration setting is set while LVM is not compiled with blkid wiping support.WARNING: Falling back to native LVM signature detection.WARNING: sysfs path for %s attribute is too long.WARNING: sysfs file %s not in expected format: %sWARNING: Device %s: %s is %lu and is unexpectedly less than sector.Ignoring invalid vg field in %sIgnoring invalid vgname in %s (%s)Ignoring invalid devname field in %sIgnoring invalid devname in %s (%s)Found PV online %s for VG %s %spvscan[%d] Path %s/%s is too long.Cannot create online file path for %s %d:%d.pvscan[%d] Cannot create online file path for %s %d:%d.Incomplete online file for %s %d:%d vg %s.Incomplete devname in online file for %s.Failed to create online file for %s path %s error %dpvscan[%d] Failed to create online file for %s path %s error %dCannot write online file for %s to %s error %dExisting online file for %d:%dPV %s %d:%d is duplicate for PVID %s on %d:%d %s.pvscan[%d] PV %s %d:%d is duplicate for PVID %s on %d:%d %s.PV %s has unexpected VG %s vs %s.pvscan[%d] PV %s has unexpected VG %s vs %s.Internal error: Path %s/%s is too long.Incorrect VG lookup file %s PVID %s %s.Found PV online lookup %s for VG %s on %sFound PVs online lookup %d for %spvscan[%d] Failed to create %s %dUnrecognised allocation policy %sFull LV name "%s/%s" is too long.%s:%s:%lu:-1:%lu:%lu:-1:%u:%u:%u:%u:%sPV Size %s / not usable %sPV Status %sallocatable%s%s/%s:%s:%lu:%d:-1:%d:%lu:%d:-1:%d:%d:%d:%d--- Historical Logical volume ---LV Name %s%s/%sread/write (activated read only)LV Path %s%s/%sLV snapshot status source of %s%s/%s [%s] %s [%s]LV snapshot status %s destination for %s%s/%sLV snapshot status %s destination for %sLV Status suspendedLV Status %savailable%sCache read hits/misses %lu / %luCache wrt hits/misses %lu / %luLV type Mirror undergoing conversionVG Access %s%s%s%sVG Status %s%sresizable%s:%s:%lu:-1:%u:%u:%u:-1:%u:%u:%u:%lu:%u:%u:%u:%u:%s"%s" %-9s [%-9s used / %s free]Name cannot start with hyphen.Name starts with . or .. and has no following character(s).Name contains invalid character, valid set includes: [a-zA-Z0-9.-_+].Name length exceeds maximum limit of %d.Internal error: Unknown error %d on name validation.error module string list allocation failedFailed to allocate memory for unknown segtypeInternal error: Destroying composite filter while in use %u times.Composite filters allocation failed.%d:%d: filter cache skipping (no name)%s: filter cache skipping (cached bad)%s: filter cache using (cached good)Ignore invalid filter result %d %sFailed to hash alias to filter.Internal error: Destroying persistent filter while in use %u times.Allocation of persistent filter failed.Couldn't create hash table for persistent filter.Allocation of device filter for persistent filter failed.Persistent filter initialised.Pattern must begin with 'a' or 'r'.Invalid separator at end of regex.Filter patterns must be enclosed in quotes.Please remove the lvm.conf filter, it is ignored with the devices file.Please remove the lvm.conf global_filter, it is ignored with the devices file.Internal error: Destroying regex filter while in use %u times.Internal error: Destroying sysfs filter while in use %u times.filter-sysfs disabled: /sys/dev/block not foundNo proc filesystem found: skipping sysfs filtermd filter full %d excluding md component %s%s: Skipping md component device%s: Skipping md component device [%s:%p]%s: Skipping: error in md component detectionInternal error: Destroying md filter while in use %u times.%s: Firmware RAID detection is not supported by LVM natively. Skipping firmware raid detection. Internal error: Missing hook for firmware RAID recognition using external device info source %s%s: Skipping firmware RAID component device%s: Skipping firmware RAID component device [%s:%p]%s: Skipping: error in firmware RAID component detectionInternal error: Destroying firmware RAID filter while in use %u times.Firmware RAID filter allocation failedFirmware RAID filter initialised.%s: Skipping mpath component deviceWARNING: devices file is missing %s (%d:%d) using multipath component %s.See lvmdevices --update for devices file update.Internal error: Destroying mpath filter while in use %u times.No proc filesystem found: skipping multipath filtermpath filter allocation failed%s: Skipping: Partition table signature found%s: Skipping: Partition table signature found [%s:%p]Internal error: Destroying partitioned filter while in use %u times.Partitioned filter allocation failedPartitioned filter initialised.%s: Skipping: Unrecognised LVM device type %luInternal error: Destroying lvm_type filter while in use %u times.LVM type filter allocation failed%s: Skipping: dev_get_size failedInternal error: Destroying usable device filter while in use %u times.Usable device filter allocation failedUsable device filter mode allocation failedUsable device filter initialised (scan_lvs %d).%s: Skipping: error in signature detectionInternal error: Destroying signature filter while in use %u times.Internal error: Destroying deviceid filter while in use %u times.deviceid filter allocation failedCouldn't scan the archive directory (%s).Couldn't create new archive file.Consider pruning %s VG archive with more then %u MiB in %u files (check archiving is needed in lvm.conf).Couldn't create temporary archive name.Couldn't create FILE object for archive.Created path %s/%s is too long.Couldn't create text instance object.Internal error: Passed file path name %s is too long.Couldn't copy archive directory name.Test mode: Skipping archiving of volume group.Cannot archive volume group metadata for %s to read-only filesystem.Archiving volume group "%s" metadata (seqno %u).Couldn't copy backup directory name.Failed to generate volume group metadata backup filename.WARNING: This metadata update is NOT backed up.Test mode: Skipping backup of volume group.Skipping backup of volume group on read-only filesystem.Backup of volume group %s metadata failed.Failed to generate backup filename (for removal).Couldn't create text format object.Failed to find cached info for PV %s.Failed to setup physical volume "%s".Failed to allocate PV list item for "%s".Set up physical volume for "%s" with %lu available sectors.Failed to allocate format instance.Deleting existing metadata for VG %s.Removal of existing metadata for VG %s failed.Failed to duplicate empty name.Failed to allocate structure for scheduled writing of PV '%s'.Format-specific setup for %s failed.Failed to wipe existing label on %sConsider using option --force to restore Volume Group %s with thin volumes.WARNING: Forced restore of Volume Group %s with thin volumes.Cannot restore Volume Group %s with %i PVs marked as missing.Failed to generate backup filename (for restore).Creating volume group backup "%s" (seqno %u).Couldn't create backup object.Internal error: No in use metadata areas to write.Skipping check for current backup, since backup is disabled.WARNING: Failed to generate backup pathname %s/%s.Internal error: problem tracking indentationDoubling metadata output buffer to %u# Generated by LVM2 version %s: %scontents = "Text Format Volume Group"creation_host = "%s" # %s %s %s %s %screation_host_system_id = "%s"Could not allocate memory for string list buffer.Internal error: PV name for uuid %s missing from text metadata export hash table.pv device name size is out of bounds.Internal error: Missing PV for area %u of %s segment of LV %s.RAID segment has non-RAID areasInternal error: Invalid type for area %u of %s segment of LV %s.Could not allocate memory for ancestor list buffer.text_export buffer allocation failedCould not format metadata for VG %s.Error parsing metadata for VG %s.Internal error: Unknown flag set requested.Internal error: Metadata inconsistency: Not all flags successfully exported.Cannot duplicate segment string.WARNING: Unrecognised flag %s in segment type %s.Random lvid creation failed for %s/%s.Reading mda header sector from %s at %lluFailed to read metadata area header on %s at %lluWARNING: wrong checksum %x in mda header on %s at %lluWARNING: wrong magic number in mda header on %s at %lluWARNING: wrong version %u in mda header on %s at %lluWARNING: wrong start sector %llu in mda header on %s at %llustruct mda_header allocation failedFailed to write mda header to %s.WARNING: metadata alignment should be 512 not %lluVG %s %u new metadata start align from %llu to beginning %uVG %s %u new metadata start align from %llu to %llu (+%llu)WARNING: Failed to read metadata text at %llu off %llu size %llu VG %s on %sFound metadata text at %llu off %llu size %llu VG %s on %sWARNING: reading %s mda%d failed to read metadata.WARNING: repair VG metadata on %s with vgck --updatemetadata.VG %s seqno %u metadata write to %s mda_start %llu mda_size %llu mda_last %lluVG %s %u metadata on %s (%llu bytes) exceeds maximum metadata size (%llu bytes)VG %s %u wrapping metadata new_start %llu new_size %llu to size1 %llu size2 %lluVG %s %u metadata area location old start %llu last %llu size %llu wrap %lluVG %s %u metadata area location new start %llu last %llu size %llu wrap %lluVG %s %u metadata on %s (%llu bytes) too large for circular buffer (%llu bytes with %llu used)VG %s %u metadata disk location start %llu size %llu last %lluVG %s %u metadata disk location write1 start %llu size %llu last %llu write2 start %llu size %llu last %lluVG %s %u metadata last align from %llu to %llu (+%u)VG %s %u %s adjusted metadata end %llu extra %u larger than write buffer %lluVG %s %u metadata last align from %llu to %llu (+%u) (wrapped)VG %s %u %s adjusted metadata end %llu wrap %llu extra %u larger than write buffer %lluVG %s %u %s metadata write size %llu %llu larger than buffer %lluVG %s %u metadata write at %llu size %llu (wrap %llu)Failed to write metadata to %s.VG %s %u metadata write at %llu size %llu (wrapped)Failed to write metadata wrap to %sVG %s metadata %scommit %sseq %u on %s mda header at %llu %s.VG %s metadata %scommit %sslot0 offset %llu size %llu slot1 offset %llu size %llu.Failed to write metadata area headerWARNING: Removing metadata location on %s with bad mda header.'%s' does not contain volume group '%s'.Text format failed to determine directory.Couldn't create temporary text file name.Test mode: Skipping committing %s metadata (%u)Committing file %s metadata (%u)Renaming path %s is too long for VG %s.Internal error: read_metadata_location_summary called with NULL pointer for mda_headerMetadata location on %s at %llu has offset 0.Skipping read of already known VG metadata with matching mda checksum on %s.WARNING: metadata on %s at %llu has invalid summary for VG.WARNING: metadata on %s at %llu has invalid VG name.Found metadata summary on %s at %llu size %llu for VG %sCreating metadata area on %s at sector %lu size %lu sectorsPV %s header needs rewrite for new ext versionPV %s header needs rewrite to set ext usedPV init requested data_alignment_sectors %llu data_alignment_offset_sectors %lluPV init config data_alignment_sectors %llu%s: pe_align (%llu sectors) must not be less than pe_align_offset (%llu sectors)PV init final alignment %llu sectors from align %llu align_offset %llu%s: Data alignment must not exceed device size.%s: Bootloader area with data-aligned start must not exceed device size.Setting pe start to %llu sectors after ba start %llu size %llu for %sSetting PE start to %llu sectors for %sSetting pe start to requested %llu sectors for %s%s: Bootloader area would overlap data area.Physical extents (%s) end beyond end of device (%s) %s.PV %s too large for extent size %s.%s: Volume group filename may not end in .tmpCouldn't allocate text format context object.Couldn't allocate text_fid_context.Couldn't create metadata index for format instance of VG %s.No cached vginfo for VG %s and ID %s.Internal error: can't add metadata area with index %u to PV %s. Metadata layout not supported by %s format.struct metadata_area allocation failedstruct mda_context allocation failedInternal error: invalid index of value %u used while trying to add metadata area on PV %s. Metadata layout not supported by %s format.Internal error: metadata area with index %u already exists on PV %s and removal failed.Using limited metadata area size on %s with value %lu (limited by %s of %lu).Metadata area size too small: %lu bytes. It must be at least %u bytes.Failed to wipe new metadata area on %s at %llu len %lluNot enough space available for metadata area with index %u on PV %s.Internal error: can't remove metadata area with index %u from PV %s. Metadata layou not supported by %s format.Failed to move metadata area with index 1 while resizing PV %s.Failed to allocate text format type structure.Couldn't create text label handler.Couldn't register text label handler.Failed to read outdated pv mda header on %sFailed to write outdated pv mda header on %sReading metadata summary from %s at %llu size %d (+%d)WARNING: invalid metadata text from %s at %llu.WARNING: invalid metadata text from file.Skipped parsing metadata on %sFailed to allocate VG fmtdata for text format.Reading metadata from %s at %llu size %d (+%d)WARNING: couldn't read volume group metadata from %s.WARNING: couldn't read volume group metadata from file.There are %d physical volumes missing.Can't process text format file - %s.Found an item that is not a stringCouldn't read uuid for physical volume.Couldn't read status flags for physical volume.Couldn't read dev size for physical volume.Failed to allocate memory for device hint in read_pv.Failed to allocate memory for device_id in read_pv.Failed to allocate memory for device_id_type in read_pv.Couldn't read extent start value (pe_start) for physical volume.Couldn't find extent count (pe_count) for physical volume.Found bootloader area specification for PV %s in metadata: ba_start=%lu, ba_size=%lu.Found incomplete bootloader area specification for PV %s in metadata.Couldn't read tags for physical volume %s in %s.Failed to allocate memory for device hint in read_pv_sum.Failed to allocate memory for device_id in read_pv_sum.Failed to allocate memory for device_id_type in read_pv_sum.Couldn't read 'start_extent' for segment '%s' of logical volume %s.Couldn't read 'extent_count' for segment '%s' of logical volume %s.Segment type must be a string.Cannot duplicate segtype string.Couldn't read segtype for logical volume %s.Couldn't read tags for a segment of %s/%s.Zero areas not allowed for segment %sBad volume name in areas array for segment %s.Missing offset in areas array for segment %s.Bad offset in areas array for segment %s.Couldn't find volume '%s' for segment '%s'.Incorrect number of areas in area array for segment '%s'.Only one segment permitted for snapshotCouldn't read segment count for logical volume %s.segment_count and actual number of segments disagree for logical volume %s.Empty logical volume section for %s.Couldn't read status flags for logical volume %s.Invalid creation_time for logical volume %s.Couldn't read creation_host for logical volume %s.Missing creation_time for logical volume %s.WARNING: Ignoring unrecognised allocation policy %s for LV %s.Adding profile configuration %s for LV %s.Failed to add configuration profile %s for LV %s.Couldn't read tags for logical volume %s.Couldn't use another pool metadata spare logical volume %s.Logical volume %s is pool metadata spare.Logical volume %s is sanlock lv.Removed logical volume structure allocation failedEmpty removed logical volume section.Couldn't read uuid for removed logical volume %s in vg %s.Invalid creation_time for removed logical volume %s.Invalid removal_time for removed logical volume %s.Unknown historical logical volume %s/%s%sCouldn't read origin for historical logical volume %s/%s%sCouldn't get descendants list for historical logical volume %s/%s%sFound empty descendants list for historical logical volume %s/%s%sFailed to allocate list item for historical logical volume %s/%s%sUnknown origin %s for historical logical volume %s/%s%sDescendant value for historical logical volume %s/%s%s is not a string.Failed to find descendant %s for historical LV %s.Lost logical volume reference %sCouldn't read uuid for logical volume %s.Couldn't read minor number for logical volume %s.WARNING: Couldn't read major number for logical volume %s.WARNING: Ignoring invalid major, minor number for logical volume %s.Couldn't find volume group in file.Couldn't create pv hash table.Couldn't create lv hash table.Unrecognised format %s for volume group %s.Couldn't read uuid for volume group %s.Couldn't read 'seqno' for volume group %s.Error reading flags of volume group %s.Failed to allocate memory for system_id in _read_vg.Couldn't read extent size for volume group %s.Couldn't read 'max_lv' for volume group %s.Couldn't read 'max_pv' for volume group %s.WARNING: Ignoring unrecognised allocation policy %s for VG %sAdding profile configuration %s for VG %s.Failed to add configuration profile %s for VG %sCouldn't find all physical volumes for volume group %s.Couldn't read tags for volume group %s.Couldn't read all logical volume names for volume group %s.Couldn't read all historical logical volumes for volume group %s.Couldn't read all logical volumes for volume group %s.Couldn't read all removed logical volume interconnections for volume group %s.Failed to fixup mirror pointers after import for volume group %s.Couldn't find status flags for volume group %s.Couldn't read seqno for volume group %s.%s: Preparing PV label header %s size %lu with%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%sInternal error: %s label header currently requires a data area.struct data_area_list allocation failedstruct mda_list allocation failedWARNING: bad metadata header on %s at %llu.Ignoring mda on device %s at offset %luWARNING: bad metadata text on %s in mda%dFound pv_header_extension version %u on %sWARNING: Scanning %s mda1 found mismatch with other metadata.WARNING: Scanning %s mda1 failed to save internal summary.Found metadata seqno %u in mda1 on %sWARNING: scanning %s mda1 failed to read metadata summary.WARNING: Scanning %s mda2 found mismatch with other metadata.WARNING: Scanning %s mda2 failed to save internal summary.Found metadata seqno %u in mda2 on %sWARNING: scanning %s mda2 failed to read metadata summary.Couldn't allocate labeller object.Couldn't allocate memory for labeller list object.Scanning for labels to wipe from %sFailed to read label from %s sector %llu%s: Wiping label at sector %lluFailed to remove label from %s at sector %lluLabel handler does not support label writesLabel sector %lu beyond range (%ld)%s: Writing label to sector %lu with stored offset %u.Ignoring additional label on %s at sector %llu%s: Label for sector %llu found at sector %llu - ignoring.Label checksum incorrect on %s - ignoringFound label at sector %llu on %sClear pvid and info for filtered dev %sClear pvid and info for no lvm header %slabel scan found duplicate PVID %s on %sWARNING: scan failed to get metadata summary from %s PVID %sDevice open %s has DEV_IN_BCACHE already setDevice open %s already open with di %d fd %dDevice open %d:%d has no path names.Can't open %s exclusively. Mounted filesystem?Drop alias for %d:%d failed open %s (%d)Invalid path %s for device %d:%d, trying different path.scan_dev_close %s no DEV_IN_BCACHE setscan_dev_close %s already closedScanning %d devices for VG infoProcessing data from device %s %d:%d di %dScanned devices: read errors %d process errors %d failed %dFailed to set up async io, using sync io.Failed to create bcache with %d cache blocks.Checking fd limit for num_devs %u failed %dChecking fd limit for num_devs %u want %u soft %lld hard %lldSetting fd limit for num_devs %u soft %lld hard %lldWARNING: permission error setting open file limit for scanning %u devices.WARNING: cannot set open file limit for scanning %u devices.Scanning failed to get devices.Finding online devices to scanNo device found for quick mapping of online PV %d:%d %s PVID %sRepeat dev cache scan to translate devnos.No device found for %d:%d PVID %sSkipping device_id filtering due to devname ids.label_scan_vg_online: read and filter devs%s excluded by devices file (checking PVID).Match device_id %s %s to %s: matching PVIDIncomplete PV list from online files %d metadata %d.Enable full md component check.Filtering devices to scan (nodata)Filtering devices to scan done (nodata)WARNING: metadata may not be usable with current io_memory_size %d KiBWARNING: increase lvm.conf io_memory_size to at least %llu KiBWill scan %d remaining devicesinvalidating devs for any pvs on lvsCannot reopen rw device %d:%d with no valid paths di %d fd %d.Cannot reopen rw device %d:%d with no valid name di %d fd %d.Reopen writeable %s uncached fd %d di %dFailed to open writable %s index %d fd noneFailed to open writeable %s index none fd %dFailed to open rw %s errno %d di %d fd %d.Failed to change to rw fd %s di %d fd %d.reopen writeable %s close prev errno %d di %d fd %d.reopen writable %s di %d prev %d fd %dError opening device %s for reading at %llu length %u.Error reading device %s at %llu length %u.dev_write bcache not set up %sError opening device %s for writing at %llu length %u.Error writing device %s at %llu length %u.dev_set_bytes bcache not set up %sError writing device value %s at %llu length %u.Set last byte mixed block sizes physical %u logical %u using 512Set last byte mixed block sizes physical %u logical %u using 4096# Created empty by %s pid %d %sHints not used with duplicate pvsHints not used with duplicate vg namesUncertain hint for unread device %d:%d %sInvalid hint device %d:%d %s pvid %s had hint pvid %sInvalid hint device %d:%d %s pvid %s had vgname %s no VG info.Invalid hint device %d:%d %s pvid %s had vgname %s no PV info.ignore hints with unknown version %d.%dignore hints with version %d.%d current %d.%dignore hints with different global_filterignore hints with different filterignore hints with different or unreadable scan_lvsignore hints with different devices_file: not enabled vs %signore hints with different devices_file: %s vs %signore hints with invalid devs_hashignore hints with read_hash %u count %u calc_hash %u count %uskip hint hash but found label %sexclude md component from hints %sscan:%s pvid:%s devn:%d:%d vg:%s Wrote hint file with devs_hash %u count %uwrite_hint_file close errno %dget_hints: applied using %d other %d vgname %sToo long locking filename %s/P_%s.Too long locking filename %s/V_%s.Path for locking_dir %s is invalid.LVM_SUPPRESS_LOCKING_FAILURE_MESSAGESFile locking settings: readonly:%d sysinit:%d ignorelockingfailure:%d global/metadata_read_only:%d global/wait_for_locks:%d.File locking initialisation failed.Internal error: Resource name %s is too long.Operation prohibited while --readonly is set.Allowing activation with --readonly --sysinit.Operation prohibited while global/metadata_read_only is set.Internal error: Unknown locking mode %s.File descriptor %d already open in read-only mode, expected write-only or read-write mode.Can't set standard input for log output.Failed to open stream for file descriptor %d.Failed to allocate buffer for stream on file descriptor %d.Internal error: reopen_standard_stream called on non-standard streamWARNING: Ignoring invalid LVM_LOG_FILE_EPOCH envvar "%s".%d %*s %*c %*d %*d %*d %*d %*d %*u %*u %*u %*u %*u %*u %*u %*d %*d %*d %*d %*d %*d %lluWARNING: Cannot parse content of %s.WARNING: Debug log file path is too long for epoch.WARNING: Ignoring invalid LVM_LOG_MAX_LINES envvar "%s".vsnprintf failed: skipping external logging function %s:%d %sAborting. Command has reached limit for logged lines (LVM_LOG_FILE_MAX_LINES=%lu).MESSAGE_ID=3ca432788c374e4ba684b834188eca36Ignoring unrecognized journal value.Internal error: Cache pool %s has undefined cache mode, using writethrough instead.Internal error: Cache mode is not determined.Internal error: Cannot set cache mode for non cache volume %s.WARNING: Data redundancy could be lost with writeback caching of raid logical volume!Using %s chunk size instead of default %s, so cache pool has less than %lu chunks.Chunk size %s is less than required minimal chunk size %s for a cache pool of %s size and limit %lu chunks.To allow use of more chunks, see setting allocation/cache_pool_max_chunks.Size of %s data volume cannot be smaller than chunk size %s.Preferred pool metadata size %s.Cannot use chunk size %s with cache pool %s metadata size %s.Minimal size for cache pool %s metadata with chunk size %s would be %s.Cannot use too small chunk size %s with cache pool %s data volume size %s.Maximum configured chunks for a cache pool is %lu.Use smaller cache pool (<%s) or bigger cache chunk size (>=%s) or enable higher values in 'allocation/cache_pool_max_chunks'.Cannot use locked cache pool %s.Logical volume %s is already in use by %s.Cannot use locked origin volume %s.Cache is not supported with %s segment type of the original logical volume %s.Cache chunk size %s is not in the range %s to %s.Cache chunk size %s must be a multiple of %s.Can't prepare new cachepool name for %s.WARNING: Skippping flush for failed cache %s.Flushing %lu blocks for cache %s.WARNING: Dirty blocks found on read-only cache volume %s.Failed to sync local devices when clearing cache volume %s.Failed to sync local devices after final clearing of cache %s.Internal error: LV %s is not cache volume.Internal error: LV %s is already dropped cache volume.Failed to activate %s to flush cache.WARNING: Cannot detect default cache policy, using "mq".Default cache policy is not available.Detected default cache_policy "%s".WARNING: Cannot detect default cache metadata format, using format: %u.Detected default cache metadata format: %u.Internal error: Cannot set cache metadata format for non cache volume %s.Failed to duplicate policy name.Internal error: Can't set policy settings without policy name.Cache metadata format %u is not supported by kernel target.Internal error: Invalid cache metadata format %u for cache volume %s.Internal error: Extend size can't be 0.The minimum cache size is two extents (%s bytes).Rounding down metadata size to max size %sRounding up metadata size to min size %sRounding up metadata size to full physical extent %sCache data blocks %llu and chunk size %u exceed max chunks %llu.Use smaller cache, larger --chunksize or increase max chunks setting.Internal error: Missing cache policy name.Setting LV %s cache on %s meta start 0 len %llu data start %llu len %llu sectorsSetting LV %s cache format %u policy %s chunk_size %u sectorsWARNING: thin pool data will not be automatically extended when cached.WARNING: manual splitcache is required before extending thin pool data.Replacing chunk size %s in cache pool %s with chunk size %s from profile.Internal error: Failed to wipe cache pool for volume %s.Aborting. Failed to activate cache pool %s.Aborting. Failed to wipe cache pool %s.Aborting. Could not deactivate cache pool %s.Failed to get mem for LV status.Failed to get device mapper status for %sNo device mapper info exists for %sInvalid device mapper status type (%d) for %sLV %s has no suffix for cachevol (skipping rename).Failed to generate new unique name for unused LV %sLV %s segment is not writecache.LV %s writecache segment has no writecache.LV %s writecache segment has no originFailed to activate LV %s for flushing writecache.Failed to sync local devices before detaching writecache.Failed to flush writecache for %s.Failed to get writecache error status for %s.Failed to flush writecache (error %u) for %s.Failed to deactivate LV %s for detaching writecache.Failed to set flush_on_suspend in writecache detach %s.Failed to remove seg in writecache detach.Failed to remove lv layer in writecache detach.Failed to write VG in writecache detach.Failed to get lv_committed in writecache detach.Suspending writecache to detach %sFailed to suspend LV in writecache detach.Checking writecache errors to detach.Failed to commit VG in writecache detach.Resuming after writecache detached %sFailed to resume LV in writecache detach.Deactivating previous cachevol %sFailed to deactivate previous cachevol in writecache detach.Deactivating previous wcorig %sFailed to deactivate previous wcorig LV in writecache detach.Failed to remove previous wcorig LV in writecache detach.Failed to write and commit VG in writecache detach.Failed to set writecache cleaner for %s.Failed to create list of writecache settings.Failed to create metadata LV name.Creating integrity metadata LV %s with size %s.Failed to create integrity metadata LVIntegrity metadata uses more than one segment.LV %s segment has no integrity metadata device.LV %s integrity segment has no originextend not needed for imeta LV %sFailed to build list of PVs for extending %s.Failed to extend integrity metadata LV %sLV %s segment is unsupported raid for integrity.Failed to update and reload LV after integrity remove.Failed to deactivate unused iorig LV %s.Failed to deactivate unused imeta LV %s.Failed to remove unused iorig LV %s.Failed to remove unused imeta LV %s.Invalid raid integrity mode (use "bitmap" or "journal")Integrity requires consistent logical block size for LV devices.Invalid integrity block size, possible values are 512, 1024, 2048, 4096Integrity block size %u not allowed with device logical block size 4096.Using integrity block size %u with unknown device logical block size.Path name too long to get LV block size %sCannot use integrity block size %u with unknown file system block size, logical block size %u, physical block size %u.Using integrity block size %u for unknown file system block size, logical block size %u, physical block size %u.Limiting integrity block size to 512 because the LV is active.Using integrity block size %u for file system block size %u.Integrity block size %u cannot be larger than file system block size %u.Integrity can only be added to top level raid LV.Integrity cannot be added to snapshot origins.Integrity can only be added to raid1,4,5,6,10.raid image must be linear to add integrityFailed to build list of PVs for %s.Failed to activate LV %s to zeroFailed to zero LV for integrity metadata %sFailed to deactivate LV %s after zeroFailed to activate LV to check block size %sFailed to deactivate LV after checking block size %sAdding integrity to raid image %sWriting VG and updating LV with new integrity LV %sWriting VG with new integrity LV %sActivating to start integrity initialization for LV %sFailed to activate integrity LV to initialize.Writing VG with initialized integrity LV %sNew integrity metadata LV may require manual removal.Invalid LV type for clearing integrityWARNING: failed to clear integrity recalculate flag for %s_format_pvsegs: str_list_create failedInternal error: Unknown area segtype._format_pvseggs: extent range dm_snprintf failed_format_pvsegs: extent number dm_snprintf failed_format_pvsegs: list item dm_pool_zalloc failed_format_pvsegs: list item dmsnprintf failed_format_pvsegs: failed to add item to listCannot query non thin-pool segment of LV %s for discards property.Kernel reports unknown discards status %u.lvseg_kernel_discards_dup_with_info_and_seg_status: dm_pool_strdup failed.WARNING: Thin volume %s maps %s while the size is only %s.Internal error: for_each_sub_lv failure.modules str_list allocation failedInternal error: Bad pvmove structureInternal error: Cannot find mirror segment.Internal error: %s is not a RAID imageFailed to find RAID segment for %s%s on %s is not a RAID segmentInternal error: sub-LV %s was not found in raid segmentInternal error: %s is not of RAID typeInternal error: %s on %s is not a RAID segment.Failed to lock logical volume %s.Deactivating logical volume %s.Failed to unlock logical volume %s.LV layout list allocation failedLV role list allocation failedInternal error: WARNING: Failed to properly detect layout and role for LV %s/%s.Generating list of PVs that %s/%s uses:Overriding default 'mirror_region_size' setting with 'raid_region_size' setting of %u kiBReducing region size to %u kiB (power of 2).Using default region size %u kiB (multiple of page size).Adding %s:%u as an user of %s.Failed to allocate segment list.%s:%u is no longer a user of %s.Internal error: Segment %s:%u is not a user of %s.Internal error: get_only_segment_using_this_lv() called with NULL LV.%s is expected to have only one segment using it, while %s:%u uses it %d times.%s is expected to have only one segment using it, while it has %d.Rounding size %s (%u extents) %s to stripe boundary size %s (%u extents).Internal error: alloc_lv_segment: Missing segtype.Remove %s:%u[%u] from the top of LV %s:%u.Failed to unlock vdo pool in lvmlockd.Internal error: Try to set to high area number (%u >= %u) for LV %s.Failed to allocate widened LV segment for %s.Segment extent reduction %u not divisible by #stripes %uInternal error: No single component user of logical volume %s.Dropping snapshot merge of %s to removed origin %s.Dropping snapshot merge of removed %s to origin %s.Internal error: Pool size mismatched data size for %sUnable to deactivate spare logical volume %s.Refusing refresh of partial LV %s. Use '--activationmode partial' to override.Internal error: Removing still active LV %s.Internal error: historical_glv_remove: historical LV %s/-%s not found Historical LV %s/-%s already on removed list Removing historical connection between %s and %s.Log size needs too many extents %lu with region size of %u sectors.Insufficient free space: %lu extents needed, but only %u availableCouldn't allocate new LV segment.Internal error: _alloc_parallel_area called without any allocation to do.alloced_area allocation failedMetadata does not fit on a single PV.Allocating parallel metadata area %u on %s start PE %u length %u.Allocating parallel area %u on %s start PE %u length %u.Failed to find segment for %s extent %uWARNING: Ignoring invalid string in config file entry allocation/cling_tag_listWARNING: Ignoring empty string in config file entry allocation/cling_tag_listWARNING: Ignoring string not starting with @ in config file entry allocation/cling_tag_list: %sWARNING: Ignoring empty tag in config file entry allocation/cling_tag_listPV tags string extension failed.Not using free space on %s: Matched allocation PV tag %s on existing parallel PV %s.Matched allocation PV tag %s on existing %s with free space on %s.Eliminating allocation area %u at PV %s start PE %u from consideration: PV tag %s already used.Parallel PVs at LE %u length %u: %sPV tags string allocation failed.%s allocation area %u %s %s start PE %u length %u leaving %u%s%s.Memory reallocation for parallel areas failed.Not using free space on existing parallel PV %s.Still need %s%u total extents from %u remaining (%u positional slots): %u (%u data/%u parity) parallel areas of %u extents each%u preferred area(s) to be filled positionally.Areas to be sorted and filled sequentially.Found %u areas for %u parallel areas and %u log areas so far.Filled %u out of %u preferred areas so far._allocate called with no work to do!Number of extents requested (%u) needs to be divisible by %u.Not enough PVs with free space available for parallel allocation.Consider --alloc anywhere if desperate.Couldn't allocate areas array.Trying allocation using %s policy.Insufficient suitable %sallocatable extents for logical volume %s: %u more requiredInsufficient suitable %sallocatable extents found for logical volume %s.Found fewer %sallocatable extents for logical volume %s than requested: using %u extents (reduced by %u).Insufficient free space for log allocation for logical volume %s.Couldn't allocate new %s segment.Internal error: _alloc_init called for virtual segment.Internal error: _alloc_init called for non-virtual segment with no disk space.allocation pool creation failedallocation handle allocation failedInternal error: Bad metadata_area_countAdjusted allocation request to %u logical extents. Existing size %u. New size %u.Mirror log of %u extents of size %u sectors needed for region size %s.allocate_extents does not handle virtual segmentsInternal error: Missing allocatable pvs.Metadata format (%s) does not support required LV segment type (%s).Consider changing the metadata format by running vgconvert.Missing segtype in lv_add_segment().lv_add_segment cannot handle virtual segmentsLog segments can only be added to an empty LVCouldn't merge segments after extending logical volume.Can't convert non-striped segment to mirrored.Can't convert striped segment with multiple areas to mirrored.Couldn't allocate converted LV segment.Internal error: Non-pvmove LV, %s, passed as argument.Internal error: Bad segment type for first segment area.Failed to find segment for %s extent %u.Failed to split segment at %s extent %u.Failed to build pvmove LV-type mirror %s.Internal error: Mirror layer must be inserted before adding mirrors.Conflicting region_size %u != %u.Internal error: Non-empty LV passed to _lv_insert_empty_sublvFailed to create mapping segment for %s.Failed to create sub LV name for LV %s.Aborting. Failed to extend %s in %s.Failed to copy tags onto LV %s to clear metadata.Test mode: Skipping wiping of metadata areas.Adding segment of type %s to LV %s.Unable to read sync percent while LV %s is not locally active.Do full resync of extended portion of %s? [y/n]: Failed to get sync percent for %s.Skipping initial resync for extended portion of %sLV %s cannot be extended while it is recovering.%sLogical Volume "%s" already exists in volume group "%s"Cannot rename "%s": name format not recognized for internal LV "%s"Failed to allocate space for new nameCannot rename "%s". New logical volume name "%s" is invalid.Cannot rename internal LV "%s".Cannot rename active VDOPOOL volume %s, VDO target feature support is missing.Failed to allocate space for new name.Failed to generate unique name for unused logical volume.Stripe size cannot be larger than %s.Reducing stripe size %s to maximum, physical extent size %s.Stripe size must be power of 2.Logical volume %s must be activated before resizing filesystem.Logical volume %s must be activated before reducing device size.WARNING: Reducing active%s logical volume to %s.THIS MAY DESTROY YOUR DATA (filesystem etc.)Do you really want to reduce %s? [y/n]: Logical volume %s NOT reduced.Couldn't create LV path for %s.Couldn't generate new LV size string.WARNING: Thin pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: VDO pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: Snapshot autoextend threshold %d%% is set bellow minimal supported value 50%%.Can't extend %s with %s autoextend percent set to 0%%.Can't read state of locally inactive LV %s.Cannot resize external origin logical volume %s.Cannot resize a RAID %s directlyCannot resize logical volume %s while it is tracking a split image.Cannot resize %s LV %s. Convert to more stripes first.RAID module does not support shrinking.Can't resize internal logical volume %s.Can't resize locked logical volume %s.Can't resize logical volume %s while lvconvert in progress.Varied stripesize not supported. Ignoring.Ignoring --resizefs as volume %s does not have a filesystem.Varied striping not supported. Ignoring.Mirrors not supported. Ignoring.Cannot resize logical volume %s with active component LV(s).Cannot reduce LV with integrity.Rounding size to boundary between physical extents: %s.Reducing %u%%VG to remaining free space %s in VG.Specified LV does not have an origin LV.Internal error: Unsupported percent type %u.Converted %u%%%s into %s%u %s extents.VolumeType does not match (%s).Logical volume %s is using mixing segment types %s and %s.Cannot vary number of mirrors in LV yet.Internal error: Missing mirror segments for %s.Please specify number of stripes (-i) and stripesize (-I)Unable to extend "%s" segment type with different number of stripes.Using stripesize of last segment %sStripesize for striped segment should not be 0!Increasing incremention size from %s to %s to fit new VDO slab.Unable to extend %s by %u logical extents: exceeds limit (%u).Reached maximum COW size %s (%u extents).Reached maximum pool metadata size %s (%u extents).Thin pool will use metadata without cropping.Ignoring stripes, stripesize and mirrors arguments when reducing.Unable to reduce %s below 1 extent.New size (%d extents) matches existing size (%d extents).Rounding size (%d extents) up to stripe boundary size for segment (%d extents).Rounding size (%d extents) down to stripe boundary size for segment (%d extents)New size given (%d extents) not larger than existing size (%d extents)New size given (%d extents) not less than existing size (%d extents)New size (%d extents) matches existing size (%d extents)New size for %s: %u. Existing logical extents: %u / physical extents: %u.Snapshot origin volumes cannot be reduced in size yet.Snapshot origin volumes can be resized only while inactive: try lvchange -an.Thin pool volumes %s cannot be reduced in size yet.Thin pool metadata volumes cannot be reduced.Cannot reduce VDO pool data volume %s.Reduce not yet allowed on LVs with writecache attached.Support for online metadata resize of %s not detected.Thin target does not support external origin smaller then thin volume.%sing logical volume %s to %s%sSize of logical volume %s unchanged from %s (%u extents).Size of logical volume %s changed from %s (%u extents) to %s (%u extents).Policy-based resize is supported only for snapshot, thin pool and vdo pool volumes.--poolmetadatasize can be used only with thin pools.--poolmetadatasize for thin-pool metadata cannot be used with size.Also going to resize thin-pool metadata to match bigger data.Ignoring PVs on command line when reducing.Cannot resize %s without using device-mapper kernel driver.Name too long - device not discarded (%s)%s: not found: device not discarded.%s: max bytes and granularity query fails.WARNING: %s: Discarding %s at offset %lu, please wait...Logical volume %s successfully resized.Failed to sync local devices before deactivating LV %s.Failed to allocate generic logical volume structure.Failed to allocate generic logical volume list item.Failed to allocate generic volume list item for indirect glv %sInternal error: %s logical volume %s is not a user of %s.Unable to allocate logical volume structureFailed to generate unique name for the new logical volumeUnable to create LV %s in Volume Group %s: name already in use%s.parallel_areas allocation failedLV %s in VG %s is now visible.Do you really want to remove%s%s%s%s logical volume %s%s? [y/n]: Logical volume %s not removed.Can't remove logical volume %s under snapshot.Can't remove external origin logical volume %s.Can't remove logical volume %s used by a mirror.Can't remove logical volume %s used as mirror log.Can't remove logical volume %s used as RAID device.Can't remove logical volume %s used by a pool.Internal error: Thin LV %s without pool.Can't remove locked logical volume %s.Failed to detach writecache from %sIgnoring update failure of pool %s.Error releasing logical volume %s with pending delete.Unable to deactivate logical volume %s.Detach cachevol before removing.Releasing %slogical volume "%s"Error releasing %slogical volume "%s"%sogical volume "%s" successfully removed.Removing %s %s will remove %u dependent volume(s). Proceed? [y/n]: Failed to obtain merging snapshot progress percentage for logical volume %s.Can't remove merging snapshot logical volume %s.Removing snapshot %s that failed to merge may leave origin %s inconsistent. Proceed? [y/n]: Removing origin logical volume %s with %u snapshots(s).Removing merging origin logical volume %s.Unable to remove %s, volume is merged to %s.Unable to fully deactivate unused cache-pool %s.Removal of pool metadata spare logical volume %s disables automatic recovery attempts after damage to a thin or cache pool. Proceed? [y/n]: Updating logical volume %s on disk(s)%s.Dropping origin_only for %s as lock holds %sFailed to suspend logical volume %s.Failed to revert logical volume %s.Updating logical volume %s in kernel.Problem reactivating logical volume %s.layer segment for %s:%u not found.Incompatible layer boundary: %s:%u[%u] on %s:%u.Removing layer %s for segments of %sLayer status does not match: %s:%u status: 0x%lx/0x%lxLayer boundary mismatch: %s:%u-%u on %s:%u / %u-%u / Internal error: Wrong layer %s in %sInvalid %d segments in %s, expected only 1.Invalid %d area count(s) in %s, expected only 1.Invalid seg_type %d in %s, expected LV.Layer doesn't match segment in %s.Inconsistent extent count (%u != %u) of layer %s.Layered name is too long. Please use shorter LV name.Creating transient LV %s for mirror conversion in VG %s.Creation of transient LV %s for mirror conversion in VG %s failed.Aborting. Unable to tag transient mirror layer.Failed to write intermediate VG %s metadata for mirror conversion.Failed to commit intermediate VG %s metadata for mirror conversion.Failed to resume transient LV %s for mirror conversion in VG %s.Matched PE range %s:%u-%u against %s %u len %uInserting layer %s for segments of %s on %sFailed to insert segment in layer LV %s under %s:%u-%uVolume %s is not active locally (volume_list activation filter?).Failed to sync local devices before wiping volume %s.Name too long - device not cleared (%s)%s: not found: device not clearedFailed to open %s for wiping and zeroing.Wiping known signatures on logical volume %s.Metadata logical volume %s will be fully zeroed.Metadata logical volume %s not fully zeroed and may contain stale data.Initializing %s of logical volume %s with value %d.%s logical volume %s at position %lu and size %lu.%s logical volume %s with value %d and size %s.Internal error: Empty list of LVs given for wiping.Internal error: LVs must be set visible before wiping.Failed to activate localy %s for wiping.Failed to sync local device names after deactivation of wiped volumes.Zero segment type for virtual origin not foundVirtual origin name is too long.ACTIVATION_SKIP flag set for LV %s/%s, skipping activation.WARNING: Read-only activated logical volume %s not zeroed.WARNING: Logical volume %s not zeroed.Signature wiping on logical volume %s not requested.Maximum number of logical volumes (%u) reached in volume group %sMetadata does not support %s segments.Volume group %s does not support tags.Metadata only supports readahead values between 2 and 120.Stripe size may not exceed %s.Can't create %s without using device-mapper kernel driver.WARNING: Skipping zeroing and wipping, compiled without activation support.The extent size in volume group %s is too small to support striped RAID volumes.Reducing requested stripe size %s to maximum, physical extent size %s.Internal error: Unable to create new logical volume with no extents.Unable to create %s smaller than 1 chunk.Number of stripes (%u) must not exceed number of physical volumes (%d)Internal error: Cannot create %s volume without %s pool.Couldn't find volume %s in Volume group %s.Cannot use locked pool volume %s.Rounding size (%d extents) up to chunk boundary size (%d extents).Aborting. Failed to locally activate thin pool %s.Cannot create new thin volume, free space in thin pool %s reached threshold.Origin volume %s not found in Volume group %s.Caching of origin cache volume smaller then chunk size is unsupported.Internal error: Pool LV for cache is missing.Logical volume %s is not a cache pool.WARNING: New %s won't be synchronised. Don't read what you didn't write!Logical volume %s is not a thin pool.Snapshots of locked devices are not supported.Cannot use writable LV as the external origin.Cannot use active LV for the external origin.Couldn't find origin volume '%s'.Can't share virtual origins. Use --virtualsize.Virtual size matching available free logical size in VDO pool.Volume group "%s" has insufficient free space (%u extents): %u required.Setting read ahead sectors %u.Setting device number to (%d, %d).Test mode: Skipping activation, zeroing and signature wiping.Aborting. Failed to activate LV %s.Aborting. Failed to activate LV %s locally exclusively.Failed to suspend thin snapshot origin %s.Failed to resume thin snapshot origin %s.Aborting. Failed to read transaction_id from thin pool %s.WARNING: Metadata for thin pool %s have transaction_id %lu, but active pool has %lu.Restoring previous transaction_id %lu for thin pool %s.Failed to activate thin pool %s.Cannot activate thin pool %s, perhaps skipped in lvm.conf volume_list?Failed to deactivate thin pool %s.Aborting. Failed to activate snapshot exception store.Aborting. Failed to activate temporary volume for VDO pool creation.Aborting. Couldn't deactivate VDO LV %s with skipped activation.Aborting. Leaving cache pool %s and uncached origin volume %s.Reverting created caching layer.LV %s has no suffix for cachepool (skipping rename).Aborting. Couldn't deactivate snapshot COW area %s.Failed to sync local devices before creating snapshot using %s.Failed to activate sparce volume %s.Aborting. Manual intervention required.Failed to sync local devices before reverting %s.Unable to deactivate failed new LV %s. Manual intervention required.Manual intervention may be required to remove abandoned LV(s) before retrying.Internal error: Unsupported creation of cache and cache pool volume.Internal error: Logical volume is not cache %s.Logical volume %s is now cached.Internal error: Creation of pool for unsupported segment type %s.Temporary logical volume "%s" created.LV %s invalid: %s for %s segmentLV %s invalid: %s (is %u) for %s segmentmin recovery larger than max recoveryLV %s invalid: maximum supported areas %u (is %u) for %s segmentDataLV without RAID image flagMetaLV without RAID metadata flagLV %s, segment %u invalid: %s for %s segment.is not referencing cache pool LVhas invalid cache metadata formathas invalid cache's feature flagis missing METADATA_FORMAT flagdoes not support flag ERROR_WHEN_FULL.log LV does not point back to mirror segmentregion size is bigger then LV itselflog LV is not a mirror log or a RAID imagedata LV does not refer back to pool LVmetadata LV does not refer back to pool LVmust not have pool metadata LV setis not flagged as thin pool LVis a thin volume that must not contain thin pool segmentis not flagged as thin volume LVis a thin pool that must not contain thin volume segmentis not referencing thin pool LVexternal LV is not flagged as a external origin LVmerge LV is not flagged as a thin LVmerge LV is not flagged as mergingsets unsupported VDO minimum io sizesets unsupported VDO block map cache sizesets unsupported VDO block map era lengthsets unsupported VDO index memory sizesets unsupported VDO slab sizesets unsupported VDO max discardsets unsupported VDO ack threadssets unsupported VDO bio threadssets unsupported VDO bio rotationsets unsupported VDO cpu threadssets unsupported VDO hash zone threadssets unsupported VDO logical threadssets unsupported VDO physical threadsis not referencing VDO pool LVLV %s invalid: segment %u is referencing different LV.LV %s invalid: segment %u should begin at LE %u (found %u).LV %s: segment %u with len=%u has inconsistent area_len %uLV %s: segment %u has same LV %s for both origin and snapshotLV %s: segment %u has unassigned area %u.LV %s: segment %u has inconsistent PV area %uLV %s: segment %u has inconsistent LV area %uLV %s: segment %u mirror image %u missing mirror ptrLV %s segment %u uses LV %s, but missing ptr from %s to %sLV %s has duplicated links to LV %s segment %uLV %s: mirrored LV segment %u has wrong size %u (should be %u).LV %s: inconsistent LE count %u != %uLV %s is used by LV %s:%u-%u, but missing ptr from %s to %sReference count mismatch: LV %s has %u links to LV %s:%u-%u, which has %u linksLV segment %s:%u-%u is incorrectly listed as being used by LV %sLV %s is indirectly used by historical LV %sbut that historical LV does not point back to LV %sLV %s is indirectly used by LV %sbut that LV does not point back to LV %sLV %s must have exactly one segment.LV %s: segment 1 pool data LV does not point back to same LVLV %s: thin pool metadata LV does not use _tmeta.LV %s: cache pool metadata LV does not use _cmeta.LV %s: external origin count does not match.LV %s: external origin cant't be writable.Unable to split the %s segment at LE %u in LV %sCouldn't allocate cloned LV segment.LV segment tags duplication failedSplit %s:%u[%u] at %u: %s LE %uSplit %s:%u[%u] at %u: %s PE %uUnassigned area %u found in segmentSegment with extent %u in LV %s not foundWARNING: PV %s in VG %s is using an old PV header, modify the VG to update.WARNING: PV %s in VG %s is missing the used flag in PV header.Using metadata size 960 KiB for non-standard page size %d.Requested PE alignment is %llu sectorsStandard PE alignment is %llu sectorsIncreasing PE alignment to page size %u sectorsAdjusting PE alignment from %llu sectors to md stripe width %llu sectors for %sAdjusting PE alignment from %llu sectors to mininum io size %llu sectors for %sAdjusting PE alignment from %llu sectors to optimal io size %llu sectors for %sSetting PE alignment to %llu sectors for %s.Setting PE alignment offset to %llu sectors for %s.Adding physical volume '%s' to volume group '%s'pv_list allocation for '%s' failedPhysical volume '%s' is already in volume group '%s'PV %s is used by a VG but its metadata is missing.Physical volume %s is of different format type (%s)Physical volume %s might be constructed from same volume group %svg->name allocation failed for '%s'Format-specific setup of physical volume '%s' failed.Physical volume '%s (%s)' already in the VG.No space for '%s' - volume group '%s' holds max %d physical volume(s).Unable to add %s to %s: new extent count (%lu) exceeds limit (%u).Physical volume %s not in volume group %sLogical volume %s not in volume group %sCannot move PV(s) from non resize volume group %s.Cannot move PV(s) to non resize volume group %s.New volume group name "%s" is invalid.%s: already exists in filesystemNew volume group path exceeds maximum length of %d!Old and new volume group names must differpv->vg_name allocation failed for '%s'Marking PV %s as moved to VG %sVolume group "%s" not found, is inconsistent or has PVs missing.Consider vgreduce --removemissing if metadata is inconsistent.Volume group "%s" still contains %u logical volume(s)Removing physical volume "%s" from volume group "%s"Failed to remove physical volume "%s" from volume group "%s"Volume group "%s" successfully removedVolume group "%s" not properly removedPhysical extent size used for volume group %s is less than logical block size (%u bytes) that %s uses.WARNING: Device %s has size of %lu sectors which is smaller than corresponding PV size of %lu sectors. Was device resized?WARNING: PV %s has unknown block size.Devices have inconsistent block sizes (%u and %u)Devices have inconsistent logical block sizes (%u and %u).PV %s cannot be added to VG %s.Logical volume %s/%s does not support tagsFailed to duplicate tag %s from %s/%sVolume group %s does not support tagsFailed to duplicate tag %s from %sFailed to add tag %s to volume group %sMajor number %d outside range 0-255.Minor number %d outside range 0-255.Major number %d outside range 0-4095.Ignoring supplied major %d number - kernel assigns major numbers dynamically.Minor number %d outside range 0-1048575.Volume Group allocation policy cannot inherit from anythingPhysical extent size may not be zeroNumber of volumes may not exceed 255Couldn't create uuid for volume group '%s'.Failed to create format instanceFormat specific setup of volume group '%s' failed.Rounding up size to full physical extent %sVolume too large (%s) for extent size %s. Upper limit is less than %s.Specified size is smaller then physical extent boundary.No free extents in the list of physical volumes.No free extents in Volume group %s.Converted %s%%%s into 0 extents.Converted %s%%%s into %u extents.Failed to allocate bitset for setting random bits.dm_pool_begin_object failed for random list of bits.Failed to generate list of random bits.Failed to finish list of random bits.Selected %u random bits from %u: %sAdjusting ignored mdas for %s: %u of %u mdas in use but %u required. Changing %u mda.Internal error: Unable to find %u metadata areas to ignore on volume group %sInternal error: Unable to find %u metadata areas to unignore on volume group %sFailed to allocate pv structure.Failed to create random uuid for %s.WARNING: %s: Overriding real size. You could lose data.%s: Pretending size is %lu sectors.%s: Size must exceed minimum of %lu sectors.pv_list allocation in pv_create failedFormat-specific initialisation of physical volume %s failed.Failed to add metadata area for new physical volume %sLogical volumes in "%s" must be inactiveExtent sizes differ: %d (%s) and %d (%s)Maximum number of physical volumes (%d) exceeded for "%s" and "%s"Maximum number of logical volumes (%d) exceeded for "%s" and "%s"Metadata types differ for "%s" and "%s"Duplicate logical volume name "%s" in "%s" and "%s"Physical volume %s might be constructed from same volume group %s.Internal error: Read ahead data missing.Calculated readahead of LV %s is %uInternal error: Referenced LV %s not listed in VG %s.Internal error: Referenced PV %s not listed in VG %s.Internal error: Invalid character at index %u of lock_args "%s"Internal error: Invalid colon at index %u of lock_args "%s"Internal error: VG %s has invalid lock_args charsInternal error: LV %s/%s has invalid lock_args charsInternal error: LV %s/%s has invalid lock_args "%s"Internal error: VG %s allocation policy set to invalid cling_by_tags.Internal error: VG %s has external flag LVM_WRITE_LOCKED set internally.Internal error: VG %s tag %s has invalid form.Internal error: PV list corruption detected in VG %s.Internal error: VG %s PV list entry points to different VG %s.Internal error: VG name for PV %s is corrupted.Internal error: Duplicate PV id %s detected for %s in %s.Internal error: PV %s tag %s has invalid form.Internal error: PV segments corrupted in %s.Internal error: LV %s is not marked as removed while it's part of removed LV list for VG %sInternal error: LV %s is marked as removed while it's still part of the VG %sInternal error: LV %s has external flag LVM_WRITE_LOCKED set internally.Internal error: LV name "%s/%s" length %zu is not supported.Internal error: LV %s has VG UUID %s but its VG %s has UUID %sInternal error: LV %s is extra pool metadata spare volume. %u found but only 1 allowed.Internal error: LV %s is not the VG's pool metadata spare volume.Internal error: LV segments corrupted in %s.Internal error: LV %s allocation policy set to invalid cling_by_tags.Internal error: LV name %s has invalid form.Internal error: LV %s tag %s has invalid form.Internal error: #LVs (%u) != #visible LVs (%u) + #snapshots (%u) + #internal LVs (%u) in VG %sFailed to allocate lv_name hashInternal error: Duplicate LV name %s detected in %s.Internal error: Duplicate LV id %s detected for %s in %s.Internal error: Segment in %s is not 2-way.Internal error: Segment in %s has wrong number of areas: %d.Internal error: Volume group %s has limited PV/LV count but limit is not set.Internal error: VG references non pool metadata spare LV %s.Failed to allocate lv_lock_args hashInternal error: VG %s with lock_type %s without lock_argsInternal error: VG %s with lock_type %s is clusteredInternal error: VG %s with lock_type %s has system_id %sInternal error: VG %s has unknown lock_type %sInternal error: VG %s has lock_args %s without lock_typeInternal error: LV %s/%s has duplicate lock_args %s.lock_args will be ignored on cache volInternal error: LV %s/%s shouldn't have lock_argsInternal error: LV %s/%s with no lock_type has lock_args %sInternal error: LV %s/%s appearing in VG's historical list is not a historical LVInternal error: Historical LV %s points to different VG %s while it is listed in VG %sInternal error: Historical LV %s has VG UUID %s but its VG %s has UUID %sInternal error: Duplicate historical LV id %s detected for %s in %sInternal error: Duplicate historical LV name %s detected in %sFailed to hash historical LV nameFailed to hash historical LV idInternal error: Name %s appears as live and historical LV at the same time in VG %sInternal error: Historical LV %s is not part of any LV chain in VG %sAutomatically removing historical logical volume %s/%s%s.WARNING: wiping mda on outdated PV %sWARNING: failed to wipe mda on outdated PV %s_wipe_outdated_pvs no label for %sWARNING: wiping header on outdated PV %sWARNING: failed to wipe header on outdated PV %sCannot allocate lock for new LV.Failed to handle historical LVs in VG %s.Cannot update partial volume group %s.Cannot update volume group %s while physical volumes are missing.Cannot update volume group %s with duplicate PV devices.Cannot update volume group %s with unknown segments in it!Aborting vg_write: No metadata areas to write to!Internal error: Writing metadata in critical section.WARNING: updating PV header on %s for VG %s.WARNING: updating old metadata to %u on %s for VG %s.Format does not support writing volume group metadata areas.WARNING: Failed to write an MDA of VG %s.WARNING: PV %s is marked in use but no VG was found using it.WARNING: PV %s might need repairing.WARNING: Couldn't find all devices for LV %s while checking used and assumed devices.WARNING: Device mismatch detected for %s which is accessing %s instead of %s.Failed to read existing physical volume '%s'WARNING: Couldn't find device with uuid %s.Couldn't find device with uuid %s.WARNING: VG %s was previously updated while PV %s was missing.Found a previously MISSING PV %s with no MDAs.Fixing up missing size (%s) for PV %sWARNING: Physical Volume %s is too large for underlying deviceFormat does not support writing physical volumesAssertion failed: can't _pv_write non-orphan PV (in VG %s)Failed to clear metadata from physical volume "%s" after removal from "%s"Attempt to modify a read-only VGAllowing forced access to clustered vg %sVolume group %s is not resizeable.Cannot access VG %s with lock type %s that requires lvmlockd.Cannot access VG %s due to failed lock.Test mode is not yet supported with lock type %s.WARNING: Found LVs active in VG %s with foreign system ID %s. Possible data corruption.Cannot access VG %s with system ID %s with unknown local system ID.Cannot access VG %s with system ID %s with local system ID %s.Couldn't allocate format_instance object.metadata_area allocation failed%s ignored flag for mda %s at offset %lu.Metadata areas on physical volume "%s" already ignored.Metadata areas on physical volume "%s" already marked as in-use.Physical volume "%s" has no metadata areas.Marking metadata areas on physical volume "%s" as %s.WARNING: Changing preferred number of copies of VG %s metadata from %u to %uInternal error: LV %s (UUID %s) not found in committed metadata.Failed to destroy record about historical LV %s/%s.Outdated record for historical logical volume "%s" automatically destroyed.Invalid mix of cache device types in %s.WARNING: not repairing bad metadata (0x%x) for mda%d on %sWARNING: repairing bad metadata (0x%x) in mda%d at %llu on %s.WARNING: failed to write VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to precommit VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to commit VG %s metadata to bad mda%d at %llu on %s.Rescan for text mismatch - no mda dev.Rescan for text mismatch - cannot invalidate.Rescan for text mismatch - no mda header.Rescan for text mismatch - bad_fields.Rescan for text checksum mismatch - now %x prev %x.Rescan for text offset mismatch - now %llu prev %llu.Rescan for text mismatch - no mdas.Rescan skipped - unchanged offset %llu checksum %x.Ignoring metadata for VG %s from missing dev.Reading VG %s precommit metadata from %s %lluWARNING: Reading VG %s precommit on %s failed.Reading VG %s metadata from %s %lluWARNING: Reading VG %s on %s failed.WARNING: ignoring metadata seqno %u on %s for seqno %u on %s for VG %s.WARNING: Inconsistent metadata found for VG %s.See vgck --updatemetadata to correct inconsistency.Drop dev for MD component from cache %s.Drop mda from MD component from mda list %s.VG %s not found on any remaining devices.vg_read %s ignore mda for outdated dev %sVolume group name "%s" has invalid characters.WARNING: activating multiple VGs with the same name is dangerous and may fail.WARNING: failed to strip outdated historical lvs.VG %s is missing PV %s (last written to %s)WARNING: VG %s is missing PV %s (last written to %s).WARNING: VG %s is missing PV %s.WARNING: VG %s has unused reappeared PV %s %s.WARNING: VG %s was missing PV %s %s.WARNING: One or more devices used as PVs in VG %s have changed sizes.Cannot change VG %s while PVs are missing.See vgreduce --removemissing and vgextend --restoremissing.Cannot change VG %s with unknown segments in it!WARNING: vg_read no vg copy: pool locked.WARNING: vg_read no vg copy: copy exists.WARNING: vg_read no vg copy: pre copy exists.Internal error: Missing committed config tree.Internal error: vg_read vg %p vg_precommitted %pInternal error: vg_read vg %p vg_committed %pFailed to find mirror_seg for %sLV %s on %s is not a mirror segments.Using reduced mirror region size of %sInvalid index (%u) of mirror image supplied to shift_mirror_images().Device path name too long - log header not written (%s).Writing log header for LV %s to device %s.%s: not found: log header not written.Failed to open %s/%s to write log header.Failed to write log header to %s.Internal error: Log LV %s is not top level LV for initialization.Test mode: Skipping mirror log initialisation.Aborting. Unable to create in-sync mirror log while activation is disabled.Aborting. Unable to tag mirror log.Aborting. Failed to activate mirror log.Aborting. Failed to wipe mirror log.Aborting. Failed to write mirror log header.Aborting. Failed to deactivate mirror log. Manual intervention required.Aborting. Failed to sync local devices before initialising mirror log %s.Unable to deactivate mirror log LV. Manual intervention required.Manual intervention may be required to remove abandoned log LV before retrying.Manual intervention may be required to remove/restore abandoned log LV before retrying.Intermediate VG commit for orphan volume failed.Failed to sync local devices when reactivating %s.Unable to determine mirror sync status of %s.Unable to split non-mirrored LV %s.Internal error: split_count is zero!Detaching %d images from mirror %s.Insufficient removable PVs given to satisfy request.Internal error: New LV not found.Unable to rename newly split LV.Failed to build new mirror, %s.Failed to build new image name for %s.Failed to generate new image names for %s.Failed to group split images into new mirror.Failed to rename newly split LV in the kernelReducing mirror set %s from %u to %u image(s)%s.Incompatible parameters to _remove_mirror_images.Internal error: _remove_mirror_images called incorrectly with is_removable undefined.Unable to remove primary mirror image while mirror volume %s is not in-sync.%s being removed due to failures.Failed error target substitution for %s.Failed to initialize log device %s.No mirror images found using specified PVs.%u images are removed out of requested %u.Failed to find mirrored LV for %s.Not collapsing %s: out-of-sync.Failed to release mirror imagesFailed to build new mirror image name for %s.Aborting. Failed to create mirror image LV. Remove new LV and retry.Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror image segment to %s. Remove new LV and retry.Segment is not mirrored: %s:%uSegment status does not match: %s:%u status:0x%lx/0x%lxUnable to allocate mirror extents for %s.Failed to add mirror areas to %s.Internal error: Unknown mirror flag.Multiple-segment mirror is not supported.Unable to determine mirror sync status.Full resync required to convert inactive mirror volume %s to core log. Proceed? [y/n]: Logical volume %s NOT converted.Failed to build new mirror log name for %s.Aborting. Failed to add mirror segment. Remove new LV and retry.Adjusting region_size to %s for mirrored log.Failed to initialise mirror log.Unable to allocate extents for mirror log.Mirror %s already has a %s log.Log type "mirrored" creation/conversion is not supported for regular operation!Log type "mirrored" is DEPRECATED. Use RAID1 LV or disk log instead.%s: Required device-mapper target(s) not detected in your kernel.Unable to allocate extents for mirror(s).Persistent log is not supported on segment-by-segment mirroring.Striped-mirroring is not supported on segment-by-segment mirroring.Unsupported mirror conversion type.%sLogical Volume "%s" already exists in volume group "%s".Unable to split mirror %s that is not in-sync.Removing more than existing: %d <= %d.Mirror log type "%s" is unknown.Internal error: Unknown mirror log count %d.Internal error: Unable to attach pool metadata LV to %s segtype.Internal error: Logical volume %s is not valid pool.Internal error: Unable to attach pool data LV to %s segtype.Internal error: Unable to attach pool to %s/%s that is not cache or thin volume.Initialization of historical LV representation for removed logical volume %s failed.Failed to create historical LV representation for removed logical volume %s.Internal error: No pool associated with %s LV, %s.Internal error: Cannot detach pool from LV %s.Internal error: Trying to delete %u again.Internal error: Unsupported message type %u.%s is referenced by more then one segments (%s, %s).Pool segment not found for %s.%s on %s is not a %s pool segmentInternal error: %s is not a pool logical volume.No usable device hint found while recalculating pool chunk size for %s.Calculated chunk size %s for pool %s is out of allowed range (%s-%s).Updating chunk size %s for pool %s to %s.Internal error: Pool %s already has extents.Name of logical volume %s is too long to be a pool name.WARNING: Pool %s is created without initialization.Aborting. Failed to activate pool metadata %s.Aborting. Failed to wipe pool metadata %s.Aborting. Could not deactivate pool metadata %s.Preparing pool metadata spare volume for Volume group %s.Unable to deactivate pool metadata spare LV. Manual intervention required.WARNING: recovery of pools without pool metadata spare LV is not automated.Dropping unused pool metadata spare LV %s.Size %s of pool metadata volume %s is bigger then maximum usable size %s.Reducing pool metadata size %s to maximum usable size %s.Can't use volume %s with size %s as pool metadata. Minimal required size is %s.Extending pool metadata size %s to required minimal size %s.Can't create pool metadata spare. Name of pool LV %s is too long.Renaming %s as pool metadata spare volume %s.Internal error: LV %s is not pool metadata spare.Internal error: LV %s has no suffix for pool metadata spare.Failed to generate unique name for pool metadata spare logical volume.Renaming existing pool metadata spare logical volume "%s" to "%s/%s".Cannot disable all metadata areas in volume group %s.Internal error: PV %s unexpectedly not in cache.Adding PE range: start PE %u length %u on %s.Overlapping PE ranges specified (%u-%u, %u-%u) on %s.PE range error: start extent %u to end extent %u.Physical extent parsing error at %s.Failed to create PV entry for missing device.WARNING: Physical volume %s not allocatable.WARNING: Physical volume %s is missing.WARNING: No free extents on physical volume "%s".Unable to allocate physical volume list.Allocation of pe_ranges list failed.Physical Volume "%s" not found in Volume Group "%s".No specified PVs have space available.Segment with extent %u in PV %s not foundMissing PV segment on %s at %u.discard_pv_segment with unallocated segment: %s PE %uSkipping discard on missing device with uuid %s.Discarding %u extents offset %lu sectors on %s.Internal error: _merge_free_pv_seg called on a segment that is not free.release_pv_segment with unallocated segment: %s PE %uInternal error: WARNING: PV %s is without initialized PE ranges.PV segment pe_count mismatch: %u != %uPV segment pe_alloc_count mismatch: %u != %uPV segment VG pv_count mismatch: %u != %uPV segment VG free_count mismatch: %u != %uPV segment VG extent_count mismatch: %u != %u%s: cannot resize to %u extents as %u are allocated.%s: cannot resize to %u extents as later ones are allocated.%s: cannot resize to %u extents as there is only room for %lu.Size must exceed minimum of %lu sectors on PV %s.Size must exceed physical extent start of %lu sectors on PV %s.Format specific resize of PV %s failed.Size must leave space for at least one physical extent of %u sectors on PV %s.No change to size of physical volume %s.Resizing physical volume %s from %u to %u extents.Physical volume %s format does not support resizing.WARNING: %s: Overriding real size %s. You could lose data.%s: Requested size %s exceeds real size %s. Proceed? [y/n]: Physical Volume %s not resized.%s: Requested size %s is less than real size %s. Proceed? [y/n]: %s: Size is already %s (%lu sectors).WARNING: %s: Pretending size is %lu not %lu sectors.Resizing volume "%s" to %lu sectors.Failed to store physical volume "%s"Failed to store physical volume "%s" in volume group "%s"Use pvcreate and vgcfgrestore to repair from archived metadata.Allowing allocation on %s start PE %u length %uCouldn't create physical volume maps in %sCannot restripe LV %s from %u to %u stripes during conversion.RAID module does not support reshape.RAID module does not support rebuild+emptymeta.Adjusting region_size from %s to %s for %s.Region size may not be smaller than stripe size on %s LV %s.Region size is too large for %s LV %s.Unable to handle raid arrays with more than %u devices.Unable to handle mirrors with more than %u devices.Adjusting region size of %s LV from %s to %s.Failed to allocate string for new LV name.Internal error: Missing image sub lv in area %u of LV %s.Failed to prevent PVs holding image components from LV %s being used for allocation.Internal error: LVs must be set visible before removing.Failed to sync local devices after removing %u LVs in VG %s.Cannot determine sync percentage of %s.Unable to determine sync status of %s.WARNING: Sync status for %s is inconsistent.Internal error: Unable to remove RAID layer from segment type %s.Internal error: Unable to remove RAID layer when there is more than one sub-lv.Internal error: Pre callout function failed.Clearing any flags for %s passed to the kernel.Updating metadata mappings for %s.Activating logical volume %s before %s in kernel.Failed to activate %s before resuming %s.Internal error: stripes may not be 0.Can't convert %s LV %s with number of stripes not divisable by number of data copies.Internal error: LV %s is missing stripes.Failed to find a valid mirror in stripe %u!Internal error: Metadata segment area. #%d should be AREA_UNASSIGNED.Failed to new raid name for %s.New logical volume name "%s" is not valid.%sLogical Volume %s already exists in volume group %s.Internal error: Bad type provided to _alloc_raid_component.Component name for raid %s is too long.Failed to allocate new raid component, %s.Failed to add segment to LV, %s.Internal error: bogus reshape space reallocation request [%d]Can't remove reshape space from inactive LV %s.Can't get data offset for %s from kernel.Failed to allocate out-of-place reshape space for %s.Internal error: Bogus reshape space allocation request.No proper new segment length for %s!Internal error: No change of image count on LV %s.Ignoring layout change on device adding reshape.Can't reshape %s LV %s to odd number of stripes.WARNING: Adding stripes to active%s logical volume %s will grow it from %u to %u extents!Run "lvresize -l%u %s" to shrink it or use the additional capacity.Are you sure you want to add %u images to %s LV %s? [y/n]: Adding %u data and metadata image LV pair%s to %s.Failed to adjust LV %s to new size!Allocating reshape space for %s.(Re)allocating reshape space for %s.Setting delta disk flag on new data LVs of %s.Minimum 3 stripes required for %s LV %s.Ignoring layout change on device removing reshape.WARNING: Removing stripes from active%s logical volume %s will shrink it from %s to %s!THIS MAY DESTROY (PARTS OF) YOUR DATA!Interrupt the conversion and run "lvresize -y -l%u %s" to keep the current size if not done already!If that leaves the logical volume larger than %llu extents due to stripe rounding,you may want to grow the content afterwards (filesystem etc.)WARNING: to remove freed stripes after the conversion has finished, you have to run "lvconvert --stripes %u %s"Can't remove stripes without --force option.Are you sure you want to remove %u images from %s LV %s? [y/n]: No correct kernel/lvm active LV count on %s.No correct kernel/lvm total LV count on %s.Removing %u data and metadata image LV pair%s from %s.Internal error: Bad return provided to %s.WARNING: ignoring --stripesize on conversion of %s to 1 stripe.Converting %s%s LV %s to %s%s.Are you sure you want to convert %s LV %s? [y/n]: %sllocating reshape space for %s.Failed to suspend %s before committing changes.Unable to convert stacked volume %s.Unable to convert %s while it is not in-sync.Internal error: Failed to free reshape space of %s.No change in RAID LV %s layout, freeing reshape space.LV %s does not have reshape space allocated.Can't reshape out of sync LV %s.Device count is incorrect. Forgotten "lvconvert --stripes %d %s" to remove %u images after reshape?Internal error: Bad return=%d provided to %s.Converting stripesize %s of %s LV %s to %s.Region size may not be smaller than stripe size on LV %s.Can't remove stripes from raid10.Internal error: Unable to allocate RAID metadata area for non-linear LV %s.Can't add image to out-of-sync RAID LV: use 'lvchange --resync' first.Can't add image to RAID LV that is still initializing.Unable to add RAID images to %s of segment type %s.Allocation of new areas failed.Allocation of new meta areas failed.Failed to clear REBUILD flag for %s components.Extracting image components %s and %s from %s.Unable to remove primary RAID image while array resyncing.Unable to remove RAID image while array is performing "%s"Internal error: RAID LV area_count differs from number of health charactersUnable to remove all primary source devicesUnable to remove %d images: Only %d device%s given.%s has components with error targets that must be removed first: %s.Try removing the PV list and rerun. the command.LVs with error segments to be removed: %s %sFailed to shift and rename image components.Unable to extract enough images to satisfy request.Failed to extract images from %s.Integrity must be removed before converting raid to linear.Are you sure you want to convert %s LV %s to type %s losing all resilience? [y/n]: Logical volume %s NOT converted to "%s".Failed to remove RAID layer after linear conversion.Can't change number of mirrors of degraded %s.Please run "lvconvert --repair %s" first.WARNING: %s already has image count of %d.%s must be active to perform this operation.Are you sure you want to convert %s LV %s to %s%u images %s resilience? [y/n]: Splitting raid image is not allowed with lock_type %s.Integrity must be removed before splitting.Unable to split more than one image from %s.Unable to split logical volume of segment type, %s.%sLogical Volume "%s" already exists in %s.Unable to split %s while it is not in-sync.Are you sure you want to split %s LV %s losing all resilience? [y/n]: Losing all resilience for logical volume %s.Unable to split additional image from %s while tracking changes for %s.Failed to write changes for %s.Failed to commit changes for %s.Failed to resume %s after committing changes.Unable to split images from non-mirrored RAID.Unable to split image from %s while not in-sync.Cannot track more than one split image at a time.Are you sure you want to split and track %s LV %s losing resilience for any newly written data? [y/n]: Losing resilience for newly written data on logical volume %s.Unable to find image to satisfy request.%s split from %s for read-only purposes.WARNING: Any newly written data will be non-resilient on LV %s during the split!Use 'lvconvert --merge %s' to merge back into %s.%s cannot be merged because --trackchanges was not used.Unable to merge non-raid image %s.Unable to find containing RAID array for %s.Failed to find meta for %s in RAID array %s.Failed to deactivate %s before merging.%s successfully merged back into %s.Allocating new metadata LV for %s.Failed to allocate metadata LV for %s.Internal error: Bad type provided to %s.Extracting image component %s from %s.Failed to allocate metadata LVs for %s.Allocating metadata LVs for %s.Clearing newly allocated metadata LVs for %s.Failed to initialize metadata LVs for %s.Adding newly allocated metadata LVs to %s.Failed to add newly allocated metadata LVs to %s.Internal error: Name %s lags image part.Failed to allocate meta areas memory.Failed to allocate metadata LV for %s in %s.Clearing newly allocated metadata LVs.Failed to initialize metadata LVs.Internal error: raid1 conversion supported only.can't convert %s to fewer than 2 data_copies.Unable to convert %s LV %s with %u images to %s.At least reduce to the maximum of %u images with "lvconvert -m%u %s".Changing image count to %u on %s.Extracting and renaming metadata LVs.Internal error: No segment for %s.Failed to retrieve raid0 segments from %s.Cannot convert striped LV %s with varying stripe count to raid0.Cannot convert striped LV %s with non-power of 2 stripe size %u.Failed to allocate empty image components for raid0 LV %s.Failed to insert linear LVs underneath %s.Failed to allocate new raid0 segment for LV %s.Direct conversion of %s LV %s is not possible.Converting %s from %s%s is directly possible to the following layout%s:Logical volume %s is already of requested type %s.Logical volume %s already is type %s.Converting the segment type for %s from %s to %s is not supported.Converting the segment type for %s from %s to %s is not supported yet.Are you sure you want to convert %s back to the older %s type? [y/n]: Extracting all MetaLVs of %s to activate as raid0.Deactivating pulled out MetaLVs of %s before initializing.Clearing allocated raid0_meta metadata LVs for conversion to raid4.Adding metadata LVs back into %s.LV %s has to be of type raid4 or raid5_n to allow for this conversion.Are you sure you want to convert %s%s LV %s to %s%s type? [y/n]: Converting LV %s from %s to %s.Failed to rename %s LV %s MetaLVs.Can't convert %s LV %s to %s with odd number of stripes.Can't convert %s LV %s to %s with != 2 legs.Internal error: Bogus new_image_count converting %s LV %s to %s.Can't convert %s LV %s to %s with < 3 legs.Reordering areas for raid10 -> raid0 takeover.Removing %u component LV pair(s) to %s.N number of data_copies "--mirrors N-1" may not be larger than number of stripes.Can't restripe LV %s during conversion.Minimum of %u stripes needed for conversion from %s to %s.Adding %u component LV pair(s) to %s.Extracting last image component pair of %s temporarily.Adding extracted last image component pair back to %s to convert to %s.Reordering areas for raid0 -> raid10_near takeover.Updating VG metadata and reloading %s LV %s.%s not allowed when converting %s LV %s.%s not allowed for LV %s when converting from %s to %s.Checking LV %s requested %s segment type for convenienceConvert %s LV %s to 2 images first.Converting %s LV %s to 2 stripes first.Converting %s LV %s to %u stripes first.Convert %s LV %s to raid4/raid5 first.Convert %s LV %s to 2 stripes first (i.e. --stripes 1).Replaced LV type %s%s with possible type %s.Repeat this command to convert to %s after an interim conversion has finished.Internal error: Cannot change region size of %s.Region size is already %s on %s LV %s.Region size is already matching %s on %s LV %s due to adjustment.Do you really want to change the region_size %s of LV %s to %s? [y/n]: Region size %s on %s is too small for metadata LV size.Unable to change region size on %s LV %s while it is not in-sync.Converting %s LV %s to regionsize %s.Changed region size on %s LV %s to %s.Unable to convert LV %s from %s to %s.WARNING: ignoring --stripes option on takeover of %s (reshape afterwards).WARNING: ignoring --stripesize option on takeover of %s (reshape afterwards).Are you sure you want to convert %s LV %sInternal error: New segtype not specified.Can't convert RAID LV %s while under snapshot.Reshape request failed on LV %s.Invalid conversion request on %s.Internal error: _reshape_requested failed.Can't convert %s LV %s to %s containing sub LVs to remove after a reshape.Run "lvconvert --stripes %u %s" first.%u extents needed to repair %s.Not enough space on %s for %s.Can't rebuild raid with integrity.Can't replace any devices in %s LV %s.Unable to replace devices in %s while it is not in-sync.Unable to repair %s/%s. Source devices failed before the RAID could synchronize.You should choose one of the following: 1) deactivate %s/%s, revive failed device, re-activate LV, and proceed. 2) remove the LV (all data is lost). 3) Seek expert advice to attempt to salvage any data from remaining devices.Unable to replace RAID images while the array has unassigned areas.Logical volume %s does not contain devices specified to %s.%s does not contain devices specified to %s.Unable to %s all PVs from %s at once.Unable to %s more than %u PVs from (%s) %s.Unable to %s all the devices in a RAID10 mirror group.Failed to prevent PVs holding image components from being used for allocation.Failed to replace %u devices. Attempting to replace %u instead.Failed to allocate replacement images for %s.Failed to remove the specified images from %s.Internal error: %s is not a partial LV.Attempting to remove missing devices from %s LV, %s.Replacing %s segments with error target.Failed to replace %s's extents with error target.An entire mirror group has failed in %s.All components of raid LV %s have failed.More than %u components from %s %s have failed.%s contains a segment incapable of degraded activation.Integrity must be removed before degraded or partial activation of raid.WARNING: Unrecognised segment type %sInternal error: Unrecognised segment type flag 0x%016lxSnapshot volume cannot be smaller than 3 chunks (%u extents, %s).Internal error: Cannot get origin from snapshot %s.Failed to find snapshot segtypeCouldn't allocate new snapshot segment.'%s' is already in use as a snapshot.Snapshot and origin LVs must differ.Failed to sync local devices before deactivating origin LV %s.Failed to deactivate logical volume "%s"Failed to remove internal snapshot LV %sPostponing write and commit for remove of snapshot %s.Failed to refresh %s without snapshot.an origin that has a merging snapshotWARNING: Snapshots of mirrors can deadlock under rare device failures.WARNING: Consider using the raid1 mirror type to avoid this.WARNING: See global/mirror_segtype_default in lvm.conf.Snapshots of %s are not supported.Internal error: data_lv_from_thin_pool arg not thin pool %sInternal error: Cannot attach message to non-pool LV %s.Message referring LV %s already queued in pool %s.Delete for device %u already queued in pool %s.Failed to allocate memory for message.Internal error: LV %s already has external origin.Setting logical volume "%s" read-only.Internal error: Inconsitent external origin.Internal error: LV %s is not pool.Internal error: pool_is_active called with non-pool volume %s.Pool's thin volume %s is active.Internal error: LV %s is not thin pool.WARNING: Thin pool %s%s%s%s%s%s.Threshold configured for free data space in thin pool %s has been reached (%s%% >= %s%%).WARNING: Remaining free space in metadata of thin pool %s is too low (%s%% >= %s%%). Resize is recommended.Threshold configured for free metadata space in thin pool %s has been reached (%s%% > %s%%).WARNING: Thin pool %s has unexpected transaction id %lu, expecting %lu%s. and the size of whole volume group and the amount of free space in volume groupWARNING: Sum of all thin volume sizes (%s) exceeds the size of thin pool%s%s%s (%s).WARNING: You have not turned on protection against thin pools running out of space.WARNING: Set activation/thin_pool_autoextend_threshold below 100 to trigger automatic extension of thin pools before they get full.WARNING: Set activation/thin_pool_autoextend_percent above 0 to specify by how much to extend thin pools reaching the threshold.Can't use "%s" as external origin with "%s" pool. Size %s is not a multiple of pool's chunk size %s.Internal error: Segment in %s is not a thin pool segment.Pool %s needs to be locally active for threshold check.Free space in pool %s is above threshold, new volumes are not allowed.Internal error: Updated LV %s is not pool., perhaps skipped in lvm.conf volume_list?Cannot activate thin pool %s%sFailed to suspend %s with queued messages.Failed to sync local devices LV %s.Internal error: Cannot find configuration.Thin pool chunk size calculation policy "%s" is unrecognised.Using metadata size without cropping.Chunk size must be a power of 2 for this thin target version.Internal error: Could not find configuration.WARNING: Chunk size is too small for pool, suggested minimum is %s.WARNING: Chunk size is smaller then suggested minimum size %s.Selected chunk size %s cannot address more then %s of thin pool data space.Thin pool volume with chunk size %s can address at most %s of data.WARNING: Pool zeroing and %s large chunk size slows down thin provisioning.WARNING: Consider disabling zeroing (-Zn) or using smaller chunk size (<%s).Thin pool discards type "%s" is unknown.Internal error: Unknown discards type encountered.Cannot read thin pool %s transaction id locally, perhaps skipped in lvm.conf volume_list?Cannot use thin pool %s with transaction id %lu for thin volumes. Expected transaction id %lu.Deactivating public thin pool %s.Aborting. Could not deactivate thin pool %s.Thin pool chunk size %s is not in the range %s to %s.Thin pool chunk size %s must be a multiple of %s.Internal error: Unrecognized compression state: %u.Internal error: Unrecognized index state: %u.Internal error: Unrecognized operating mode: %u.Internal error: Unrecognized VDO write policy: %u.Failed to build VDO DM name %s.Cannot parse %s VDO pool status %s.statistics/logical_blocks_usedFailed to build device path for VDO formating of data volume %s.Slab size %s converted to %u bits.Internal error: Unable to find configuration for vdoformat command options.Invalid string in config file: global/vdoformat_options.Internal error: Failed to wipe logical VDO data for volume %s.WARNING: Cannot read output from %s.Logical blocks defaulted to %lu blocksAvailable VDO logical blocks %lu (%s).Number of VDO logical blocks was not provided by vdo_format output.Rounding size up to 4,00 KiB VDO logical extent boundary: %s.Cannot format VDO pool volume %s.Cannot deactivate formated VDO pool volume %s.Cannot create fully fitting VDO volume, --virtualsize has to be specified.Size %s for VDO volume cannot be smaller then extent size %s.Failed to allocate volume group structureFailed to allocate VG hostname hashtable.Internal error: global memory pool used for VG %sSetting mda_copies to %u for VG %sNew size %lu for %s%s not an exact number of new extents.New extent count %lu for %s%s exceeds 32 bits.Physical Extent size must be a multiple of %s when not a power of 2.Metadata format only supports Physical Extent sizes that are powers of 2.Extent size must be between %s and %sExtent size must be multiple of %sVolume group "%s" must be resizeable to change PE sizeNew extent size is not a perfect fitVolume group "%s" must be resizeable to change MaxLogicalVolumeMaxLogicalVolume is less than the current number %d of LVs for %sVolume group "%s" must be resizeable to change MaxPhysicalVolumesMaxPhysicalVolume limit is 255MaxPhysicalVolumes is less than the current number %d of PVs for "%s"Failed to allocate memory for system_id in vg_set_system_id.Physical volume "%s" still in useCan't remove final physical volume "%s" from volume group "%s"Removing "%s" from volume group "%s"Cannot remove final metadata area on "%s" from "%s"Removal of physical volume "%s" from "%s" failedRemoved "%s" from volume group "%s"Couldn't read 'mirror_count' for segment '%s'.Couldn't read 'extents_moved' for segment %s of logical volume %s.Couldn't read 'region_size' for segment %s of logical volume %s.Unrecognised mirror log in segment %s of logical volume %s.Missing region size for mirror log for segment %s of logical volume %s.Couldn't find mirrors array for segment %s of logical volume %s.struct mirr_state allocation failedMirrored transient status: "%s"Active mirror has a wrong number of mirror images!Metadata says %u, kernel says %u.Check for existence of mirror log %s failed.Mirror log mismatch. Metadata says %d:%d, kernel says %u:%u.Check for existence of mirror image %s failed.Failed to find image %d (%d:%d).Failed to build uuid for log LV %s.Failed to build uuid for mirror LV %s.WARNING: Mirror %s without monitoring will not react on failures.Missing region size for mirror segment.mirror string list allocation failedInternal error: Missing command.Failed to sync local device names before forking.wait4 child process %u failed: %sNot enough space to build temporary file string.fcntl_lock_file failed in strdup.Failed to convert flock on %s %dTEST MODE: Metadata will NOT be updated and volumes will not be (de)activated.LVM activation checks disabledNames starting "%s" are reserved. Please choose a different LV name.Names including "%s" are reserved. Please choose a different LV name.Failed to build LVM dlid for %s.Internal error: Name is too long.Failed to create udev library context.WARNING: Failed to reserve memory, %d bytes missing.%s area unreadable %s : Skipping.%s ignore filter '%s' matches '%s': Skipping.%s default filter '%s' matches '%s': Skipping.%s_filter '%s' matches '%s': Skipping.%s %10ldKiB %12lx - %12lx %c%c%c%c%sAllocation of maps buffer failed.Raised task priority %d -> %d.WARNING: setpriority %d failed: %s.Restoring original task priority %d.WARNING: setpriority %u failed: %s.Internal error: Reserved memory (%ld) not enough: used %ld. Increase activation/reserved_memory?Suppressed internal error: Maps lock %ld < unlock %ld, a one-page difference.Lock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dUnlock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dEntering critical section (%s).Entering prioritized section (%s).Leaving critical section (%s).Internal error: _memlock_inc_daemon used in critical section.memlock_count_daemon inc to %dInternal error: _memlock_count_daemon has dropped below 0.memlock_count_daemon dec to %dorg.freedesktop.systemd1.NoSuchUnitorg.freedesktop.DBus.Error.ServiceUnknownFailed to parse dbus response message: %dBad return value from dbus service: %dProperty name %s does not match type %dUnable to set read-only property %sCouldn't read 'device_count' or 'stripe_count' for segment '%s'.Only one of 'device_count' and 'stripe_count' allowed for segment '%s'.Missing data device in areas array for segment %s.Couldn't read '%s' for segment %s of logical volume %s.Couldn't find RAID array for segment %s of logical volume %s.Failed to import RAID component pairs.RAID target does not support RAID4 for LV %s.Internal error: _raid_add_target_line called with no areas for %s.Unable to handle more than %u devices in a single RAID arrayMissing region size for raid segment in %s.Internal error: Invalid request for delta disks minus and delta disks plus!Active raid has a wrong number of raid images!Check for existence of raid meta %s failed.Check for existence of raid image %s failed.Target raid does not support %s.raid module string list allocation failedFailed to allocate memory for %s segtypealloc_time_item: dm_pool_zalloc failed_preparse_fuzzy_time: dm_pool_alloc failedUnrecognized string in date/time specification at "%s".Unrecognized number in date/time specification at "%s".Mixed absolute and relative date specification found at "%s".Ambiguous date specification found at "%s".Mixed absolute and relative time specification found at "%s".Ambiguous time specification found at "%s"._get_now: dm_pool_zalloc failed_get_now: failed to cache current time_translate_time_items: invalid time._translate_time_items: dm_snprintf failed_translate_time_items: dm_pool_strdup failedFailed to get value for parsed time specification.Failed to allocate space to store time range.Reserved value for undefined numeric value._get_glv_str: dm_snprintf failedFailed to allocate buffer for mode.Failed to allocate buffer for time.Failed to allocate buffer for host.Failed to display layout for LV %s/%s.Failed to display role for LV %s/%s.Failed to allocate buffer for active.Logical Volume Device Info and Status CombinedName. LVs created for internal use are enclosed in brackets.Full name of LV including its VG, namely VG/LV.Full pathname for LV. Blank for internal LVs.Internal device-mapper pathname for LV (in /dev/mapper directory).For LVs that are components of another LV, the parent LV.Set if mirror/RAID images underwent initial resynchronization.Set if mirror/RAID image is synchronized.Set if snapshot LV is being merged to origin.Set if LV is locked against allocation changes.Set if LV has fixed minor number assigned.Set if LV is skipped on activation.Set if LV autoactivation is enabled.For thin pools, behavior when full.Set if the LV is active locally.Set if the LV is active remotely.Set if the LV is active exclusively.Persistent major number or -1 if not persistent.Persistent minor number or -1 if not persistent.Read ahead setting in current units.For thin and cache pools, the size of the LV that holds the metadata.For snapshots and thins, the origin device of this LV.For snapshots and thins, the UUID of origin device of this LV.For snapshots, the size of the origin device of this LV.LV ancestors ignoring any stored history of the ancestry chain.LV ancestors including stored history of the ancestry chain.LV descendants ignoring any stored history of the ancestry chain.LV descendants including stored history of the ancestry chain.For RAID, number of mismatches found or repaired.For RAID, the current synchronization action being performed.For RAID1, the number of outstanding writes allowed to writemostly devices.For RAID1, the minimum recovery I/O load in kiB/sec/disk.For RAID1, the maximum recovery I/O load in kiB/sec/disk.The number of integrity mismatches.For pvmove, Source PV of temporary LV created by pvmove.For pvmove, the UUID of Source PV of temporary LV created by pvmove.For lvconvert, Name of temporary LV created by lvconvert.For lvconvert, UUID of temporary LV created by lvconvert.For mirrors, the LV holding the synchronisation log.For mirrors, the UUID of the LV holding the synchronisation log.For cache/thin/vdo pools, the LV holding the associated data.For cache/thin/vdo pools, the UUID of the LV holding the associated data.For cache/thin pools, the LV holding the associated metadata.For cache/thin pools, the UUID of the LV holding the associated metadata.For cache/thin/vdo volumes, the cache/thin/vdo pool LV for this volume.For cache/thin/vdo volumes, the UUID of the cache/thin/vdo pool LV for this volume.Configuration profile attached to this LV.Lock args of the LV used by lvmlockd.Creation time of the LV, if knownRemoval time of the LV, if knownCreation host of the LV, if known.Kernel device-mapper modules required for this LV.Currently assigned major number or -1 if LV is not active.Currently assigned minor number or -1 if LV is not active.Currently-in-use read ahead setting in current units.Set if LV has live table present.Set if LV has inactive table present.For snapshot, cache and thin pools and volumes, the percentage full if LV is active.For snapshots, the percentage full if LV is active.For cache and thin pools, the percentage of metadata full if LV is active.For Cache, RAID, mirrors and pvmove, current percentage in-sync.Cache settings/parameters as set in kernel, including default values (cached segments only).Cache metadata format used in kernel.For thin pools, how discards are handled in kernel.For thin pools and cache volumes, whether metadata check is needed.Set if snapshot LV is invalid.For vdo pools, its current operating mode.For vdo pools, whether compression is running.For vdo pools, state of index for deduplication.For vdo pools, currently used space.For vdo pools, percentage of saved space.Total writecache writeback blocks.Various attributes - see man page.Size of underlying device in current units.Free metadata area space on this device in current units.Size of smallest metadata area on this device in current units.Offset to the start of data on the underlying device.Total amount of unallocated space in current units.Total amount of allocated space in current units.Set if this device can be used for allocation.Set if this device is exported.Set if this device is missing in system.Total number of Physical Extents.Total number of allocated Physical Extents.Number of metadata areas on this device.Number of metadata areas in use on this device.Offset to the start of PV Bootloader Area on the underlying device in current units.Size of PV Bootloader Area in current units.Set if PV is an unchosen duplicate.Type of device ID such as WWID.Set if VG autoactivation is enabled.Total size of VG in current units.Total amount of free space in current units.System ID of the VG indicating which host owns it.Lock type of the VG used by lvmlockd.Lock args of the VG used by lvmlockd.Size of Physical Extents in current units.Total number of unallocated Physical Extents.Maximum number of LVs allowed in VG or 0 if unlimited.Maximum number of PVs allowed in VG or 0 if unlimited.Number of PVs in VG which are missing.Revision number of internal metadata. Incremented whenever it changes.Configuration profile attached to this VG.Number of metadata areas on this VG.Number of metadata areas in use on this VG.Free metadata area space for this VG in current units.Size of smallest metadata area for this VG in current units.Target number of in use metadata areas in the VG.Number of stripes or mirror/raid1 legs.Number of data stripes or mirror/raid1 legs.Size of out-of-place reshape space in current units.Size of out-of-place reshape space in logical extents.Data offset on each image device.New data offset after any reshape on each image device.Number of (rotating) parity chunks.For stripes, amount of data placed on one device before switching to the next.For mirrors/raids, the unit of data per leg when synchronizing devices.For snapshots, the unit of data used when tracking changes.For thin pools, the number of thin volumes in this pool.For thin pools, how discards are handled.For cache, metadata format in use.For cache, how writes are cached.For thin pools and volumes, if zeroing is enabled.For thin pools, the transaction id and creation transaction id for thins.For thin volume, the thin device id.Offset within the LV to the start of the segment in current units.Offset within the LV to the start of the segment in physical extents.Size of segment in current units.Size of segment in physical extents.Ranges of Physical Extents of underlying devices in command line format (deprecated, use seg_le_ranges for common format).Ranges of Logical Extents of underlying devices in command line format.Ranges of Logical Extents of underlying metadata devices in command line format.Underlying devices used with starting extent numbers.Underlying metadata devices used with starting extent numbers.Dmeventd monitoring status of the segment.The cache policy (cached segments only).Cache settings/parameters (cached segments only).Set for compressed LV (vdopool).Set for deduplicated LV (vdopool).Use REQ_SYNC for writes (vdopool).Minimum acceptable IO size (vdopool).Allocated caching size (vdopool).Speed of cache writes (vdopool).Allocated indexing memory (vdopool).Increment size for growing (vdopool).Acknowledging threads (vdopool).IO submitting threads (vdopool).CPU threads for compression and hashing (vdopool).Threads for subdivide parts (vdopool).Logical threads for subdivide parts (vdopool).Physical threads for subdivide parts (vdopool).Maximum discard size volume can recieve (vdopool).Specified write policy (vdopool).Header size at front of vdopool.Physical Extent number of start of segment.Name of Device Type exactly as it appears in /proc/devices.Maximum number of partitions. (How many device minor numbers get reserved for each device.)Couldn't read chunk size for snapshot.Merging store must be a string in segment %s of logical volume %s.Both snapshot cow and merging storage were specified in segment %s of logical volume %s.Cow store must be a string in segment %s of logical volume %s.Snapshot cow storage not specified in segment %s of logical volume %s.Snapshot origin not specified in segment %s of logical volume %s.Snapshot origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot cow store in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot origin in segment %s of logical volume %s.Target snapshot may leak metadata.snapshot string list allocation failedCouldn't read 'stripe_count' for segment '%s'.Couldn't read stripe_size for segment %s of logical volume %s.Couldn't find stripes array for segment %s of logical volume %s.Internal error: striped add_target_line called with no areas for %s.Unknown LV %s for create message in segment %s of logical volume %s.Unknown message in segment %s of logical volume %s.Metadata must be a string in segment %s of logical volume %s.Unknown metadata %s in segment %s of logical volume %s.Pool must be a string in segment %s of logical volume %s.Unknown pool %s in segment %s of logical volume %s.Could not read transaction_id for segment %s of logical volume %s.Could not read chunk_size segment %s of logical volume %s.Could not read discards for segment %s of logical volume %s.Discards option unsupported for segment %s of logical volume %s.Unsupported value %u for chunk_size segment %s of logical volume %s.Could not read zero_new_blocks for segment %s of logical volume %s.Could not read crop_metadata for segment %s of logical volume %s.Internal error: Invalid discards value %d.Internal error: Invalid zero new blocks value %d.Internal error: LV %s is not a thin volume.Internal error: Passed unsupported message.String list allocation failed for thin_pool.String list allocation failed for thin.Internal error: Thin pool is missing metadata device.Thin pool target does not support %s chunk size (needs kernel >= 3.6).Failed to build uuid for metadata LV %s.Failed to build uuid for pool LV %s.WARNING: Thin pool target does not support discards (needs kernel >= 3.4).WARNING: Thin pool target does not support error if no space (needs version >= 1.10).Internal error: Unsupported message.Thin pool set transaction id %lu.Thin pool must be a string in segment %s of logical volume %s.Unknown thin pool %s in segment %s of logical volume %s.Origin must be a string in segment %s of logical volume %s.Unknown origin %s in segment %s of logical volume %s.Merge lv must be a string in segment %s of logical volume %s.Unknown merge lv %s in segment %s of logical volume %s.Could not read device_id for segment %s of logical volume %s.Unsupported value %u for device_id segment %s of logical volume %s.External origin must be a string in segment %s of logical volume %s.Unknown external origin %s in segment %s of logical volume %s.Internal error: Segment %s has no pool.Internal error: Failed to add merged segment of %s.Thin target does not support smaller size of external origin LV %s.Failed to build uuid for external origin LV %s.WARNING: LV %s maps %s while the size is only %s.WARNING: Ignoring invalid string in config file %s.UUID contains invalid character '%c'Couldn't write uuid, buffer too small.Too many characters to be uuid.Couldn't read uuid: incorrect number of characters.zero module string list allocation failedFailed to set query_inactive_table.WARNING: Failed to disable open_count.WARNING: Failed to set no_flush.WARNING: Failed to query uuid with LIST.WARNING: Cannot find matching %s segment for %s.WARNING: Detected %s segment type does not match expected type %s for %s.%s: Mirror image %d marked as failed.%s: Mirror log device marked as failed.%s: I/O blocked to mirror device.WARNING: Incorrect snapshot table found for %d:%d.WARNING: Incorrect snapshot-origin table found for %d:%d.WARNING: Cannot get thin-pool major:minor for thin device %d:%d.WARNING: %s: Thin's thin-pool needs inspection.WARNING: %s frozen raid device (%d:%d) needs inspection.%s: Reserved uuid %s on internal LV device %s not usable.%s: Reserved internal LV device %s/%s%s%s not usable.%s: Reserved uuid %s on %s device %s not usable.%s: Empty device %s not usable.%s: Suspended device %s not usable.%s: Scanning mirror devices is disabled.%s: Mirror device %s not usable.%s: Invalid %s device %s not usable.%s: Frozen %s device %s not usable.%s: Error device %s not usable.Skipping checks for old devices without LVM- dm uuid prefix (kernel vsn %d >= %d).Getting device info for %s [%s].Failed to set device number for remove %u:%uWARNING: Cannot get info from tree node for %s.%soaded thin volume %s with id %u is %smatching id %u.WARNING: Using linear target for %s/%s: Striped requires extent size (%u sectors) >= page size (%u).Number of segments in active LV %s does not match metadata.Internal error: Segment is not selected.Getting device %s status percentage for %s.Checking raid status for volume %s.Expected %s segment type but got %s instead.Internal error: %s is not a RAID logical volume.Internal error: Unknown RAID message: %s.Internal error: %s is not a writecache logical volume.Checking status for cache volume %s.Checking thin pool status for LV %s.Checking thin status for LV %s.More then one table line found for %s.Unexpected target type %s found for thin %s.Cannot parse table like parameters %s for %s.Checking VDO pool status for LV %s.Kernel driver has incomplete udev support so LVM will check and perform some operations itself.Failed to parse dm device minor number from %s.Checking holder of %s %s (%u:%u) %s.Cannot find holder with device name %s in VG %s.sysfs_path dm_snprintf failed.Cached as present %s %s (%d:%d).Volume %s (%u:%u) differs from already active device (%u:%u).The requested major:minor pair (%u:%u) is already used.Failed to add device (%u:%u) to dtree.Tracking pending delete for %s (%s).Found version of %s %s is %s then requested %u.%u.%u.WARNING: Cannot parse output '%s' from %s.Failed to build device path for checking cachevol metadata %s.Failed to build device path for checking pool metadata %s.Metadata checking skipped, detected empty disk header on %s.Internal error: Unable to find configuration for pool check options.Invalid string in config file: global/%s_check_options.Too many options for %s command.WARNING: Check is skipped, please install recommended missing binary %s!WARNING: Check is skipped, please upgrade installed version of %s!Check of pool %s failed (status:%d). Manual repair required!WARNING: Integrity check of metadata for pool %s failed.Failed to allocated path for callback.Internal error: Registering unsupported pool callback.Tracking pending delete for %s %s (%s).Partial dtree creation failed for %s.Internal error: _add_error_or_zero_device called with bad segment.Aborting. LV %s is now incomplete and '--activationmode partial' was not specified.Internal error: Unassigned area found in LV %s.Cannot activate %s: pool incomplete.Internal error: LV %s is not merging snapshot.Couldn't find snapshot for '%s'.Internal error: _emit_target cannot handle segment type %s.Adding external origin LV %s and all active users.Finished adding external origin LV %s and all active users.Checking kernel supports %s segment type for %s%s%sCan't process LV %s: %s target support missing from kernel?Using error for pending delete %s._add_new_lv_to_dtree: pool alloc failed for %s %s.Add cachevol %s to dtree before cache %s.Failed to add cachevol to dtree before cache.Using error for pending meta delete %s.Using error for pending data delete %s.Merging of snapshot volume %s to origin %s is in progress.Postponing pending snapshot merge for origin %s, merge was not started before suspend.Postponing pending snapshot merge for origin %s, origin volume is opened.Postponing pending snapshot merge for origin volume %s, merging thin snapshot volume %s is active.Postponing pending snapshot merge for origin volume %s, merging snapshot volume %s is opened._create_lv_symlinks: Couldn't split up old device name %s._create_lv_symlinks: Couldn't split up new device name %s._clean_tree: Couldn't split up device name %s._clean_tree: Failed to duplicate uuid.Internal error: Cannot create tree for %s.Lost dependency tree root node.Failed to remove all device symlinks associated with %s.Failed to create symlinks for %s.Internal error: _tree_action: Action %u not supported.Failed to create partial dtree.Failed to add device %s (%u:%u) to dtree.Couldn't construct name of volume group directory.Couldn't create path for volume group dir %sCouldn't create source pathname for logical volume link %sCouldn't create destination pathname for logical volume link for %sCouldn't create pathname for LVM1 group file for %sNon-LVM1 character device found at %sSymbolic link %s not created: file existsSymlink %s that should have been created by udev does not have correct target. Falling back to direct link creationSymlink %s that should have been created by udev could not be checked for its correctness. Falling back to direct link creation.The link %s should have been created by udev but it was not found. Falling back to direct link creation.Couldn't determine link pathname.The link %s should have been removed by udev but it is still present. Falling back to direct link removal.%s not symbolic link - not removingNo space to stack fs operationSucessfully connected to lvmpolld on fd %d.WARNING: Failed to connect to lvmpolld. Proceeding with polling without using lvmpolld.WARNING: Check global/use_lvmpolld in lvm.conf or the lvmpolld daemon state.LVM command run by lvmpolld responded with: 'No such command.'LVM command run by lvmpolld failed due to invalid parameters.LVM command executed by lvmpolld failed.lvmpolld failed to duplicate file descriptors.lvmpolld failed to exec() lvm binary.lvmpolld responded with unexpected return code.For more information see lvmpolld messages in syslog or lvmpolld log file.lvmpolld failed to process a request. The reason was: %s.lvmpolld couldn't handle a request. It might be due to daemon internal state. The reason was: %s.Unexpected response %s. The reason: %s.Failed to create progress_info request.Failed to process request with error %s (errno: %d).No polling operation in progress regarding LV %s.Interval string conversion got truncated.Internal error: Use of lvmpolld requires uuid setInternal error: Use of lvmpolld requires vgname setInternal error: Use of lvmpolld requires lvname setAsking lvmpolld for pvmove%s on %s/%s.Asking lvmpolld for mirror conversion on %s/%s.Asking lvmpolld for snapshot merge on %s/%s.Asking lvmpolld for thin snapshot merge on %s/%s.Internal error: Unsupported poll operation.Internal error: Unsupported poll operationInternal error: use of lvmpolld requires uuid being setAsking lvmpolld for progress status of an operation on %s/%s.Command executed by lvmpolld got terminated by signal (%d).Polling finished successfully.Should not initialize lvmlockd with use_lvmlockd=0.WARNING: lvmlockd socket location is not configured.WARNING: lvmlockd process is not running.Should not connect to lvmlockd with use_lvmlockd=0.lvmlockd is already connected.Successfully connected to lvmlockd on fd %d.WARNING: lvmlockd connect failed.lockd_result %d flags %s lm %sFail to allocate PV list for VG %sFail to allocate PV path for VG %sFail to find any PVs for %s/%s, try to find PVs from VG insteadFail to allocate PV list for %s/%sFail to allocate PV path for LV %s/%sFind PV device %s for LV %s/%slvmlockd %s %s vg %s lv %s result %d %xlvmlockd %s %s vg %s result %d %xlvmlockd %s %s failed no resultCreating lvmlock LV for sanlock with size %um %ub %u extentsFailed to create sanlock lv %s in vg %sFailed to remove sanlock LV %s/%sExtend sanlock LV from %llus (%llu bytes) to %us (%u bytes)Extend sanlock LV %s to size %s failed.Failed to refresh sanlock LV %s after extend.Extend sanlock LV %s name too long - extended size not zeroed.Extend sanlock LV zeroing %u bytes from offset %llu to %lluZeroing %u MiB on extended internal lvmlock LV...Extend sanlock LV %s cannot find device.Extend sanlock LV %s cannot open device.Extend sanlock LV %s cannot zero device at %lu.Failed to activate sanlock lv %s/%sFailed to deactivate sanlock lv %s/%sVG %s init failed: lvmlockd not availableVG %s init failed: invalid parameters for dlmVG %s init failed: lock manager %s is not runningVG %s init failed: lock manager %s is not supported by lvmlockdVG %s init failed: a lockspace with the same name existsVG %s init failed: lock_args not returnedVG %s init failed: lock_args alloc failedVG %s init failed: vg_write vg_commitUsing sector size %u for sanlock LVVG %s init failed: invalid parameters for sanlockVG %s init failed: sanlock cannot open device /dev/mapper/%s-%sCheck that sanlock has permission to access disks.VG %s init failed: lock manager sanlock is not runningVG %s init failed: lock manager sanlock is not supported by lvmlockdVG %s init failed: no disk space for leases%s: lock type %s lvmlockd result %dLockspace for "%s" not stopped on other hostsGlobal lock failed: global lock was lost by removing a previous VG._free_vg_sanlock %s no lock_args_free_vg_sanlock lvmlockd result %dVG %s held the sanlock global lock, enable global lock in another VG.LV %s/%s must be inactive on all hosts.Cannot change VG %s with active LVsVG %s start failed: lvmlockd is not enabledVG %s start failed: lvmlockd is not runninglockd start VG %s lock_type %s init %dVG %s start failed: lvmlockd not availableVG %s start error: already startedVG %s start error: already startingVG %s start failed: invalid parameters for %sVG %s start failed: invalid sanlock host_id, set in lvmlocal.confVG %s start failed: lock manager %s is not runningVG %s start failed: lock manager %s is not supported by lvmlockdVG %s stop failed: LVs must first be deactivatedlockd_stop_vg deactivate sanlock lvMissing global lock: global lock was lost by removing a previous VG.To enable the global lock in another VG, see lvmlockctl --gl-enable.Cannot create VG with lock_type %s without lvmlockd.Global lock failed: check that lvmlockd is running.Global lock failed: start existing sanlock VGs to access global lock.(If all sanlock VGs are started, enable global lock with lvmlockctl.)Global lock failed: check that VG holding global lock exists and is started.Global lock failed: check that global lockspace is started.Start a lock manager, lvmlockd did not find one running.Global lock failed: lockspace is starting.Global lock failed: held by other host.VG create failed: lock manager %s is not supported by lvmlockd.Exclusive locks are not allowed with readonly option.Unknown lvmlockd global lock modeReading without shared global lock.lockd global mode %s already held.Global lock failed: lockspace is startingGlobal lock failed: check that global lockspace is startedGlobal lock failed: storage errors for sanlock leasesGlobal lock failed: storage failed for sanlock leasesSkipping global lock: lockspace is startingSkipping global lock: storage %s for sanlock leasesSkipping global lock: VG with global lock was removedSkipping global lock: lockspace not found or startedDuplicate sanlock global locks should be correctedVG %s lock skipped: lock start in progressVG %s lock failed: lock start in progressVG %s lock skipped: storage %s for sanlock leasesVG %s lock failed: storage %s for sanlock leasesVG %s lock skipped: held by other host.VG %s lock failed: held by other host.Duplicate sanlock global lock in VG %sLock query failed for LV %s/%squery_lock_lv lvmlockd result %dquery_lock_lv mode not returnedLV locks are not allowed with readonly option.WARNING: shared LV may require refresh on other hosts where it is active.Shared activation not compatible with LV type %s of %s/%slockd LV %s/%s mode %s uuid %sLV locked by other host: %s/%sWARNING: extending LV with a shared lock, other hosts may require LV refresh.LV is already locked with incompatible mode: %s/%sLV %s/%s lock failed: lockspace is inactiveLV %s/%s lock failed: storage %s for sanlock leasesLV %s/%s lock failed: error %dLock on incorrect thin lv type %s/%sCannot find thin pool for %s/%sLock on incorrect vdo lv type %s/%sLV in VG %s with lock_type %s requires lvmlockd.LV path too long for lvmlockd refresh.Lock already exists for LV %s/%sNo sanlock space for lock for LV %s/%s_init_lv_sanlock lvmlockd result %dlv_lock_args allocation failedlockd_init_lv: unknown lock_type.Cannot create snapshot without origin LV in shared VG.Failed to find origin LV %s/%sFailed to lock origin LV %s/%sFailed to find thin pool %s/%sFailed to lock thin pool %s/%sCreate thin pool and thin LV separately with lock type %sUnknown thin options for lock init.lockd_free_lv: unknown lock_type.LVs must be inactive before vgrename.Cannot rename VG %s with active LVslockd_rename_vg_before lvmlockd result %dlockd_rename_vg_before deactivate sanlock lvFailed to restart VG %s lockspace.lockd_rename_vg_final lvmlockd result %dFailed to start VG %s lockspace.Failed to get result from lvmlockdFailed to find a running lock manager.Refreshing LV %s on other hosts...Failed to refresh LV on all hosts.Manual lvchange --refresh required on all hosts for %s.Couldn't read '%s' for VDO segment.Unknown VDO pool logical volume %s.Internal error: Passed segment is not VDO type.Internal error: Passed segment is not VDO pool.WARNING: Target %s version %u.%u.%u is too old.Target %s %s support disabled by %s.String list allocation failed for VDO module.Failed to allocate memory for VDO segtypes.writethrough|writeback|passthrough[Number]r|R|h|H|b|B|s|S|k|K|m|M|g|G|t|T|p|P|e|Elinear|striped|snapshot|raid|mirror|thin|thin-pool|vdo|vdo-pool|cache|cache-pool|writecachecontiguous|cling|cling_by_tags|normal|anywhere|inheritpvmove|convert|merge|merge_thincurrent|default|diff|full|list|missing|new|profilable|profilable-command|profilable-metadatapv_header|metadata|label_headerheaders|metadata|metadata_all|metadata_search#pvmove Abort any pvmove operations in progress. If a pvmove was started with the --atomic option, then all LVs will remain on the source PV. Otherwise, segments that have been moved will remain on the destination PV, while unmoved segments will remain on the source PV. #lvpoll Stop processing a poll operation in lvmpolld. Determines if LV activation is allowed when PVs are missing, e.g. because of a device failure. \fBcomplete\fP only allows LVs with no missing PVs to be activated, and is the most restrictive mode. \fBdegraded\fP allows RAID LVs with missing PVs to be activated. (This does not include the "mirror" type, see "raid1" instead.) \fBpartial\fP allows any LV with missing PVs to be activated, and should only be used for recovery or repair. For default, see \fBlvm.conf\fP(5) activation_mode. See \fBlvmraid\fP(7) for more information. Adds a tag to a PV, VG or LV. This option can be repeated to add multiple tags at once. See \fBlvm\fP(8) for information about tags. Add a device to the devices file. Remove a device from the devices file. When used alone, --deldev specifies a device name. When used with --deviceidtype, --deldev specifies a device id. Find a device with the PVID and add the device to the devices file. Remove a device with the PVID from the devices file. Use with --separator to align the output columns Determines the allocation policy when a command needs to allocate Physical Extents (PEs) from the VG. Each VG and LV has an allocation policy which can be changed with vgchange/lvchange, or overridden on the command line. \fBnormal\fP applies common sense rules such as not placing parallel stripes on the same PV. \fBinherit\fP applies the VG policy to an LV. \fBcontiguous\fP requires new PEs be placed adjacent to existing PEs. \fBcling\fP places new PEs on the same PV as existing PEs in the same stripe of the LV. If there are sufficient PEs for an allocation, but normal does not use them, \fBanywhere\fP will use them even if it reduces performance, e.g. by placing two stripes on the same PV. Optional positional PV args on the command line can also be used to limit which PVs the command will use for allocation. See \fBlvm\fP(8) for more information about allocation. Makes a pvmove operation atomic, ensuring that all affected LVs are moved to the destination PV, or none are if the operation is aborted. Specify an LVM version in x.y.z format where x is the major version, the y is the minor version and z is the patchlevel (e.g. 2.2.106). When configuration is displayed, the configuration settings recognized at this LVM version will be considered only. This can be used to display a configuration that a certain LVM version understands and which does not contain any newer settings for which LVM would issue a warning message when checking the configuration. Specify if autoactivation is being used from an event. This allows the command to apply settings that are specific to event activation, such as device scanning optimizations using pvs_online files created by event-based pvscans. Set the autoactivation property on a VG or LV. Display the property with vgs or lvs "-o autoactivation". When the autoactivation property is disabled, the VG or LV will not be activated by a command doing autoactivation (vgchange, lvchange, or pvscan using -aay.) If autoactivation is disabled on a VG, no LVs will be autoactivated in that VG, and the LV autoactivation property has no effect. If autoactivation is enabled on a VG, autoactivation can be disabled for individual LVs. Use binary values "0" or "1" instead of descriptive literal values for columns that have exactly two valid values to report (not counting the "unknown" value which denotes that the value could not be determined). Reserve space for the bootloader between the LVM metadata area and the first PE. The bootloader area is reserved for bootloaders to embed their own data or metadata; LVM will not use it. The bootloader area begins where the first PE would otherwise be located. The first PE is moved out by the size of the bootloader area, and then moved out further if necessary to match the data alignment. The start of the bootloader area is always aligned, see also --dataalignment and --dataalignmentoffset. The bootloader area may be larger than requested due to the alignment, but it's never less than the requested size. To see the bootloader area start and size of an existing PV use pvs -o +pv_ba_start,pv_ba_size. #pvscan Scan one or more devices and record that they are online. #vgscan This option is no longer used. #lvscan This option is no longer used. Specifies the cache metadata format used by cache target. Specifies when writes to a cache LV should be considered complete. \fBwriteback\fP considers a write complete as soon as it is stored in the cache pool. \fBwritethough\fP considers a write complete only when it has been stored in both the cache pool and on the origin LV. While writethrough may be slower for writes, it is more resilient if something should happen to a device associated with the cache pool LV. With \fBpassthrough\fP, all reads are served from the origin LV (all reads miss the cache) and all writes are forwarded to the origin LV; additionally, write hits cause cache block invalidates. See \fBlvmcache\fP(7) for more information. The name of a device to use for a cache. Checks the content of the devices file. Reports incorrect device names or PVIDs for entries. The command profile to use for command configuration. See \fBlvm.conf\fP(5) for more information about profiles. Controls whether compression is enabled or disable for VDO volume. See \fBlvmvdo\fP(7) for more information about VDO usage. Config settings for the command. These override \fBlvm.conf\fP(5) settings. The String arg uses the same format as \fBlvm.conf\fP(5), or may use section/field syntax. See \fBlvm.conf\fP(5) for more information about config. \fBcurrent\fP prints the config settings that would be applied to an lvm command (assuming the command does not override them on the command line.) This includes: settings that have been modified in lvm config files, settings that get their default values from config files, and default settings that have been uncommented in config files. \fBdefault\fP prints all settings with their default values. Changes made in lvm config files are not reflected in the output. Some settings get their default values internally, and these settings are printed as comments. Other settings get their default values from config files, and these settings are not printed as comments. \fBdiff\fP prints only config settings that have been modified from their default values in config files (the difference between current and default.) \fBfull\fP prints every setting uncommented and set to the current value, i.e. how it would be used by an lvm command. This includes settings modified in config files, settings that usually get defaults internally, and settings that get defaults from config files. \fBlist\fP prints all config names without values. \fBmissing\fP prints settings that are missing from the lvm config files. A missing setting that usually gets its default from config files is printed uncommented and set to the internal default. Settings that get their default internally and are not set in config files are printed commented with the internal default. \fBnew\fP prints config settings that have been added since the lvm version specified by --sinceversion. They are printed with their default values. \fBprofilable\fP prints settings with their default values that can be set from a profile. \fBprofilable-command\fP prints settings with their default values that can be set from a command profile. \fBprofilable-metadata\fP prints settings with their default values that can be set from a metadata profile. Also see \fBlvm.conf\fP(5). Align the start of a PV data area with a multiple of this number. To see the location of the first Physical Extent (PE) of an existing PV, use pvs -o +pe_start. In addition, it may be shifted by an alignment offset, see --dataalignmentoffset. Also specify an appropriate PE size when creating a VG. Shift the start of the PV data area by this additional offset. Controls whether deduplication is enabled or disable for VDO volume. See \fBlvmvdo\fP(7) for more information about VDO usage. Deletes a tag from a PV, VG or LV. This option can be repeated to delete multiple tags at once. See \fBlvm\fP(8) for information about tags. Detaches a metadata profile from a VG or LV. See \fBlvm.conf\fP(5) for more information about profiles. The type of device ID to use for the device. If the specified type is available for the device, then it will override the default type that lvm would use. Restricts the devices that are visible and accessible to the command. Devices not listed will appear to be missing. This option can be repeated, or accepts a comma separated list of devices. This overrides the devices file. A file listing devices that LVM should use. The file must exist in \fI#DEFAULT_SYS_DIR#/devices/\fP and is managed with the \fBlvmdevices\fP(8) command. This overrides the \fBlvm.conf\fP(5) \fBdevices/devicesfile\fP and \fBdevices/use_devicesfile\fP settings. Specifies how the device-mapper thin pool layer in the kernel should handle discards. \fBignore\fP causes the thin pool to ignore discards. \fBnopassdown\fP causes the thin pool to process discards itself to allow reuse of unneeded extents in the thin pool. \fBpassdown\fP causes the thin pool to process discards itself (like nopassdown) and pass the discards to the underlying device. See \fBlvmthin\fP(7) for more information. If set to no, the command will not attempt to use device-mapper. For testing and debugging. Dump headers and metadata from a PV for debugging and repair. Option values include: \fBheaders\fP to print and check LVM headers, \fBmetadata\fP to print or save the current text metadata, \fBmetadata_all\fP to list or save all versions of metadata, \fBmetadata_search\fP to list or save all versions of metadata, searching standard locations in case of damaged headers, \fBmetadata_area\fP to save an entire text metadata area to a file. Specifies thin pool behavior when data space is exhausted. When yes, device-mapper will immediately return an error when a thin pool is full and an I/O request requires space. When no, device-mapper will queue these I/O requests for a period of time to allow the thin pool to be extended. Errors are returned if no space is available after the timeout. (Also see dm-thin-pool kernel module option no_space_timeout.) See \fBlvmthin\fP(7) for more information. Force metadata restore even with thin pool LVs. Use with extreme caution. Most changes to thin metadata cannot be reverted. You may lose data if you restore metadata that does not match the thin pool kernel metadata precisely. Report/display foreign VGs that would otherwise be skipped. See \fBlvmsystemid\fP(7) for more information about foreign VGs. Allows a polling operation to continue when PVs are missing, e.g. for repairs due to faulty devices. Exclude advanced configuration settings from the output. Ignore the local section. The local section should be defined in the lvmlocal.conf file, and should contain config settings specific to the local host which should not be copied to other hosts. Allows a command to continue with read-only metadata operations after locking failures. Do not interact with dmeventd unless --monitor is specified. Do not use this if dmeventd is already monitoring a device. Exclude unsupported configuration settings from the output. These settings are either used for debugging and development purposes only or their support is not yet complete and they are not meant to be used in production. The \fBcurrent\fP and \fBdiff\fP types include unsupported settings in their output by default, all the other types ignore unsupported settings. Add devices to the devices file. Record information in the systemd journal. This information is in addition to information enabled by the lvm.conf log/journal setting. command: record information about the command. output: record the default command output. debug: record full command debugging. By default the PV is labelled with an LVM2 identifier in its second sector (sector 1). This lets you use a different sector near the start of the disk (between 0 and 3 inclusive - see LABEL_SCAN_SECTORS in the source). Use with care. Print a list of LVs that use the device. Print the VG that uses the device. Check if all the devices used by a VG or LV are present, and print "complete" or "incomplete" for each listed VG or LV. This option is used as a part of event-based autoactivation, so pvscan will do nothing if this option is set and event_activation=0 in the config settings. Used to pass options for special cases to lvmlockd. See \fBlvmlockd\fP(8) for more information. Start the lockspace of a shared VG in lvmlockd. lvmlockd locks becomes available for the VG, allowing LVM to use the VG. See \fBlvmlockd\fP(8) for more information. Stop the lockspace of a shared VG in lvmlockd. lvmlockd locks become unavailable for the VG, preventing LVM from using the VG. See \fBlvmlockd\fP(8) for more information. #vgchange Change the VG lock type to or from a shared lock type used with lvmlockd. See \fBlvmlockd\fP(8) for more information. #vgcreate Specify the VG lock type directly in place of using --shared. See \fBlvmlockd\fP(8) for more information. Suppress command report and display only log report. Sets the maximum recovery rate for a RAID LV. The rate value is an amount of data per second for each device in the array. Setting the rate to 0 means it will be unbounded. See \fBlvmraid\fP(7) for more information. An alias for --mergethin, --mergemirrors, or --mergesnapshot, depending on the type of LV. Merge LV images that were split from a raid1 LV. See --splitmirrors with --trackchanges. Merge COW snapshot LV into its origin. When merging a snapshot, if both the origin and snapshot LVs are not open, the merge will start immediately. Otherwise, the merge will start the first time either the origin or snapshot LV are activated and both are closed. Merging a snapshot into an origin that cannot be closed, for example a root filesystem, is deferred until the next time the origin volume is activated. When merging starts, the resulting LV will have the origin's name, minor number and UUID. While the merge is in progress, reads or writes to the origin appear as being directed to the snapshot being merged. When the merge finishes, the merged snapshot is removed. Multiple snapshots may be specified on the command line or a @tag may be used to specify multiple snapshots be merged to their respective origin. Merge thin LV into its origin LV. The origin thin LV takes the content of the thin snapshot, and the thin snapshot LV is removed. See \fBlvmthin\fP(7) for more information. When the command is run with --config and/or --commandprofile (or using LVM_COMMAND_PROFILE environment variable), --profile, or --metadataprofile, merge all the contents of the "config cascade" before displaying it. Without merging, only the configuration at the front of the cascade is displayed. See \fBlvm.conf\fP(5) for more information about config. Specifies the metadataignore property of a PV. If yes, metadata areas on the PV are ignored, and lvm will not store metadata in the metadata areas of the PV. If no, lvm will store metadata on the PV. The metadata profile to use for command configuration. See \fBlvm.conf\fP(5) for more information about profiles. The approximate amount of space used for each VG metadata area. The size may be rounded. #lvcreate #lvchange Sets the minor number of an LV block device. #pvscan The minor number of a device. Sets the minimum recovery rate for a RAID LV. The rate value is an amount of data per second for each device in the array. Setting the rate to 0 means it will be unbounded. See \fBlvmraid\fP(7) for more information. Specifies the type of mirror log for LVs with the "mirror" type (does not apply to the "raid1" type.) \fBdisk\fP is a persistent log and requires a small amount of storage space, usually on a separate device from the data being mirrored. \fBcore\fP is not persistent; the log is kept only in memory. In this case, the mirror must be synchronized (by copying LV data from the first device to others) each time the LV is activated, e.g. after reboot. \fBmirrored\fP is a persistent log that is itself mirrored, but should be avoided. Instead, use the raid1 type for log redundancy. Only remove missing PVs from mirror LVs. Also checks the LVM special files in /dev that are needed for active LVs and creates any missing ones and removes unused ones. Start (yes) or stop (no) monitoring an LV with dmeventd. dmeventd monitors kernel events for an LV, and performs automated maintenance for the LV in reponse to specific events. See \fBdmeventd\fP(8) for more information. Add an "LVM2_" prefix plus the field name to the output. Useful with --noheadings to produce a list of field=value pairs that can be used to set environment variables (for example, in udev rules). Suppress the headings line that is normally the first line of output. Useful if grepping the output. Do not use the hints file to locate devices for PVs. A command may read more devices to find PVs when hints are not used. The command will still perform standard hint file invalidation where appropriate. Do not record history of LVs being removed. This has no effect unless the configuration setting metadata/record_lvs_history is enabled. Disable locking. Use with caution, concurrent commands may produce incorrect results. In conjunction with --uuid, this allows a uuid to be specified without also requiring that a backup of the metadata be provided. Suppress the suffix on output sizes. Use with --units (except h and H) if processing the output. Causes the creation of mirror, raid1, raid4, raid5 and raid10 to skip the initial synchronization. In case of mirror, raid1 and raid10, any data written afterwards will be mirrored, but the original contents will not be copied. In case of raid4 and raid5, no parity blocks will be written, though any data written afterwards will cause parity blocks to be stored. This is useful for skipping a potentially long and resource intensive initial sync of an empty mirror/raid1/raid4/raid5 and raid10 LV. This option is not valid for raid6, because raid6 relies on proper parity (P and Q Syndromes) being created during initial synchronization in order to reconstruct proper user date in case of device failures. raid0 and raid0_meta do not provide any data copies or parity support and thus do not support initial synchronization. Send a notification to D-Bus. The command will exit with an error if LVM is not built with support for D-Bus notification, or if the notify_dbus config setting is disabled. Disables udev synchronisation. The process will not wait for notification from udev. It will continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. Specifies the name to use for the external origin LV when converting an LV to a thin LV. The LV being converted becomes a read-only external origin with this name. Overrides the automatically detected size of the PV. Use with care, or prior to reducing the physical size of the device. Specifies command specific settings in "Key = Value" form. Combine multiple settings in quotes, or repeat the settings option for each. When yes, start the background transformation of an LV. An incomplete transformation, e.g. pvmove or lvconvert interrupted by reboot or crash, can be restarted from the last checkpoint with --poll y. When no, background transformation of an LV will not occur, and the transformation will not complete. It may not be appropriate to immediately poll an LV after activation, in which case --poll n can be used to defer polling until a later --poll y command. The command to perform from lvmpolld. The name of a an LV to use for storing pool metadata. #lvcreate #lvconvert Specifies the size of the new pool metadata LV. #lvresize #lvextend Specifies the new size of the pool metadata LV. The plus prefix \fB+\fP can be used, in which case the value is added to the current size. Enable or disable the automatic creation and management of a spare pool metadata LV in the VG. A spare metadata LV is reserved space that can be used when repairing a pool. An alias for --commandprofile or --metadataprofile, depending on the command. The number of metadata areas to set aside on a PV for storing VG metadata. When 2, one copy of the VG metadata is stored at the front of the PV and a second copy is stored at the end. When 1, one copy of the VG metadata is stored at the front of the PV. When 0, no copies of the VG metadata are stored on the given PV. This may be useful in VGs containing many PVs (this places limitations on the ability to use vgsplit later.) Enable or disable data integrity checksums for raid images. The block size to use for dm-integrity on raid images. The integrity block size should usually match the device logical block size, or the file system block size. It may be less than the file system block size, but not less than the device logical block size. Possible values: 512, 1024, 2048, 4096. Use a journal (default) or bitmap for keeping integrity checksums consistent in case of a crash. The bitmap areas are recalculated after a crash, so corruption in those areas would not be detected. A journal does not have this problem. The journal mode doubles writes to storage, but can improve performance for scattered writes packed into a single journal write. bitmap mode can in theory achieve full write throughput of the device, but would not benefit from the potential scattered write optimization. Run the command in a special read-only mode which will read on-disk metadata without needing to take any locks. This can be used to peek inside metadata used by a virtual machine image while the virtual machine is running. No attempt will be made to communicate with the device-mapper kernel driver, so this option is unable to report whether or not LVs are actually in use. If the LV is active, reload its metadata. This is not necessary in normal operation, but may be useful if something has gone wrong, or if some form of manual LV sharing is being used. Removes all missing PVs from the VG, if there are no LVs allocated on them. This resumes normal operation of the VG (new LVs may again be created, changed and so on). If this is not possible because LVs are referencing the missing PVs, this option can be combined with --force to have the command remove any partial LVs. In this case, any LVs and dependent snapshots that were partly on the missing disks are removed completely, including those parts on disks that are still present. If LVs spanned several disks, including ones that are lost, salvaging some data first may be possible by activating LVs in partial mode. Selects a PV to rebuild in a raid LV. Multiple PVs can be rebuilt by repeating this option. Use this option in place of --resync or --syncaction repair when the PVs with corrupted data are known, and their data should be reconstructed rather than reconstructing default (rotating) data. See \fBlvmraid\fP(7) for more information. #lvconvert Replace failed PVs in a raid or mirror LV, or run a repair utility on a thin pool. See \fBlvmraid\fP(7) and \fBlvmthin\fP(7) for more information. #pvck Repair headers and metadata on a PV. Repair headers and metadata on a PV. See command description. Replace a specific PV in a raid LV with another PV. The new PV to use can be optionally specified after the LV. Multiple PVs can be replaced by repeating this option. See \fBlvmraid\fP(7) for more information. Overrides current output format for reports which is defined globally by the report/output_format setting in \fBlvm.conf\fP(5). \fBbasic\fP is the original format with columns and rows. If there is more than one report per command, each report is prefixed with the report name for identification. \fBjson\fP produces report output in JSON format. See \fBlvmreport\fP(7) for more information. In conjunction with --uuid, this reads the file (produced by vgcfgbackup), extracts the location and size of the data on the PV, and ensures that the metadata produced by the program is consistent with the contents of the file, i.e. the physical extents will be in the same place and not be overwritten by new metadata. This provides a mechanism to upgrade the metadata format or to add/remove metadata areas. Use with care. Add a PV back into a VG after the PV was missing and then returned, e.g. due to a transient failure. The PV is not reinitialized. Initiates mirror synchronization. Synchronization generally happens automatically, but this option forces it to run. Also see --rebuild to synchronize a specific PV. During synchronization, data is read from the primary mirror device and copied to the others. This can take considerable time, during which the LV is without a complete redundant copy of the data. See \fBlvmraid\fP(7) for more information. #pvs Produces one line of output for each contiguous allocation of space on each PV, showing the start (pvseg_start) and length (pvseg_size) in units of physical extents. #lvs Use default columns that emphasize segment information. String to use to separate each column. Useful if grepping the output. #vgcreate Create a shared VG using lvmlockd if LVM is compiled with lockd support. lvmlockd will select lock type sanlock or dlm depending on which lock manager is running. This allows multiple hosts to share a VG on shared devices. lvmlockd and a lock manager must be configured and running. See \fBlvmlockd\fP(8) for more information about shared VGs. #vgs #lvs #pvs #fullreport #vgdisplay #lvdisplay #pvdisplay Report/display shared VGs that would otherwise be skipped when lvmlockd is not being used on the host. See \fBlvmlockd\fP(8) for more information about shared VGs. Specify an LVM version in x.y.z format where x is the major version, the y is the minor version and z is the patchlevel (e.g. 2.2.106). This option is currently applicable only with --typeconfig new to display all configuration settings introduced since given version. Separates a cache pool from a cache LV, and keeps the unused cache pool LV. Before the separation, the cache is flushed. Also see --uncache. Splits the specified number of images from a raid1 or mirror LV and uses them to create a new LV. If --trackchanges is also specified, changes to the raid1 LV are tracked while the split LV remains detached. If --name is specified, then the images are permanently split from the original LV and changes are not tracked. Separates a COW snapshot from its origin LV. The LV that is split off contains the chunks that differ from the origin LV along with metadata describing them. This LV can be wiped and then destroyed with lvremove. Include deprecated configuration settings in the output. These settings are deprecated after a certain version. If a concrete version is specified with --atversion, deprecated settings are automatically included if the specified version is lower than the version in which the settings were deprecated. The current and diff types include deprecated settings in their output by default, all the other types ignore deprecated settings. Include unsupported configuration settings in the output. These settings are either used for debugging or development purposes only, or their support is not yet complete and they are not meant to be used in production. The current and diff types include unsupported settings in their output by default, all the other types ignore unsupported settings. Start polling an LV to continue processing a conversion. Specifies the number of stripes in a striped LV. This is the number of PVs (devices) that a striped LV is spread across. Data that appears sequential in the LV is spread across multiple devices in units of the stripe size (see --stripesize). This does not apply to existing allocated space, only newly allocated space can be striped. Extracts the metadata LV from a pool and replaces it with another specified LV. The extracted LV is preserved and given the name of the LV that replaced it. Use for repair only. When the metadata LV is swapped out of the pool, it can be activated directly and used with thin provisioning tools: \fBcache_dump\fP(8), \fBcache_repair\fP(8), \fBcache_restore\fP(8), \fBthin_dump\fP(8), \fBthin_repair\fP(8), \fBthin_restore\fP(8). Initiate different types of RAID synchronization. This causes the RAID LV to read all data and parity blocks in the array and check for discrepancies (mismatches between mirrors or incorrect parity values). \fBcheck\fP will count but not correct discrepancies. \fBrepair\fP will correct discrepancies. See \fBlvs\fP(8) for reporting discrepancies found or repaired. Indicates that vgchange/lvchange is being invoked from early system initialisation scripts (e.g. rc.sysinit or an initrd), before writable filesystems are available. As such, some functionality needs to be disabled and this option acts as a shortcut which selects an appropriate set of options. Currently, this is equivalent to using --ignorelockingfailure, --ignoremonitoring, --poll n, and setting env var LVM_SUPPRESS_LOCKING_FAILURE_MESSAGES. vgchange/lvchange skip autoactivation, and defer to pvscan autoactivation. #vgcreate Specifies the system ID that will be given to the new VG, overriding the system ID of the host running the command. A VG is normally created without this option, in which case the new VG is given the system ID of the host creating it. Using this option requires caution because the system ID of the new VG may not match the system ID of the host running the command, leaving the VG inaccessible to the host. See \fBlvmsystemid\fP(7) for more information. #vgchange Changes the system ID of the VG. Using this option requires caution because the VG may become foreign to the host running the command, leaving the host unable to access it. See \fBlvmsystemid\fP(7) for more information. Can be used with --splitmirrors on a raid1 LV. This causes changes to the original raid1 LV to be tracked while the split images remain detached. This is a temporary state that allows the read-only detached image to be merged efficiently back into the raid1 LV later. Only the regions with changed data are resynchronized during merge. While a raid1 LV is tracking changes, operations on it are limited to merging the split image (see --mergemirrors) or permanently splitting the image (see --splitmirrors with --name. The LV type, also known as "segment type" or "segtype". See usage descriptions for the specific ways to use these types. For more information about redundancy and performance (\fBraid\fP, \fBmirror\fP, \fBstriped\fP, \fBlinear\fP) see \fBlvmraid\fP(7). For thin provisioning (\fBthin\fP, \fBthin-pool\fP) see \fBlvmthin\fP(7). For performance caching (\fBcache\fP, \fBcache-pool\fP) see \fBlvmcache\fP(7). For copy-on-write snapshots (\fBsnapshot\fP) see usage definitions. For VDO (\fBvdo\fP) see \fBlvmvdo\fP(7). Several commands omit an explicit type option because the type is inferred from other options or shortcuts (e.g. --stripes, --mirrors, --snapshot, --virtualsize, --thin, --cache, --vdo). Use inferred types with care because it can lead to unexpected results. Command output is modified to be imported from a udev rule. Produce output immediately without sorting or aligning the columns properly. Separates a cache pool from a cache LV, and deletes the unused cache pool LV. Before the separation, the cache is flushed. Also see --splitcache. Update the content of the devices file. Specifies the cache policy for a cache LV. See \fBlvmcache\fP(7) for more information. Specifies tunable kernel options for dm-cache or dm-writecache LVs. Use the form 'option=value' or 'option1=value option2=value', or repeat --cachesettings for each option being set. These settings override the default kernel behaviors which are usually adequate. To remove cachesettings and revert to the default kernel behaviors, use --cachesettings 'default' for dm-cache or an empty string --cachesettings '' for dm-writecache. See \fBlvmcache\fP(7) for more information. Internal option used for generating config file during build. All sizes are output in these units: human-(r)eadable with '<' rounding indicator, (h)uman-readable, (b)ytes, (s)ectors, (k)ilobytes, (m)egabytes, (g)igabytes, (t)erabytes, (p)etabytes, (e)xabytes. Capitalise to use multiples of 1000 (S.I.) instead of 1024. Custom units can be specified, e.g. --units 3M. When used with --nameprefixes, output values in the field=value pairs are not quoted. Perform an operation according to the policy configured in \fBlvm.conf\fP(5) or a profile. Validate current configuration used and exit with appropriate return code. The validation is done only for the configuration at the front of the "config cascade". To validate the whole merged configuration tree, also use --mergedconfig. The validation is done even if \fBlvm.conf\fP(5) \fBconfig/checks\fP is disabled. Specifies the command is handling VDO LV. See --type vdo. See \fBlvmvdo\fP(7) for more information about VDO usage. The name of a VDO pool LV. See \fBlvmvdo\fP(7) for more information about VDO usage. Specifies tunable VDO options for VDO LVs. Use the form 'option=value' or 'option1=value option2=value', or repeat --vdosettings for each option being set. These settings override the default VDO behaviors. To remove vdosettings and revert to the default VDO behaviors, use --vdosettings 'default'. See \fBlvmvdo\fP(7) for more information. Number of copies of the VG metadata that are kept. VG metadata is kept in VG metadata areas on PVs in the VG, i.e. reserved space at the start and/or end of the PVs. Keeping a copy of the VG metadata on every PV can reduce performance in VGs containing a large number of PVs. When this number is set to a non-zero value, LVM will automatically choose PVs on which to store metadata, using the metadataignore flags on PVs to achieve the specified number. The number can also be replaced with special string values: \fBunmanaged\fP causes LVM to not automatically manage the PV metadataignore flags. \fBall\fP causes LVM to first clear the metadataignore flags on all PVs, and then to become unmanaged. The first command to see a complete VG will report it uniquely. Other commands to see the complete VG will report it differently. Display a one line comment for each configuration node. Display a full comment for each configuration node. For deprecated settings, also display comments about deprecation. Include general config file preamble. Include local config file preamble. Where appropriate, add more spaces in output for better readability. Also display a comment containing the version of introduction for each configuration node. If the setting is deprecated, also display the version since which it is deprecated. The maximum number of outstanding writes that are allowed to devices in a RAID1 LV that is marked write-mostly. Once this value is exceeded, writes become synchronous (i.e. all writes to the constituent devices must complete before the array signals the write has completed). Setting the value to zero clears the preference and allows the system to choose the value arbitrarily. Mark a device in a RAID1 LV as write-mostly. All reads to these drives will be avoided unless absolutely necessary. This keeps the number of I/Os to the drive to a minimum. The default behavior is to set the write-mostly attribute for the specified PV. It is also possible to remove the write-mostly flag by adding the suffix \fB:n\fP at the end of the PV name, or to toggle the value with the suffix \fB:t\fP. Repeat this option to change the attribute on multiple PVs. #pvscan Auto-activate LVs in a VG when the PVs scanned have completed the VG. (Only \fBay\fP is applicable.) #lvchange #vgchange Change the active state of LVs. An active LV can be used through a block device, allowing data on the LV to be accessed. \fBy\fP makes LVs active, or available. \fBn\fP makes LVs inactive, or unavailable. The block device for the LV is added or removed from the system using device-mapper in the kernel. A symbolic link /dev/VGName/LVName pointing to the device node is also added/removed. All software and scripts should access the device through the symbolic link and present this as the name of the device. The location and name of the underlying device node may depend on the distribution, configuration (e.g. udev), or release version. \fBay\fP specifies autoactivation, which is used by system-generated activation commands. By default, LVs are autoactivated. An autoactivation property can be set on a VG or LV to disable autoactivation, see --setautoactivation y|n in vgchange, lvchange, vgcreate, and lvcreate. Display the property with vgs or lvs "-o autoactivation". The \fBlvm.conf\fP(5) auto_activation_volume_list includes names of VGs or LVs that should be autoactivated, and anything not listed is not autoactivated. When auto_activation_volume_list is undefined (the default), it has no effect. If auto_activation_volume_list is defined and empty, no LVs are autoactivated. Items included by auto_activation_volume_list will not be autoactivated if the autoactivation property has been disabled. See \fBlvmlockd\fP(8) for more information about activation options \fBey\fP and \fBsy\fP for shared VGs. #lvcreate Controls the active state of the new LV. \fBy\fP makes the LV active, or available. New LVs are made active by default. \fBn\fP makes the LV inactive, or unavailable, only when possible. In some cases, creating an LV requires it to be active. For example, COW snapshots of an active origin LV can only be created in the active state (this does not apply to thin snapshots). The --zero option normally requires the LV to be active. If autoactivation \fBay\fP is used, the LV is only activated if it matches an item in \fBlvm.conf\fP(5) \fBactivation/auto_activation_volume_list\fP. \fBay\fP implies --zero n and --wipesignatures n. See \fBlvmlockd\fP(8) for more information about activation options for shared VGs. #vgreduce Removes all empty PVs if none are named on the command line. #pvchange Change all visible PVs. #vgimport Import all visible VGs. #lvscan #lvdisplay #lvs Show information about internal LVs. These are components of normal LVs, such as mirrors, which are not independently accessible, e.g. not mountable. #vgs List all VGs. Equivalent to not specifying any VGs. #pvs #pvdisplay Show information about devices that have not been initialized by LVM, i.e. they are not PVs. Specifies if metadata should be backed up automatically after a change. Enabling this is strongly advised! See \fBvgcfgbackup\fP(8) for more information. Only select active VGs. The VG is considered active if at least one of its LVs is active. If the operation requires polling, this option causes the command to return before the operation is complete, and polling is done in the background. By default the snapshot VG will be renamed to the original name plus a numeric suffix to avoid duplicate naming (e.g. 'test_vg' would be renamed to 'test_vg1'). This option will override the base VG name that is used for all VG renames. If a VG already exists with the specified name a numeric suffix will be added (like the previous example) to make it unique. The size of chunks in a snapshot, cache pool or thin pool. For snapshots, the value must be a power of 2 between 4KiB and 512KiB and the default value is 4. For a cache pool the value must be between 32KiB and 1GiB and the default value is 64. For a thin pool the value must be between 64KiB and 1GiB and the default value starts with 64 and scales up to fit the pool metadata size within 128MiB, if the pool metadata size is not specified. The value must be a multiple of 64KiB. See \fBlvmthin\fP(7) and \fBlvmcache\fP(7) for more information. This option was specific to clvm and is now replaced by the --shared option with \fBlvmlockd\fP(8). Generate colon separated output for easier parsing in scripts or programs. Also see \fBvgs\fP(8) which provides considerably more control over the output. Display output in columns, the equivalent of \fBvgs\fP(8). Options listed are the same as options given in \fBvgs\fP(8). Sets or resets the contiguous allocation policy for LVs. Default is no contiguous allocation based on a next free principle. It is only possible to change a non-contiguous allocation policy to contiguous if all of the allocated physical extents in the LV are already contiguous. Set debug level. Repeat from 1 to 6 times to increase the detail of messages sent to the log file and/or syslog (if configured). Only show PVs belonging to exported VGs. #pvck Metadata file to read or write. #lvmconfig #dumpconfig #config Write output to the named file. #vgcfgbackup Write the backup to the named file. When backing up more than one VG, the file name is treated as a template, and %s is replaced by the VG name. #vgcfgrestore Read metadata backup from the named file. Usually this file was created by vgcfgbackup. Override various checks, confirmations and protections. Use with extreme caution. Specifies the command is handling a cache LV or cache pool. See --type cache and --type cache-pool. See \fBlvmcache\fP(7) for more information about LVM caching. Include historical LVs in the output. (This has no effect unless LVs were removed while \fBlvm.conf\fP(5) \fBmetadata/record_lvs_history\fP was enabled. Import exported VGs. Otherwise VGs that have been exported will not be changed (nor will their associated PVs). Report progress at regular intervals. Specifies the number of stripes in a striped LV. This is the number of PVs (devices) that a striped LV is spread across. Data that appears sequential in the LV is spread across multiple devices in units of the stripe size (see --stripesize). This does not change existing allocated space, but only applies to space being allocated by the command. When creating a RAID 4/5/6 LV, this number does not include the extra devices that are required for parity. The largest number depends on the RAID type (raid0: 64, raid10: 32, raid4/5: 63, raid6: 62), and when unspecified, the default depends on the RAID type (raid0: 2, raid10: 2, raid4/5: 3, raid6: 5.) To stripe a new raid LV across all PVs by default, see \fBlvm.conf\fP(5) \fBallocation/raid_stripe_all_devices\fP. The amount of data that is written to one device before moving to the next in a striped LV. Sets the maximum number of LVs allowed in a VG. #lvcreate Specifies the size of the new LV in logical extents. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. An alternate syntax allows the size to be determined indirectly as a percentage of the size of a related VG, LV, or set of PVs. The suffix \fB%VG\fP denotes the total size of the VG, the suffix \fB%FREE\fP the remaining free space in the VG, and the suffix \fB%PVS\fP the free space in the specified PVs. For a snapshot, the size can be expressed as a percentage of the total size of the origin LV with the suffix \fB%ORIGIN\fP (\fB100%ORIGIN\fP provides space for the whole origin). When expressed as a percentage, the size defines an upper limit for the number of logical extents in the new LV. The precise number of logical extents in the new LV is not determined until the command has completed. #lvreduce #lvextend #lvresize Specifies the new size of the LV in logical extents. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. An alternate syntax allows the size to be determined indirectly as a percentage of the size of a related VG, LV, or set of PVs. The suffix \fB%VG\fP denotes the total size of the VG, the suffix \fB%FREE\fP the remaining free space in the VG, and the suffix \fB%PVS\fP the free space in the specified PVs. For a snapshot, the size can be expressed as a percentage of the total size of the origin LV with the suffix \fB%ORIGIN\fP (\fB100%ORIGIN\fP provides space for the whole origin). When expressed as a percentage, the size defines an upper limit for the number of logical extents in the new LV. The precise number of logical extents in the new LV is not determined until the command has completed. When the plus \fB+\fP or minus \fB-\fP prefix is used, the value is not an absolute size, but is relative and added or subtracted from the current size. #lvmconfig #dumpconfig #config List config settings with summarizing comment. This is the same as using options --typeconfig list --withsummary. #vgcfgrestore List metadata backup and archive files pertaining to the VG. May be used with --file. Does not restore the VG. #vgmerge Display merged destination VG like vgdisplay -v. #lvcreate Specifies the size of the new LV. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. #lvreduce #lvextend #lvresize Specifies the new size of the LV. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. When the plus \fB+\fP or minus \fB-\fP prefix is used, the value is not an absolute size, but is relative and added or subtracted from the current size. When yes, makes the specified minor number persistent. #lvcreate #lvchange Sets the major number of an LV block device. #pvscan The major number of a device. Persistently sets (yes) or clears (no) the "activation skip" flag on an LV. An LV with this flag set is not activated unless the --ignoreactivationskip option is used by the activation command. This flag is set by default on new thin snapshot LVs. The flag is not applied to deactivation. The current value of the flag is indicated in the lvs lv_attr bits. Ignore the "activation skip" LV flag during activation to allow LVs with the flag set to be activated. #lvdisplay Display the mapping of logical extents to PVs and physical extents. To map physical extents to logical extents use: pvs --segments -o+lv_name,seg_start_pe,segtype #pvdisplay Display the mapping of physical extents to LVs and logical extents. #lvcreate Specifies the number of mirror images in addition to the original LV image, e.g. --mirrors 1 means there are two images of the data, the original and one mirror image. Optional positional PV args on the command line can specify the devices the images should be placed on. There are two mirroring implementations: "raid1" and "mirror". These are the names of the corresponding LV types, or "segment types". Use the --type option to specify which to use (raid1 is default, and mirror is legacy) Use \fBlvm.conf\fP(5) \fBglobal/mirror_segtype_default\fP and global/raid10_segtype_default to configure the default types. See the --nosync option for avoiding initial image synchronization. See \fBlvmraid\fP(7) for more information. #lvconvert Specifies the number of mirror images in addition to the original LV image, e.g. --mirrors 1 means there are two images of the data, the original and one mirror image. Optional positional PV args on the command line can specify the devices the images should be placed on. There are two mirroring implementations: "raid1" and "mirror". These are the names of the corresponding LV types, or "segment types". Use the --type option to specify which to use (raid1 is default, and mirror is legacy) Use \fBlvm.conf\fP(5) \fBglobal/mirror_segtype_default\fP and global/raid10_segtype_default to configure the default types. The plus prefix \fB+\fP can be used, in which case the number is added to the current number of images, or the minus prefix \fB-\fP can be used, in which case the number is subtracted from the current number of images. See \fBlvmraid\fP(7) for more information. #lvextend Not used. Specifies the type of on-disk metadata to use. \fBlvm2\fP (or just \fB2\fP) is the current, standard format. \fBlvm1\fP (or just \fB1\fP) is no longer used. #lvcreate #lvconvert Specifies the name of a new LV. When unspecified, a default name of "lvol#" is generated, where # is a number generated by LVM. #pvmove Move only the extents belonging to the named LV. #vgsplit Move only PVs used by the named LV. Do not perform fsck before resizing filesystem when filesystem requires it. You may need to use --force to proceed with this option. Only show PVs not belonging to any VG. Comma-separated, ordered list of fields to display in columns. String arg syntax is: [\fB+\fP|\fB-\fP|\fB#\fP]\fIField1\fP[\fB,\fP\fIField2\fP ...] The prefix \fB+\fP will append the specified fields to the default fields, \fB-\fP will remove the specified fields from the default fields, and \fB#\fP will compact specified fields (removing them when empty for all rows.) Use \fB-o help\fP to view the list of all available fields. Use separate lists of fields to add, remove or compact by repeating the -o option: -o+field1,field2 -o-field3,field4 -o#field5. These lists are evaluated from left to right. Use field name \fBlv_all\fP to view all LV fields, \fBvg_all\fP all VG fields, \fBpv_all\fP all PV fields, \fBpvseg_all\fP all PV segment fields, \fBseg_all\fP all LV segment fields, and \fBpvseg_all\fP all PV segment columns. See the \fBlvm.conf\fP(5) report section for more config options. See \fBlvmreport\fP(7) for more information about reporting. Comma-separated ordered list of columns to sort by. Replaces the default selection. Precede any column with \fB-\fP for a reverse sort on that column. Sets the maximum number of PVs that can belong to the VG. The value 0 removes any limitation. For large numbers of PVs, also see options --pvmetadatacopies, and --vgmetadatacopies for improving performance. Set access permission to read only \fBr\fP or read and write \fBrw\fP. Commands will do their best to activate LVs with missing PV extents. Missing extents may be replaced with error or zero segments according to the missing_stripe_filler setting. Metadata may not be changed with this option. Suppress output and log messages. Overrides --debug and --verbose. Repeat once to also suppress any prompts with answer 'no'. Sets read ahead sector count of an LV. \fBauto\fP is the default which allows the kernel to choose a suitable value automatically. \fBnone\fP is equivalent to zero. Resize underlying filesystem together with the LV using \fBfsadm\fP(8). Size of each raid or mirror synchronization region. \fBlvm.conf\fP(5) \fBactivation/raid_region_size\fP can be used to configure a default. #vgcreate Sets the physical extent size of PVs in the VG. The value must be either a power of 2 of at least 1 sector (where the sector size is the largest sector size of the PVs currently used in the VG), or at least 128KiB. Once this value has been set, it is difficult to change without recreating the VG, unless no extents need moving. #vgchange Sets the physical extent size of PVs in the VG. The value must be either a power of 2 of at least 1 sector (where the sector size is the largest sector size of the PVs currently used in the VG), or at least 128KiB. Once this value has been set, it is difficult to change without recreating the VG, unless no extents need moving. Before increasing the physical extent size, you might need to use lvresize, pvresize and/or pvmove so that everything fits. For example, every contiguous range of extents used in a LV must start and end on an extent boundary. #lvcreate Create a snapshot. Snapshots provide a "frozen image" of an origin LV. The snapshot LV can be used, e.g. for backups, while the origin LV continues to be used. This option can create a COW (copy on write) snapshot, or a thin snapshot (in a thin pool.) Thin snapshots are created when the origin is a thin LV and the size option is NOT specified. Thin snapshots share the same blocks in the thin pool, and do not allocate new space from the VG. Thin snapshots are created with the "activation skip" flag, see --setactivationskip. A thin snapshot of a non-thin "external origin" LV is created when a thin pool is specified. Unprovisioned blocks in the thin snapshot LV are read from the external origin LV. The external origin LV must be read-only. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. COW snapshots are created when a size is specified. The size is allocated from space in the VG, and is the amount of space that can be used for saving COW blocks as writes occur to the origin or snapshot. The size chosen should depend upon the amount of writes that are expected; often 20% of the origin LV is enough. If COW space runs low, it can be extended with lvextend (shrinking is also allowed with lvreduce.) A small amount of the COW snapshot LV size is used to track COW block locations, so the full size is not available for COW data blocks. Use lvs to check how much space is used, and see --monitor to to automatically extend the size to avoid running out of space. #lvconvert Combine a former COW snapshot LV with a former origin LV to reverse a previous --splitsnapshot command. #pvdisplay Only display the size of the given PVs. #vgdisplay Give a short listing showing the existence of VGs. #pvscan Short listing format. Select objects for processing and reporting based on specified criteria. The criteria syntax is described by \fB--select help\fP and \fBlvmreport\fP(7). For reporting commands, one row is displayed for each object matching the criteria. See \fB--options help\fP for selectable object fields. Rows can be displayed with an additional "selected" field (-o selected) showing 1 if the row matches the selection and 0 otherwise. For non-reporting commands which process LVM entities, the selection is used to choose items to process. Run in test mode. Commands will not update metadata. This is implemented by disabling all metadata writing but nevertheless returning success to the calling function. This may lead to unusual error messages in multi-stage operations if a tool relies on reading back metadata it believes has changed but hasn't. Specifies the command is handling a thin LV or thin pool. See --type thin, --type thin-pool, and --virtualsize. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. Update VG metadata to correct problems. If VG metadata was updated while a PV was missing, and the PV reappears with an old version of metadata, then this option (or any other command that writes metadata) will update the metadata on the previously missing PV. If a PV was removed from a VG while it was missing, and the PV reappears, using this option will clear the outdated metadata from the previously missing PV. If metadata text is damaged on one PV, using this option will replace the damaged metadata text. For more severe damage, e.g. with headers, see \fBpvck\fP(8). #pvchange Generate new random UUID for specified PVs. #pvscan Show UUIDs in addition to device names. #vgchange Generate new random UUID for specified VGs. Specify a UUID for the device. Without this option, a random UUID is generated. This option is needed before restoring a backup of LVM metadata onto a replacement device; see \fBvgcfgrestore\fP(8). As such, use of --restorefile is compulsory unless the --norestorefile is used. All PVs must have unique UUIDs, and LVM will prevent certain operations if multiple devices are seen with the same UUID. See \fBvgimportclone\fP(8) for more information. Set verbose level. Repeat from 1 to 4 times to increase the detail of messages sent to stdout and stderr. The virtual size of a new thin LV. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. Using virtual size (-V) and actual size (-L) together creates a sparse LV. \fBlvm.conf\fP(5) \fBglobal/sparse_segtype_default\fP determines the default segment type used to create a sparse LV. Anything written to a sparse LV will be returned when reading from it. Reading from other areas of the LV will return blocks of zeros. When using a snapshot to create a sparse LV, a hidden virtual device is created using the zero target, and the LV has the suffix _vorigin. Snapshots are less efficient than thin provisioning when creating large sparse LVs (GiB). Controls detection and subsequent wiping of signatures on new LVs. There is a prompt for each signature detected to confirm its wiping (unless --yes is used to override confirmations.) When not specified, signatures are wiped whenever zeroing is done (see --zero). This behaviour can be configured with \fBlvm.conf\fP(5) \fBallocation/wipe_signatures_when_zeroing_new_lvs\fP. If blkid wiping is used (\fBlvm.conf\fP(5) \fBallocation/use_blkid_wiping\fP) and LVM is compiled with blkid wiping support, then the blkid(8) library is used to detect the signatures (use blkid -k to list the signatures that are recognized). Otherwise, native LVM code is used to detect signatures (only MD RAID, swap and LUKS signatures are detected in this case.) The LV is not wiped if the read only flag is set. Enable or disable allocation of physical extents on this PV. Enables or disables the addition or removal of PVs to/from a VG (by vgextend/vgreduce). Do not prompt for confirmation interactively but always assume the answer yes. Use with extreme caution. (For automatic no, see -qq.) #lvchange Set zeroing mode for thin pool. Note: already provisioned blocks from pool in non-zero mode are not cleared in unwritten parts when setting --zero y. #lvconvert For snapshots, this controls zeroing of the first 4KiB of data in the snapshot. If the LV is read-only, the snapshot will not be zeroed. For thin pools, this controls zeroing of provisioned blocks. Provisioning of large zeroed chunks negatively impacts performance. #lvcreate Controls zeroing of the first 4KiB of data in the new LV. Default is \fBy\fP. Snapshot COW volumes are always zeroed. For thin pools, this controls zeroing of provisioned blocks. LV is not zeroed if the read only flag is set. Warning: trying to mount an unzeroed LV can cause the system to hang. #pvcreate #vgcreate #vgextend Controls if the first 4 sectors (2048 bytes) of the device are wiped. The default is to wipe these sectors unless either or both of --restorefile or --uuid are specified. lvconvert_change_mirrorlog_CMDlvconvert_change_region_size_CMDlvconvert_combine_split_snapshot_CMDlvconvert_combine_split_snapshotlvconvert_merge_mirror_images_CMDlvconvert_split_and_keep_cache_CMDlvconvert_split_and_keep_cachelvconvert_split_and_remove_cache_CMDlvconvert_split_and_remove_cachelvconvert_split_cow_snapshot_CMDlvconvert_split_mirror_images_CMDlvconvert_swap_pool_metadata_CMDlvconvert_to_cache_with_cachepool_CMDlvconvert_to_cache_with_cachepoollvconvert_to_cache_with_cachevol_CMDlvconvert_to_cache_with_cachevollvconvert_to_cache_with_device_CMDlvconvert_to_cache_with_devicelvconvert_to_cachepool_or_swap_metadata_CMDlvconvert_to_cachepool_or_swap_metadatalvconvert_to_thin_with_external_CMDlvconvert_to_thin_with_externallvconvert_to_thinpool_or_swap_metadata_CMDlvconvert_to_thinpool_or_swap_metadatalvconvert_to_vdopool_param_CMDlvconvert_to_writecache_with_device_CMDlvconvert_to_writecache_with_devicelvcreate_and_attach_cachedevice_for_cache_CMDlvcreate_and_attach_cachedevice_for_cachelvcreate_and_attach_cachedevice_for_writecache_CMDlvcreate_and_attach_cachedevice_for_writecachelvcreate_and_attach_cachepool_CMDlvcreate_and_attach_cachepool_v2_CMDlvcreate_and_attach_cachepool_v2lvcreate_and_attach_cachepool_v3_CMDlvcreate_and_attach_cachepool_v3lvcreate_and_attach_cachevol_for_cache_CMDlvcreate_and_attach_cachevol_for_cachelvcreate_and_attach_cachevol_for_writecache_CMDlvcreate_and_attach_cachevol_for_writecachelvcreate_cow_snapshot_with_virtual_origin_CMDlvcreate_cow_snapshot_with_virtual_originlvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepool_CMDlvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepoollvcreate_thin_snapshot_of_external_CMDlvcreate_thin_snapshot_of_externallvcreate_thin_vol_and_thinpool_CMDlvcreate_thin_vol_and_thinpoollvcreate_thin_vol_with_thinpool_or_sparse_snapshot_CMDlvcreate_thin_vol_with_thinpool_or_sparse_snapshotlvextend_pool_metadata_by_size_CMDlvextend_pool_metadata_by_sizelvresize_pool_metadata_by_size_CMDlvresize_pool_metadata_by_sizeDisplay and manipulate configuration informationDisplay recognised built-in block device typesList available metadata formatsDisplay last command's log reportChange the attributes of logical volume(s)Display information about a logical volumeWith the device mapper, this is obsolete and does nothing.List devices that may be used as physical volumesContinue already initiated poll operation on a logical volumeReduce the size of a logical volumeRemove logical volume(s) from the systemDisplay information about logical volumesList all logical volumes in all volume groupsChange attributes of physical volume(s)Check metadata on physical volumesInitialize physical volume(s) for use by LVMDisplay the on-disk metadata for physical volume(s)Display various attributes of physical volume(s)Move extents from one physical volume to anotherRemove LVM label(s) from physical volume(s)Display information about physical volumesDisplay the system ID, if any, currently set on this hostList tags defined on this hostDisplay software and driver version informationBackup volume group configuration(s)Restore volume group configurationChange volume group attributesCheck the consistency of volume group(s)Change volume group metadata formatDisplay volume group informationUnregister volume group(s) from the systemAdd physical volumes to a volume groupRegister exported volume group with systemAdd devices for a VG to the devices file.Create the special files for volume group devices in /devRemove physical volume(s) from a volume groupDisplay information about volume groupsMove physical volumes into a new or existing volume groupParsing command defs: unknown opt str: "%s"%s%s.Parsing command defs: unknown lv property %s.Parsing command defs: unknown lv type %s.File cmds.h has unsorted name entry %s.File commands.h has unsorted name entry %s.Parsing command defs: options must be specified in long form: %s.Parsing command defs: unknown pos arg: %s.Parsing command defs: unknown opt arg: %s.Parsing command defs: invalid OO definition.Parsing command defs: no memory.Parsing command defs: no OO line found for %s.Parsing command defs: option %s must be followed by an arg.Parsing command defs: can't parse argc %d argv %s%s%s.Parsing command defs: too many rules for cmd.Parsing command defs: can't process input line %s. Special options for command: [ --extents Number[PERCENT] ] The --extents option can be used in place of --size. The number allows an optional percent suffix. [ --name String ] The --name option is not required but is typically used. When a name is not specified, a new LV name is generated with the "lvol" prefix and a unique numeric suffix. Common variables for lvm: Variables in option or position args are capitalized, e.g. PV, VG, LV, Size, Number, String, Tag. PV Physical Volume name, a device path under /dev. For commands managing physical extents, a PV positional arg generally accepts a suffix indicating a range (or multiple ranges) of PEs. When the first PE is omitted, it defaults to the start of the device, and when the last PE is omitted it defaults to the end. PV[:PE-PE]... is start and end range (inclusive), PV[:PE+PE]... is start and length range (counting from 0). LV Logical Volume name. See lvm(8) for valid names. An LV positional arg generally includes the VG name and LV name, e.g. VG/LV. LV followed by _ indicates that an LV of the given type is required. (raid represents raid type). The _new suffix indicates that the LV name is new. Tag Tag name. See lvm(8) for information about tag names and using tags in place of a VG, LV or PV. Select Select indicates that a required positional arg can be omitted if the --select option is used. No arg appears in this position. Size[UNIT] Size is an input number that accepts an optional unit. Input units are always treated as base two values, regardless of capitalization, e.g. 'k' and 'K' both refer to 1024. The default input unit is specified by letter, followed by |UNIT. UNIT represents other possible input units: BbBsSkKmMgGtTpPeE. (This should not be confused with the output control --units, where capital letters mean multiple of 1000.)Only one of --type and --validate permitted.Only one of --type and --list permitted.Only one of --atversion and --sinceversion permitted.--atversion requires --type or --list--sinceversion requires --type newOnly one of --ignoreunsupported and --showunsupported permitted.--atversion has no effect with --type %s--ignoreadvanced and --ignoreunsupported has no effect with --type current--mergedconfig has no effect without --type current or --type fullFailed to merge configuration.--withcomments has no effect with --type list--withlocalpreamble has no effect with --type list--withgeneralpreamble has no effect with --type listIncorrect type of configuration specified. Expected one of: current, default, diff, full, list, missing, new, profilable, profilable-command, profilable-metadata.Updating %s%slogical volume %s on disk(s).Failed to update %smetadata of %s on disk.Logical volume %s is already read-only. Refreshing kernel state.Logical volume "%s" is already read only.Logical volume %s is already writable. Refreshing kernel state.Logical volume %s is already writable.Setting logical volume %s read/write.Setting logical volume %s read-only.Cannot change support for discards while pool volume %s is active.Logical volume %s already uses --discards %s.Logical volume %s already %szero new blocks.Logical volume %s is not active.Cannot activate LVs in a foreign VG.Can't resync open logical volume %s.Do you really want to deactivate logical volume %s to resync it? [y/n]: Logical volume %s not resynced.RAID logical volume %s cannot be active remotely.Unable to deactivate %s for resync.Failed to sync local dev names.Starting resync of %s%s%s%s %s.Failed to reactivate %s to resynchronize mirror.Failed to reattach %s device after clearing.Failed to reactivate %s after resync.Allocation policy of logical volume %s is already %s.Setting contiguous allocation policy for %s to %s.Updating logical volume %s on disk(s).Error when full is already %sset for %s.WARNING: Overriding readahead to %u sectors, a multiple of %uK page size.Read ahead is already auto for %s.Read ahead is already %u for %s.Setting read ahead to %u for %s.Minor number is already not persistent for %s.Disabling persistent device number for %s.Logical volume %s will be deactivated temporarily. Continue? [y/n]: Setting persistent device number to (%d, %d) for %s.Re-activating logical volume %s.Cannot change existing block size %u bytes.Clear all writecache settings? WARNING: repairing a damaged cachevol is not yet possible.WARNING: cache mode writethrough is suggested for safe operation.Continue using writeback without repair?Cache %s is not clean, refusing to switch cache mode.Cannot change VDO settings for active VDO pool %s.VDO pool %s with all its LVs needs to be deactivated.Do you really want to rebuild %u PVs of logical volume %s [y/n]: Logical volume %s not rebuild.Unable to change write%s on %s while it is not in-sync.%s not found in volume group, %sCan't set all images of %s LV %s to writemostly.Minimum recovery rate cannot be higher than maximum.Changing configuration profile for LV %s: %s -> %s.Changing activation skip flag to %s for LV %s.Changing autoactivation flag to %s for LV %s.Unable to change compression for non VDO volume %s.Logical volume %s already uses --compression %c.Unable to change deduplication for non VDO volume %s.Logical volume %s already uses --deduplication %c.Internal error: Failed to check for option %sOperation not permitted on hidden LV %s.Cannot change LV properties when activating component LVs.WARNING: Combining activation change with other commands is not advised.Change of snapshot %s will also change its origin %s%s. Proceed? [y/n]: Logical volume %s not changed.Do you want to activate component LV in read-only mode? [y/n]: Allowing activation of component LV.Refreshing logical volume %s (if active).Internal error: Missing syncaction arg.Use syncaction check to detect and correct integrity checksum mismatches.Internal error: Missing function for command definition %d:%s.Internal error: Changing conv_type from %d to %d.Conversion using --type %s is not supported.--mirrorlog and --corelog are incompatible.--mirrors/--type mirror/--type raid* and --splitmirrors are mutually exclusive.Please name the new logical volume using '--name'--stripes or --stripesize argument is only valid with --mirrors/--type mirror/--type raid*/--type striped/--type linear, --repair and --thinpool--chunksize is only available with snapshots or pools.--zero is only available with snapshots or pools.cannot be used with --type raid0 or --type striped or --type linearInternal error: Wrong params for lvconvert _create_id.Internal error: Name "%s/%s" is too long.Poll operation ID allocation failed.Failed to copy one or more poll operation ID members.Failed to allocate poll identifier for lvconvert.lvconvert: layer name creation failed.lvconvert: layer name generation failed.Allocation of list of failed_pvs failed.Allocation of failed_pvs list entry failed.Attempt to replace failed mirror log? [y/n]: Attempt to replace failed mirror images (requires full device resync)? [y/n]: WARNING: %d missing and now unallocated Physical Volumes removed from VG.Unable to split mirrors in VG with lock_type %sOnly up to %d images in mirror supported currently.Unable to reduce images by specified amount - only %d in %sAdjusting mirror image count of %sCopying region size %s from existing mirror.Mirror log region size cannot be changed on an existing mirror.Logical volume %s has multiple mirror segments.WARNING: Logical volume %s is already not mirrored.Cannot convert logical volume %s with active component LV(s).Can't add mirror to out-of-sync mirrored LV: use lvchange --resync first.Can't add additional mirror images to mirror %s which is under snapshots.%s is already being converted. Unable to start another conversion.Failed to insert resync layer.ABORTING: Failed to remove temporary mirror layer %s.Manual cleanup with vgcfgrestore and dmsetup may be required.--trackchanges is not available to 'mirror' segment type.Volume %s is consistent. Nothing to repair.Mirror status: %d of %d images failed.Mirror log status: %d of %d images failed.WARNING: Trying to up-convert to %d images, %d logs.WARNING: Failed to replace %d of %d images in volume %s.WARNING: Failed to replace %d of %d logs in volume %s.Converting thin%s segment type for %s to %s is not supported.For pool data volume conversion use %s.For pool metadata volume conversion use %s.Conversion of tracking raid1 LV %s is not supported.Failed to find RaidLV of RAID subvolume %s.Conversion of tracked raid1 subvolume %s is not supported.--corelog and --mirrorlog are only compatible with mirror devices.Mirror segment type cannot be used for thinpool%s. Try "%s" segment type instead.Mirrors are not yet supported on cache LVs %s.Cannot specify mirrors with linear type.Cannot both allocate and free extents when specifying physical volumes to use.Please specify the operation in two steps.Logical volume %s being converted.Cannot convert %s LV %s to %s.Unable to %s images by specified amount.Exactly one image must be split off from %s when tracking changes.--corelog and --mirrorlog are only compatible with mirror devicesOnly up to %u mirrors in %s LV %s supported currently.Cannot add raid images with integrity for this raid level.Logical volume %s successfully converted.RAID module does not support RAID0.RAID module does not support RAID10.This conversion is not supported for raid with integrity.Unknown operation on mirror LV %s.Unknown operation on raid LV %s.Unknown operation on striped or linear LV %s.Conversions to --type mirror require -m/--mirrorsInternal error: Volume %s is not a COW.Unable to split off snapshot %s with virtual origin.Unable to split snapshots in VG with lock_type %s.Do you really want to split off active logical volume %s? [y/n]: Splitting snapshot %s from its origin.Logical Volume %s split from its origin.Detaching cachevol %s from LV %s.WARNING: writeback cache on %s is not complete and cannot be flushed.WARNING: cannot detach writeback cache from %s without --force.WARNING: Data may be lost by detaching writeback cache without flushing.Detach writeback cache %s from %s without flushing data?Detaching cachepool %s from LV %s.Cannot split cache pool while PVs are missing, see --uncache to delete cache pool.Logical volume %s is not cached and %s is unused.WARNING: Cache origin logical volume %s is missing.WARNING: Cache pool data logical volume %s is missing.WARNING: Cache pool metadata logical volume %s is missing.Cannot uncache writeback cache volume %s without --force.WARNING: Uncaching of partially missing %s cache volume %s might destroy your data.Do you really want to uncache %s with missing LVs? [y/n]: Logical volume %s is not cached.Unable to use %s as both snapshot and origin.Chunk size must be a power of 2 in the range 4K to 512K.Couldn't find origin volume %s in Volume group %s.Cannot use logical volume %s with active component LVs for snapshot origin.WARNING: Converting logical volume %s to snapshot exception store.THIS WILL DESTROY CONTENT OF LOGICAL VOLUME (filesystem etc.)Do you really want to convert %s? [y/n]: Couldn't deactivate logical volume %s.Aborting. Failed to wipe snapshot exception store.Logical volume %s converted to snapshot.Cannot merge snapshot %s into the origin %s with merging snapshot %s.Cannot merge snapshot %s into the read-only external origin %s.Cannot merge snapshot %s into the read-only origin %s. (Use lvchange -p rw).Unable to merge invalidated snapshot LV %s.Can't initialize snapshot merge. Missing support in kernel?Delaying merge since origin is open.Delaying merge since snapshot is open.Conversion starts after activation.Merging of snapshot %s will occur on next activation of %s.%s is not a mergeable logical volume.Internal error: %s is missing origin.%s is read-only external origin %s.Merging into the old snapshot origin %s is not supported.Delaying merge since origin volume is open.Failed to reactivate origin %s.Merging of thin snapshot %s will occur on next activation of %s.Thin repair commnand is not configured. Repair is disabled.Failed to build thin metadata path.Failed to build pool metadata spare path.Internal error: Unable to find configuration for global/thin_repair_optionsInvalid string in config file: global/thin_repair_optionsToo many options for thin repair command.Active pools cannot be repaired. Use lvchange -an first.Cannot activate pool metadata spare volume %s.Cannot activate thin pool metadata volume %s.Repair of thin metadata volume of thin pool %s failed (status:%d). Manual repair required!WARNING: Cannot read output from %s %s.Transaction id %lu from pool "%s/%s" does not match repaired transaction id %lu from %s.Cannot deactivate thin pool metadata volume %s.Cannot deactivate pool metadata spare volume %s.Can't prepare new metadata name for %s.Can't generate new name for %s.WARNING: LV %s holds a backup of the unrepaired metadata. Use lvremove when no longer required.WARNING: New metadata LV %s might use different PVs. Move it with pvmove if required.Cache repair commnand is not configured. Repair is disabled.Failed to build cache metadata path.Internal error: Unable to find configuration for global/cache_repair_optionsInvalid string in config file: global/cache_repair_optionsToo many options for cache repair command.Only inactive cache can be repaired.Cannot activate cache pool metadata volume %s.Repair of cache metadata volume of cache %s failed (status:%d). Manual repair required!Cannot deactivate pool metadata volume %s.WARNING: If everything works, remove %s volume.WARNING: Use pvmove command to move %s on the best fitting PV.Can't use same LV %s for thin pool and thin volume.Can't use lock_type %s LV as external origin.Aborting. Unable to deactivate new LV. Manual intervention required.Converted %s to thin volume with external origin %s.Unable to deactivate failed new LV. Manual intervention required.LV %s with type %s cannot be used as a metadata LV.Pool metadata LV %s is of an unsupported type.Cannot convert pool %s with active volumes.Failed to create internal lv names, pool name is too long.Chunk size can be only changed with --force. Conversion aborted.WARNING: Changing chunk size %s to %s for %s pool volume.Do you really want to change chunk size for %s pool volume? [y/n]: Do you want to swap metadata of %s pool with metadata volume %s? [y/n]: Aborting. Failed to deactivate %s.Internal error: LV %s is already a pool.Can't use same LV for pool data and metadata LV %s.Use a different LV for pool metadata %s.Mirror logical volumes cannot be used for pool metadata.Try "%s" segment type instead.Pool metadata LV %s is too small (%u extents) for required metadata (%u extents).Pool metadata extents %u chunk_size %uWARNING: Converting %s to %s pool's data%s %s metadata wiping.WARNING: Using mismatched cache pool metadata MAY DESTROY YOUR DATA!Aborting. Failed to activate metadata lv.Aborting. Failed to wipe metadata lv.Aborting. Failed to deactivate metadata lv. Manual intervention required.Aborting. Failed to deactivate logical volume %s.Failed to activate pool logical volume %s.Failed to deactivate pool data logical volume %s.Failed to deactivate pool metadata logical volume %s.Failed to unlock pool data LV %s/%sFailed to unlock pool metadata LV %s/%sCan't prepare new cachevol name for %s.Failed to unlock fast LV %s/%sConvert poll ID list allocation failed.Attempt to replace failed RAID images (requires full device resync)? [y/n]: Failed to replace faulty devices in %s.Faulty devices in %s successfully replaced.Use 'lvconvert --repair %s' to replace failed device.Unsupported volume type for repair of volume %s.Failed to initialize processing handle.Failed to get '--replace' argumentUnable to combine split snapshots in VG with lock_type %sInternal error: Invalid lvconvert pool commandWith tag as cachedevice, --cachesize is required.PV %s is in use, --cachesize is required.Use all %s from %s for cache? [y/n]: Use --cachesize SizeMB to use a part of the cachedevice.Cannot allocate from more than %u cache devices.No cachedevice specified to create a cachevol.cachedevice not found in VG %s.Failed to create cachevol LV name.Failed to generate cachevol LV format.Failed to generate cachevol LV name.Creating cachevol LV %s with size %s.LV %s is already used as a cachevol.Erase all existing data on %s? [y/n]: Redirecting operation to data sub LV %s.LV %s with type %s cannot be converted to a cache pool.Use a different LV for cache pool LV and cache LV %s.LV %s could not be converted to a cache pool.Internal error: LV %s is not a cache pool data volume.Cache pool %s is already in use.Do you want wipe existing metadata of cache pool %s? [y/n]: To preserve cache metadata add option "--zero n".WARNING: Reusing mismatched cache pool metadata MAY DESTROY YOUR DATA!WARNING: Reusing cache pool metadata %s for volume caching.LV %s with type %s cannot be converted to a thin pool.Use a different LV for thin pool LV and thin LV %s.LV %s could not be converted to a thin pool.Internal error: LV %s cannot be found.Internal error: LV %s is not a thin pool.Cannot convert cache volume %s with %s cache mode to external origin.To proceed, run 'lvchange --cachemode writethrough %s'.Cache %s is not clean, refusing to convert to external origin.Unable to swap pool metadata in VG with lock_type %sInternal error: Invalid lvconvert pool command.LV %s with type %s cannot be used as a %s pool LV.Cannot convert logical volume %s under snapshot.The --poolmetadata option is required to swap metadata.Internal error: Unknown pool conversion.Cannot find LV with cache from %s.Logical volume %s is not cached and %s is removed.Internal error: Unknown cache split command.Operation not permitted on LV %s type %s.Unable to convert VDO pool in VG with lock_type %sWARNING: Converting logical volume %s to VDO pool volume %s formating.WARNING: Using invalid VDO pool data MAY DESTROY YOUR DATA!Aborting. Failed to wipe VDO data store.Converted %s to VDO pool volume and created virtual %s VDO volume.WARNING: writecache on %s is not complete and cannot be flushed.WARNING: cannot detach writecache from %s without --force.WARNING: Data may be lost by detaching writecache without flushing.Detach writecache %s from %s without flushing data?Detaching writecache skipping cleaner...Detaching writecache without cleaner...Failed to activate LV to clean writecache.Detaching writecache already clean.Detaching writecache setting cleaner.Failed to set cleaner cachesetting to flush cache.See lvchange --cachesettings cleaner=1Detaching writecache finished cleaning.Failed to monitor writecache cleaner progress.Logical volume %s writecache has been detached.Detaching writecache interrupted - locking VG failed.detach writecache check clean reading vg %sDetaching writecache interrupted - reading VG failed.Detaching writecache interrupted - reading VG error %x.Detaching writecache interrupted - LV not found.Detaching writecache interrupted - LV not active.Detaching writecache cleaning %llu blocksThis command can be cancelled and rerun to complete writecache detach.Detaching writecache completed cleaning.Detaching writecache cachevol failed.Removing the writecache cachevol failed.Logical volume %s write cache has been detached.Cannot initialize readonly LV %sFailed to activate LV %s for zeroing.Failed to deactivate LV %s for zeroing.Writecache requires consistent logical block size for LV devices.Writecache block size %u not allowed with device logical block size 4096.Using writecache block size %u for thin pool data, logical block size %u, physical block size %u.Test mode skips checking fs block size.Using writecache block size %u for unknown file system block size, logical block size %u, physical block size %u.WARNING: unable to detect a file system block size on %sWARNING: using a writecache block size larger than the file system block size may corrupt the file system.Use writecache block size %u? [y/n]: Writecache block size %u cannot be larger than file system block size %u.Unknown memory usage for unknown writecache block_size_sectors %uWARNING: writecache size %s will use %llu GiB of system memory (%llu GiB).Continue adding writecache? [y/n]: LV %s must be linear to use as a writecache.LV %s must be inactive to attach.Logical volume %s now has writecache.Logical volume %s has removed integrity.Cannot add integrity while LV is missing PVs.Logical volume %s has added integrity.Failed to remove temporary sync layer.Failed to swap %s with merging %s.Logical volume %s is no longer merging origin, polling has finished.Merge of snapshot into logical volume %s has finished.Could not remove snapshot %s merged into %s.%s: Failed query for merging percentage. Aborting merge.%s: Merging snapshot invalidated. Aborting merge.%s: Merge failed. Retry merge or inspect manually.Inconsistent volume group names given: "%s" and "%s"Please specify a logical volume to act as the cache pool or origin.Unsupported syntax, cannot use cache origin %s and --cachepool %s.The cache pool or cache origin name should include the volume group.Creation of cached volume and cache pool in one command is not yet supported.Please specify a logical volume to act as the snapshot origin.The origin name should include the volume group.Ambiguous %s name specified, %s and %s.The %s name should include the volume group.Please provide a volume group nameVolume group name expected (no slash)Logical volume name %s and pool name must be different.Volume group name %s has invalid charactersPlease express size as %%FREE%s, %%PVS or %%VG.Internal error: Couldn't find origin volume.Calculated size of logical volume is 0 extents. Needs to be larger.Converted %u%% of %s (%u) extents into %u (with mimages %u and stripes %u for segtype %s).Internal error: Missing snapshot chunk size.Reducing COW size %s down to maximum usable size %s.Rounding size (%d extents) down to stripe boundary size (%d extents)Not enough space for thin pool creation.Adjusted size of logical volume is 0 extents. Needs to be larger.Please specify either size or extents (not both).Please specify either size or extents.Please use only one of --corelog or --mirrorlog.Minimum of 2 stripes required for %s.Stripes argument cannot be used with segment type, %sMinimum of 3 stripes required for %s.Stripe size argument cannot be used with segment type, %sMirror argument cannot be used with segment type, %sAdjusting %s %s region size to required minimum of stripe size %s.RAID10 currently supports only 2-way mirroring (i.e. '-m 1')--mirrors must be at least 1 with segment type %s.Redundant mirrors argument: default is 0Only up to %u stripes in %s supported currently.Only up to %u mirrors in %s supported currently.nosync option prohibited on RAID6.regionsize in configuration file is invalid.Unable to create LV with unknown segment type %s.is unsupported with cache poolsCannot create read-only cache pool.Snapshot segment type is incompatible with thin pools.is unsupported with snapshots and --thinpoolSnapshot segment type requires size or extents.is supported only with sparse snapshotsis supported only with mirrorsPlease specify either size or pooldatasize.is supported only with thin pool creationThin segment type requires --virtualsize.Switching from thin to thin pool segment type.is unsupported with thin poolsCannot create read-only thin pool.is supported only with VDO pool creationis supported only with mirrors or raids--mirrors is supported only with mirrors or raidsis supported only with pools and snapshotsis supported only with vdo, sparse snapshots and thinsSegment type %s does not support --errorwhenfull.Cannot use stripes with linear type.Conflicting contiguous and alloc arguments.Unable to allocate memory for tag %s.Change of volume permission is unsupported with cache conversion, use lvchange.is unsupported with cache conversionSkipping activation of cache origin %s.Cannot activate cache origin %s.Cannot deactivate activate cache origin %s.Ambiguous syntax, please create --type cache-pool %s separately.Snapshot origin LV %s not found in Volume group %s.Thin pool volume %s not found in Volume group %s.Logical volume %s is not a thin pool volume.Please specify either size or extents with snapshots.Logical volume %s is not a thin volume. Thin snapshot supports only thin origins.Switching from snapshot to thin segment type.Unable to create RAID LV: requires minimum VG extent size %sUnable to create RAID(1)0 LV: insufficient number of devices.Segment type 'raid0' requires 2 or more stripes.Number of stripes must be at least %d for %sPlease either create snapshot or thin volume.Please specify device size(s).is only available when creating thin poolOnly specify Physical volumes when allocating thin pool.Segment type %s cannot use pool %s.Logical volume %s already exists in Volume group %s.Persistent major and minor numbers are unsupported with pools.Ambigous --readahead parameter specified. Please use either with pool or volume.Please specify name of existing pool.Pool %s not found in Volume group %s.Please either create VDO or snapshot.Internal error: Buffer is too small for dm_snprintf().Cannot zero %slogical volume with option -Zy or -Wy.Ignoring option -Zy or -Wy for unzeroable %s volume.Internal error: --thinpool not identified.Internal error: Inconsistent snapshot and origin parameters identified.Internal error: Failed to identify what type of thin target to use.Making pool %s in VG %s using segtype %sNo space for sanlock lock, extend the internal lvmlock LV.Making thin LV %s in pool %s in VG %s%s%s using segtype %s.Use lvconvert to create thin pools and cache pools in a shared VG.Removal of created spare volume failed. Manual intervention required.Failed to find LV %s to add writecache.Removing new LV after failing to add writecache.Failed to deactivate new LV %s.Failed to find LV %s to add cache.Removing new LV after failing to add cache.Incompatible options selected.Options -c and -m are incompatible.There's no 'lvmsadc' command in LVM2.Please use the superior 'dmstats' facilities instead.There's no 'lvmsar' command in LVM2.There's no 'pvdata' command in LVM2.Use lvs, pvs, vgs instead; or use vgcfgbackup and read the text file backup.There's no 'lvmchange' command in LVM2.Use 'dmsetup' commands to reset the kernel device-mapper driver.The vgconvert command has been removed along with the lvm1 format.Use a previous version of lvm to convert the lvm1 format to lvm2.Selected cache metadata format %d is not supported.Multiple sign symbols detected.Size requires number argument.Can't parse size argument at '%c'.%s%sPercentage is too big (>=%d%%).Size is not a multiple of 512. Try using %lu or %lu.Size may not be relative/signed.Extents may not be relative/signed.Region size may not be negative.Region size is too big (max %u).Region size must be a multiple of machine memory page size (%d bytes).Region size must be a power of 2.Internal error: Failed to parse command definitions.Internal error: Failed to find command id %s.No command with matching syntax recognised. Run '%s --help' for more information.Nearest similar command has syntax:Command does not accept option: %s%s%s.Command does not accept argument: %s.Command does not accept option combination: %s with %sCommand does not accept options: %sRecognised command %s (id %d / enum %d).Run `%s --help' for more information.Command definition index %d enum %d id %sInternal error: Command %s not found.Use --longhelp to show all options and advanced commands.Unable to allocate memory for command line arguments.Option%s%c%s%s may not be repeated.%s and %s are synonyms. Please only supply one../configure --build=x86_64-linux-gnu --prefix=/usr --includedir=${prefix}/include --mandir=${prefix}/share/man --infodir=${prefix}/share/info --sysconfdir=/etc --localstatedir=/var --disable-option-checking --disable-silent-rules --libdir=${prefix}/lib/x86_64-linux-gnu --runstatedir=/run --disable-maintainer-mode --disable-dependency-tracking --prefix=/usr --exec-prefix=/usr --with-usrlibdir=/usr/lib/x86_64-linux-gnu --with-optimisation=-O2 --with-cache=internal --with-device-uid=0 --with-device-gid=6 --with-device-mode=0660 --with-default-pid-dir=/run --with-default-run-dir=/run/lvm --with-default-locking-dir=/run/lock/lvm --with-thin=internal --with-thin-check=/usr/sbin/thin_check --with-thin-dump=/usr/sbin/thin_dump --with-thin-repair=/usr/sbin/thin_repair --enable-applib --enable-blkid_wiping --enable-cmdlib --enable-dmeventd --enable-editline --enable-lvmlockd-dlm --enable-lvmlockd-sanlock --enable-lvmpolld --enable-notify-dbus --enable-pkgconfig --enable-udev_rules --enable-udev_sync --disable-readline--partial and --activationmode are mutually exclusive argumentsPARTIAL MODE. Incomplete logical volumes will be processed.Invalid activation mode given.Ignoring unknown search_for_devnames setting, using %s.Failed to copy devices file name.A --devices list cannot be used with --devicesfile.Failed to read --devices args.Use 'lvm help ' for more informationCommand profile '%s' requested via environment variable.Only one of --profile or --metadataprofile allowed.Only one of --profile or --commandprofile allowed.Ignore lvmlockd for pvscan cache.WARNING: skipping LV lock in lvmlockd.WARNING: skipping VG lock in lvmlockd.WARNING: skipping global lock in lvmlockd.Ignoring unknown md_component_checks setting, using auto.Using md_component_checks %s use_full_md_check %dFailed to strdup command basename.Error during parsing of command line.Updated config file invalid. Aborting.DEGRADED MODE. Incomplete RAID LVs will be processed.%s: Command not permitted while global/metadata_read_only is set.WARNING: see lvmlockd(8) for information on using cluster/clvm VGs.WARNING: locking_type (%d) is deprecated, using --nolocking.WARNING: locking_type (%d) is deprecated, using --sysinit --readonly.WARNING: locking_type (%d) is deprecated, using file locking.File descriptor %d (%s) leaked on %s invocation.Close failed on stray file descriptor %d (%s): %sLine too long (max 255) beginning: %sInternal error: Failed command did not use log_errorCommand failed with status code %d.WARNING: Running as a non-root user. Functionality may be unavailable.Specify options after a command: lvm [command] [options].No such command. Try 'lvm help'.Filtering devices (no data) for pvid searchPVID %s not found on any devices.Filtering devices (with data) for pvid searchWARNING: PVID %s found on %s which is excluded: %sFailed to create the devices file.Checking filters with data for %sfilter result: %s in devices file is excluded by filter: %s.Removing multipath component %s.Adding multipath device %s for multipath component %s.Missing multipath device %s for multipath component %s.Not searching for missing devnames, search_for_devnames="none".Updated devices file to version %sNo update for devices file is needed.Updates needed for devices file.WARNING: adding device %s that is excluded: %s.PVID already exists in devices file for %s.WARNING: to remove a device by device id, include --deviceidtype.Device %s is used by an active LV, continue to remove? WARNING: to remove a device by name, do not include --deviceidtype.No devices file entry with device id %s %s.PVID not found in devices file.Multiple devices file entries for PVID %s (%s %s), remove by device name.Device %s IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%sWARNING: only considering LVM devices%d LVM physical volume whole disk%s--polloperation parameter is mandatoryArgument to --interval cannot be negativePlease enter one or more logical volume paths or use --select for selection.Existing logical volume "%s" not found in volume group "%s"Cannot rename a RAID %s directlyCannot rename %s while it is tracking a split imageExisting historical logical volume "%s" not found in volume group "%s"Renamed "%s%s" to "%s%s" in volume group "%s"Please use a single volume group name ("%s" or "%s")Old and new logical volume names requiredPlease provide a valid volume group nameLogical volume names must have the same volume group ("%s" or "%s")Old name references live LV while new name is for historical LV.New logical volume name "%s" may not exceed %zu characters.New logical volume name may not be blankNew logical volume name "%s" is invalidOld and new logical volume names must differIgnoring size parameters with --use-policies.Can't reduce pool metadata size.Please specify either size or extents but not both.Negative argument not permitted - use lvreduce.Positive sign not permitted - use lvextend.Please provide the logical volume name.Please specify a logical volume path.Mirrors argument may not be signed.Stripes argument may not be negative.Stripesize may not be negative.Logical volume %s not found in volume group %s.Ignoring lvscan --cache because lvmetad is no longer used.ABORTING: Mirror percentage check failed.Failed to generate list of copied LVs: can't abort.ABORTING: Failed to generate list of copied LVsABORTING: Segment progression failed.ABORTING: Polling interrupted for %s.ABORTING: Can't lock VG for %s.Can't find VG %s. No longer active.ABORTING: Can't reread VG for %s error flags %x.%s: No pvmove in progress - already finished or aborted.%s: Interrupted: No longer active.Internal error: Wrong params for _copy_poll_operation_id.Failed to copy one or more poll_operation_id members.Poll ID list allocation failed.Internal error: Handle is undefined.Device name for LV %s not found in metadata. (unfinished pvmove mirror removal?)%s: Skipping inactive LV. Try lvchange or vgchange.Failed to create poll_id_list.Can't reread VG for %s error flags %xCan't find LV in %s for %s. Already finished or removed.Argument to --interval cannot be negative.Checking progress %s waiting every %u seconds.devicefile name too long for lvmpolldResolve duplicate PV UUIDs with vgimportclone (or filters).Volume group containing %s does not support tagsVolume group containing %s has active logical volumesCan't change tag on Physical Volume %s not in volume groupCan't change PV '%s' without -ff.Allocatability not supported by orphan %s format PV %sPhysical volume "%s" is already allocatable.Physical volume "%s" is already unallocatable.Setting physical volume "%s" allocatableSetting physical volume "%s" NOT allocatableOverride preferred number of copies of VG %s metadata? [y/n]: Failed to generate new random UUID for %s.pv_write with new uuid failed for %s.Physical volume %s not changedFailed to set pvid for devices file.Failed to update devices file.Please give one or more of -x, -uuid, --addtag, --deltag or --metadataignorePlease give a physical volume path or use --select for selection.Option --all and PhysicalVolumePath are exclusive.%d physical volume%s changed / %d physical volume%s not changedCHECK: abbreviating output for %sskip invalid metadata with len %llu at %lluFailed to extract full metadata text at %llu, skipping.metadata at %llu length %llu crc %08x vg %s seqno %u id %sWARNING: parse error for metadata at %lluWARNING: unexpected terminating bytes for metadata at %lluWARNING: metadata from multiple VGs was found.CHECK: label_header.id expected %sCHECK: label_header.sector expected %dCHECK: label_header.crc expected 0x%xCHECK: label_header.offset expected 32CHECK: label_header.type expected %sCHECK: pv_header.pv_uuid invalid formatCHECK: mda_header_%d.checksum expected 0x%xCHECK: mda_header_%d.magic expected 0x%sCHECK: mda_header_%d.version expected %uCHECK: mda_header_%d.start does not match pv_header.disk_locn.offset %lluCHECK: mda_header_%d.size does not match pv_header.disk_locn.size %llumda_header_%d.raw_locn[%d] at %llu # %s%smda_header_%d.raw_locn[%d].offset %llumda_header_%d.raw_locn[%d].size %llumda_header_%d.raw_locn[%d].checksum 0x%xmda_header_%d.raw_locn[%d].flags 0x%x # RAW_LOCN_IGNOREDmda_header_%d.raw_locn[%d].flags 0x%xCHECK: mda_header_%d.raw_locn[%d] for precommit not emptyCHECK: mda_header_%d.raw_locn[%d].size larger than metadata area sizeCHECK: failed to read metadata area at offset %llu size %lluFailed to write file %s metadata area size %llu.CHECK: mda_header_%d.raw_locn[%d] no mem for metadata text size %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_a %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_b %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %lluCHECK: metadata text at %llu crc does not match mda_header_%d.raw_locn[%d].checksumCHECK: failed to set up metadata parsingCHECK: failed to parse metadata text at %llu size %llumetadata text at %llu crc 0x%x # vgname %s seqno %uCHECK: failed to read label_header at %lluCHECK: problem with pv_header offset calculationCHECK: problem with pv_header.disk_locn[%d] offset calculationpv_header.disk_locn[%d] at %llu # location of data areapv_header.disk_locn[%d].offset %llupv_header.disk_locn[%d].size %llupv_header.disk_locn[%d] at %llu # location list endpv_header.disk_locn[%d] at %llu # location of metadata areaWARNING: pv_header.disk_locn[%d].offset %llu is unexpected # for first mdaCHECK: problem with pv_header_extension offset calculationpv_header_extension.version %upv_header_extension.disk_locn[%d] at %llu # bootloader areapv_header_extension.disk_locn[%d].offset %llupv_header_extension.disk_locn[%d].size %llupv_header_extension.disk_locn[%d] at %llu # location list endCHECK: failed to read mda_header at %llumda_header_%d at %llu # metadata areaCHECK: problem with rlocn0 offset calculationCHECK: problem with rlocn1 offset calculationCHECK: mdas have different raw_locn[0].checksum valuesFound bad header or metadata values.Found label on %s, sector %llu, type=LVM2 001Could not find LVM label on %sFound text metadata area: offset=%llu, size=%lluSpecify at least two values from: mda_num, mda_offset, mda_size.Ignoring mda2 values from settings.Specify at least two values from: mda_num, mda2_offset, mda2_size.Invalid mda_num=1 and mda2 settings.Using common defaults for first mda: offset %llu size %llu.Override defaults with --settings "mda_offset= mda_size="Using defaults for second mda: offset %llu size %llu.Ignoring mda1_offset %llu mda1_size %llu from pv_header.Ignoring mda2_offset %llu mda2_size %llu from pv_header.Searching for metadata at offset %llu size %lluFailed to parse UUID from pv_uuid setting.WARNING: No LVM label found on %s. It may not be an LVM device.Failed to read label_header at %lluProblem with pv_header offset calculationWriting label_header.crc 0x%08xWARNING: existing PV UUID %s does not match pv_uuid setting %s.PV UUID %s not found in metadata file.PV UUID %s in existing pv_header not found in metadata file.PV name %s not found in metadata file.No valid PV UUID, specify a PV UUID from metadata in --settings.Skipping mda2 (wrong mda_header.version)Skipping mda2 (wrong mda_header.start)Found mda2 header at offset %llu size %lluSkipping mda2 (no matching VG UUID in metadata area)WARNING: Cannot get device size.WARNING: PV will have no metadata with zero metadata areas.WARNING: no previous metadata areas found on device.Should a metadata area be included? To repair with zero metadata areas, use --settings "mda_offset=0 mda_size=0".mda2_offset setting %llu does not match mda2_offset found on disk %llu.mda2_size setting %llu does not match mda2_size found on disk %llu.WARNING: device_size setting %llu bytes does not match device size %llu bytes.Metadata input file is needed for pv_header info.See pvck --dump to locate and create a metadata file.Failed to scan devices to check PV UUID.Cannot use PV UUID %s which exists on %sWriting label_header.crc 0x%08x pv_header uuid %s device_size %lluWriting data_offset %llu mda1_offset %llu mda1_size %llu mda2_offset %llu mda2_size %lluMetadata text %llu too large for mda_size %llu max %lluCHECK: failed to read mda_header_%d at %lluWriting metadata at %llu length %llu crc 0x%08x mda%dWriting mda_header at %llu mda%dWrite new LVM metadata to %s? Failed to write new mda headerMetadata input file is required.See --repairtype pv_header to repair headers.No metadata areas on device to repair.No metadata areas found on device.Set backup file in --settings backup_file=pathFile does not appear to contain a metadata backup.Invalid raw text metadata in file. File size is too small.Invalid raw text metadata in file.(pvck stdout is not valid input, see pvck -f.)(metadata backup file is not valid input.)WARNING: unexpected final bytes of raw metadata, expected \n\n\0.Invalid raw text metadata in file. (No VG UUID found.)WARNING: file data does not begin with a VG name and may be invalid.Write input file data to disk?Failed to read the first 4096 bytes of device %s.--uuid is required with --restorefile--restorefile is required with --uuidCan only set uuid on one volume at oncePhysical volume size may not be negativeUnable to read volume group from %sCan't find uuid %s in backup file %sDevice "%s" has a capacity of %sPhysical volume "%s" of volume group "%s" is exported"%s" is a new physical volume of "%s"Option -c not allowed with option -mOption -c is not allowed with option -s--name takes a logical volume name.Named LV and old PV must be in the same VG.Incomplete LV name supplied with --name.No extents available for allocation.Internal error: LV name %s is too long.Can't find rimage or rmeta suffix.Can't find '_' after suffix %s.Raid sublv for name %s too long.Removing PV %s from trim list.Internal error: alloc_list is NULL.Moving %u extents of logical volume %s.Creation of temporary pvmove LV failed.lvs_changed list struct allocation failed.Unable to pvmove when %s volume %s is present.Unable to pvmove device used for writecache.Unable to move device used for writecache cachevol %s.Unable to pvmove device used for raid with integrity. and clustered mirror (cmirror) not detectedSkipping LV %s which is not locally exclusive%s.Skipping LV %s which cannot be activated.All data on source PV skipped. It contains locked, hidden or non-top level LVs only.Failed to convert pvmove LV to mirrored.Failed to split segments being moved.ABORTING: Temporary pvmove mirror activation failed. Run pvmove --abort.Failed to clone VG or LV name.Logical volume name %s is invalid.pvmove not allowed on raid LV with integrity.pvmove in a shared VG requires a named LV.pvmove not allowed on internal sanlock LV.pvmove in a shared VG requires exclusive lock on named LV.Detected pvmove in progress for %s.WARNING: Ignoring remaining command line arguments.ABORTING: Failed to generate list of moving LVs.ABORTING: Temporary mirror activation failed.Internal error: Wrong params for _pvmove_create_id.Failed to allocate poll identifier for pvmove.Required device-mapper target(s) not detected in your kernel.Enable lvmpolld when using lvmlockd.Specify pvmove args when using lvmlockd.Internal error: %s is not a proper mirror imageInternal error: %s is not a pvmove mirror of LV-typeInternal error: Mirror image %u not found in segmentABORTING: Removal of temporary mirror failedABORTING: Unable to deactivate temporary logical volume %s.ABORTING: Removal of temporary pvmove LV failedWriting out final volume group after pvmoveABORTING: Failed to write new data locations to disk.Please enter a physical volume pathWARNING: skipping global lock for force.Internal error: Invalid resize params.Please supply physical volume(s)%d physical volume(s) resized or updated / %d physical volume(s) not resizedPV %-*s is in exported VG %s [%s / %s free]PV %-*s VG %-*s %s [%s / %s free]Options -e and -n are incompatibleWARNING: only considering physical volumes %sNo matching physical volumes foundTotal: %d [%s] / in use: %d [%s] / in no VG: %d [%s]Failed to write lookup entry %s %spvscan[%d] Failed to write lookup entry %s %schecking all pvid files using lookup file for %sWARNING: Path %s/%s is too long.WARNING: Failed to strdup vgname.pvscan[%d] %s: autoactivation failed.Wrong VG found for %d:%d PVID %s: %s vs %spvscan[%d] Wrong VG found for %d:%d PVID %s: %s vs %sNo device set up for online PV %d:%d %s PVID %spvscan[%d] No device set up for online PV %d:%d %s PVID %sPVID %s read from %s last written to %s.pvscan[%d] PVID %s read from %s last written to %s.pvscan using %s for PVID %s in VG %sVG %s not using quick activation.pvscan[%d] VG %s not using quick activation.activation for VG %s failed to lock VG.pvscan[%d] activation for VG %s failed to lock VG.activation for VG %s failed to find vgid.pvscan[%d] activation for VG %s failed to find vgid.activation for VG %s cannot read (%x).pvscan[%d] activation for VG %s cannot read (%x).activation for VG %s found different devices.pvscan[%d] activation for VG %s found different devices.pvscan[%d] Failed to initialize processing handle.pvscan[%d] VG %s skip autoactivation.pvscan[%d] VG %s run autoactivation.WARNING: Failed to parse major:minor from %s, skipping.finding all devices for filter symlinks.pvscan[%d] finding all devices for filter symlinks.No device set up for arg %s %d:%dpvscan[%d] No device set up for arg %s %d:%dset_pv_devices_online vg %s pv %s missing flag already setset_pv_devices_online vg %s pv %s no online fileWARNING: VG %s PV %s wrong vgname in online file %sVG %s PV %s no device found for online PV %d:%d %spvscan[%d] VG %s PV %s no device found for online PV %d:%d %sset_pv_devices_online vg %s pv %s is online %spvscan[%d] ignore %s with no lvm info.pvscan[%d] failed to create format instance.pvscan[%d] PV %s has no VG metadata.pvscan[%d] PV %s not found in VG %s.pvscan[%d] PV %s missing device size.pvscan[%d] ignore md component %s.pvscan[%d] PV %s ignore shared VG.Ignore PV %s with VG system id %s with our system id %spvscan[%d] PV %s ignore foreign VG.pvscan[%d] PV %s ignore exported VG.PV %s failed to create online file.pvscan[%d] PV %s failed to create online file.checking all pvid files from vg %srechecking all pvid files from vg %spvscan[%d] VG %s complete after recheck.checking all pvid files from lookup filepvscan[%d] PV %s online, VG unknown.PV %s online, VG %s incomplete (need %d).pvscan[%d] PV %s online, VG %s incomplete (need %d).PV %s online, VG %s is complete.pvscan[%d] PV %s online, VG %s is complete.Cannot list LVs from device without metadata.pvscan[%d] Cannot list LVs from device without metadata.pvscan[%d] Failed to find LVs using %s.pvscan[%d] Failed to check partial lvs.pvscan_cache_all: label scan allpvscan_cache_all: create list of devicesWARNING: no autoactivation for %s: not found in system.devices.WARNING: no autoactivation for %s: system.devices %s current %s.pvscan[%d] Failed to set up devices.pvscan_cache_args: filter devs nodatapvscan_cache_args: read and filter devspvscan[%d] %s cannot read label.pvscan[%d] %s not an lvm device.pvscan[%d] %s excluded by devices file (checking PVID).pvscan_cache_args: label scan devsSkip pvscan for unknown autoactivation value.pvscan[%d] Skip pvscan for unknown autoactivation value.Skip pvscan for event with event_activation=0.pvscan[%d] Skip pvscan for event with event_activation=0.Ignoring pvscan --cache -aay because event_activation is disabled.Ignoring pvscan with --checkcomplete because event_activation is disabled.pvscan[%d] Ignoring pvscan with --checkcomplete because event_activation is disabled.Both --major and --minor required to identify devices.Ignoring pvscan --cache because event_activation is disabled.WARNING: devtypes currently ignores command line arguments.Merge is in progress, reporting merged LV %s.Can't report LV and PV fields at the same time in %sreport type "%s"%s%s.Subreport of type "%s" for VG %s contains columns which lead to change of report type. Add these columns to proper subreport type.Internal error: _report_all_in_vg: incorrect report typeInternal error: _report_all_in_lv: incorrect report typeInternal error: _report_all_in_pv: incorrect report typeInternal error: report_for_selection: incorrect report typeUnknonwn report specifier in report option list: %s.Failed to create temporary mempool to process report options.Internal error: _set_report_prefix_and_name: no prefix found for report type 0x%x_set_report_prefix_and_name: dm_strncpy failedInternal error: _do_report: full report requested at incorrect levelInternal error: _do_report: unknown report type.Failed to compact report output.Failed to compact given columns in report output.Internal error: _report: unknown report type.Failed to add main report section to report group.Failed to finalize main report section in report group.Supported report formats: %s, %s.Failed to create report group.Failed to add log report to report group.Failed to set log report name for command context.Failed to set selection for log report.Forking background process from command: %sWARNING: Failed to set SIGCHLD action.Failed to sync local devices before forking.Background process failed to setsid: %sskip_dev_dir: Couldn't split up device name %s.Cannot access clustered VG %s.See lvmlockd(8) for changing a clvm/clustered VG to a shared VG.Skipping exported volume group %sCannot access VG %s with system ID %s with %slocal system ID%s%s.Skipping foreign volume group %sCannot process standalone physical volumesCannot process volume group %s"%s": Invalid path for Logical Volume."%s": Invalid environment var LVM_VG_NAME set for Volume Group.Path required for Logical Volume "%s".The clustered option is deprecated, see --shared.Physical extent size must be smaller than %s.Max Logical Volumes may not be negative.Max Physical Volumes may not be negative.VG with system ID %s might become inaccessible as local system ID is %sWARNING: A VG without a system ID allows unsafe access from other hosts.The --shared option requires lock type sanlock, dlm or idm.Found multiple lock managers, select one with --lock-type.Failed to detect a running lock manager to select lock type.Using a shared lock type requires lvmlockd (lvm.conf use_lvmlockd.)Using a shared lock type requires lvmlockd.Skipping activation of cache pool %s.Skipping deactivation of used cache pool %s.Refusing to activate merging volume %s while snapshot volume %s is still active.Cannot fully deactivate merging origin volume %s while snapshot volume %s is still active.Cannot activate LVs in VG %s while PVs appear on duplicate devices.Cannot activate uninitialized integrity LV %s from pvscan.Cannot activate uninitialized integrity LV %s without lock.Updating VG to complete initialization of integrity LV %s.Delaying merge for origin volume %s since snapshot volume %s is still active.Spawning background pvmove process for %s.Spawning background lvconvert process for %s.--ignoremonitoring or --sysinit option not allowed with --monitor option.Setting pool chunk size to %s.Please specify either metadata logical volume or its size.Number of stripes (%d) must be between %d and %d.Ignoring stripesize argument for %s devices.Ignoring stripesize argument with single stripe.Negative stripesize is invalid.Cache mode "writeback" is not compatible with cache policy "cleaner".Cannot change VDO setting "vdo_%s" in existing VDO pool.Invalid argument for VDO setting "vdo_%s".Setting fua and nofua cannot both be set.Setting %s is not recognized. Only one unrecognized setting is allowed.Unrecognized writecache setting "%s" may cause activation failure.Use unrecognized writecache setting? [y/n]: Aborting writecache conversion.Using unrecognized writecache setting: %s = %s.Invalid lvm.conf writecache setting value for %s.High watermark must be greater than low watermark.Failed to add tag %s to physical volume %s.No physical volume label read from %s.Option --minor may not be repeated.Option -j|--major may not be repeated.Options --major and --minor are incompatible with -Mn.Please specify minor number with --minor when using -My.Please specify major number with --major when using -My.WARNING: Ignoring supplied major number %d - kernel assigns major numbers dynamically. Using major number %d instead.Please use a single volume group name ("%s" or "%s").Logical volume name "%s" is invalid._init_processing_handle: failed to allocate memory for processing handle_init_selection_handle: failed to allocate memory for selection handleMultiple VGs found with the same name: skipping %sUse --select vg_uuid= in place of the VG name.Processing VG %s because of matching UUID %sVG name on command line not found in list of VGs: %sObtaining the complete list of VGs to processInternal error: unknown lv property value lvp_enum %dInternal error: unknown lv type value lvt_enum %dInternal error: Command %d:%s arg position %d does not permit an LV (%llx)Command on LV %s does not accept LV type unknown (%d).Command on LV %s does not accept LV type %s.Command on LV %s has invalid use of option %s.Command on LV %s requires option %s.Command on LV %s uses options invalid with LV type %s.Command on LV %s with invalid LV type %s.Command on LV %s uses options that require LV types %s.Command on LV %s does not accept LV type %s. Required LV types are %s.Command on LV %s uses options that are invalid with LV properties: %s.Command on LV %s is invalid on LV with properties: %s.Command on LV %s uses options that require LV properties: %s.Command on LV %s requires LV with properties: %s.Ignoring virtual origin logical volume %s.Processing lockd_sanlock_lv %s/%s.Adding %s to the list of LVs to be processed.Failed to allocate final LV list item.Command not permitted on LV %s.Processing historical LV %s in VG %s.Failed to find logical volume "%s/%s"One LV position arg is required.VG name mismatch from %s arg (%s) and option arg (%s).Cannot find VG name for LV %s.Obtaining the complete list of VGs before processing their LVsProcessing devices that are not PVsProcessing duplicate device %s.Internal error: No info for pvidCannot use PV %s in exported VG %s.Cannot use PV %s in foreign VG %s.Cannot use PV %s in shared VG %s.Tags cannot be used with this command.Failed to find physical volume "%s".labelsector must be less than %lu.metadataignore only applies to metadatacopies > 0.Physical volume data alignment may not be negative.Physical volume data alignment is too big.Physical volume data alignment offset may not be negative.Physical volume data alignment offset is too big.WARNING: Ignoring data alignment %s incompatible with restored pe_start value %s.Metadata size may not be negative.Bootloader area size may not be negative.Can't initialize PV '%s' without -ff.Can't initialize physical volume "%s" of volume group "%s" without -ffUnable to add physical volume '%s' to volume group '%s'Really INITIALIZE physical volume "%s" of volume group "%s" [y/n]? WARNING: Forcing physical volume creation on %s of volume group "%s"WARNING: Faking size of PV %s. Don't write outside real device.WARNING: %s: device size %s does not match requested size %s. Proceed? [y/n]: PV %s is used by VG %s so please use vgreduce first.(If you are certain you need pvremove, then confirm by using --force twice.)WARNING: PV %s is used by VG %s.Really WIPE LABELS from physical volume "%s" of volume group "%s" [y/n]? WARNING: prompt answer yes is overridden by prompt answer no.%s: physical volume not initialized.%s: physical volume label not removed.WARNING: Wiping physical volume label from %s of volume group "%s".Checking %s for pvcreate %.32s.Check pvcreate arg %s no PVID foundCannot use device %s with duplicates.Failed to read lvm info for %s PVID %s.Check pvcreate arg %s found vg %s.Check pvcreate arg %s found EXT_USED flag.Check pvcreate arg %s is orphan.Checking %s for pvremove %.32s.Check pvremove arg %s no PVID foundCheck pvremove arg %s device is not a PV.Check pvremove arg %s found vg %s.Check pvremove arg %s found EXT_USED flag.Check pvremove arg %s is orphan.Check confirm arg %s no PVID foundCannot use device %s: it changed during prompt.Scanning and filtering device args (%u).Command requires all devices to be found.WARNING: Unknown block size for device %s.WARNING: Unknown logical_block_size for device %s.WARNING: Devices have inconsistent physical block sizes (%u and %u).See lvm.conf allow_mixed_block_sizes.UUID %s already in use on "%s".Check pvremove arg %s device is a duplicate.Failed to reacquire global lock after prompt.Rescanning and filtering device args with exclusive openWiping signatures on new PV %s.Using existing orphan PVs in %s.Failed to wipe existing label on %s.Writing physical volume data to disk "%s".Failed to write physical volume "%s".Physical volume "%s" successfully created.Failed to wipe existing label(s) on %s.Labels on physical volume "%s" successfully wiped.Error processing filename template %sVGs must be backed up into different files. Use %%s in filename for VG name.No backup taken: specify filename with -f to backup with missing PVs.No backup taken: specify filename with -f to backup with unknown segments.Volume group "%s" successfully backed up.Volume group %s has active volume: %s.Volume group name "%s" is invalid.Please specify a *single* volume group to restore.Internal error: VG name is not set.WARNING: Failed to check for active volumes in volume group "%s".WARNING: Found %u active volume(s) in volume group "%s".Restoring VG with active LVs, may cause mismatch with its metadata.Do you really want to proceed with restore of volume group "%s", while %u volume(s) are active? [y/n]: Unable to lock volume group %s.%sctivated %d logical volumes in volume group %s.Failed to sync local devices for VG %s.%d logical volume(s) in volume group "%s" %smonitoredStarting background polling for volume group "%s".Background polling started for %d logical volume(s) in volume group "%s"Autoactivation is disabled for VG %s.Can't deactivate volume group "%s" with %d open logical volume(s)%d logical volume(s) in volume group "%s" already active%d existing logical volume(s) in volume group "%s" %smonitored%d logical volume(s) in volume group "%s" now activeVolume group allocation policy is already %sVolume group "%s" is already resizeableVolume group "%s" is already not resizeableVolume group autoactivation is already %s.Physical extent size cannot be larger than %s.Physical extent size of VG %s is already %s.Failed to change physical extent size for VG %s.Volume group has active logical volumesFailed to generate new random UUID for VG %s.vgchange_metadata_copies new %u vg_mda_copies %u D %uNumber of metadata copies for VG %s is already unmanaged.Number of metadata copies for VG %s is already %u.Changing configuration profile for VG %s: %s -> %s.Volume Group system ID is already "%s".WARNING: Removing the system ID allows unsafe access from other hosts.Remove system ID %s from volume group %s? [y/n]: System ID of volume group %s not changed.Logical Volumes in VG %s must be deactivated before system ID can be changed.WARNING: Requested system ID %s does not match local system ID %s.WARNING: No local system ID is set.WARNING: Volume group %s might become inaccessible from this machine.Set foreign system ID %s on volume group %s? [y/n]: Volume group %s system ID not changed.Changing system ID for VG %s from "%s" to "%s".Ignoring invalid string in lock_start listIgnoring empty string in config fileNot starting %s since it does not pass lock_start_listNot starting %s since it does not pass auto_lock_start_listVolume group "%s" successfully changedSkip vgchange for unknown autoactivation value.Skip vgchange for event and event_activation=0.Failed early VG locking for autoactivation.PVs online error%s%s, using all devices.PVs online not found for VG %s, using all devices.PVs online incomplete for VG %s, using all devicess.PVs online unknown for VG %s, using all devices.Need one or more command options.Only one of --metadataprofile and --detachprofile permitted.Only one of -a and --refresh permitted.Only -a permitted with --ignorelockingfailure and --sysinitOnly -ay* allowed with --monitor or --poll.Only one of --poll and --sysinit permitted.MaxPhysicalVolumes may not be negativePhysical extent size may not be negativeChange clustered property of all volumes groups? [y/n]: New lock type %s matches the current lock type %s.Cannot change lock type directly from "%s" to "%s".First change lock type to "none", then to "%s".Changing VG %s lock type not allowed with active LVsFailed to initialize lock args for lock type %sCannot change to unknown lock type %sLock type can only be forced to "none" for recovery.Forcibly change VG lock type to none? [y/n]: Using lock type requires lvmlockd.Using lock start and lock stop requires lvmlockd.Starting locking. Waiting for sanlock may take 20 sec to 3 min...Starting locking. Waiting until locks are ready...Starting locking. VG can only be read until locks are ready.The volume group is missing %d physical volumes.Please provide volume group name and physical volumesA volume group called %s already exists.WARNING: Setting maxlogicalvolumes to %d (0 means unlimited)WARNING: Setting maxphysicalvolumes to %d (0 means unlimited)Volume group "%s" successfully created%s%sStarting locking. VG is read-only until locks are ready.Option -A is not allowed with volume group namesVolume group "%s" has active logical volumesLV %s/%s must be inactive on all hosts before vgexport.Volume group "%s" successfully exportedPlease supply volume groups or use --select for selection or use -a for all.No arguments permitted when using -a for all.WARNING: PV %s not found in VG %sWARNING: The PV %s is still missing.WARNING: PV %s was not missing in VG %sVolume group "%s" successfully extendedVolume group "%s" will be extended by %d new physical volumesPlease enter volume group name and physical volume(s)Volume group "%s" is not exportedVolume group "%s" is partially missingVolume group "%s" successfully importedPlease supply volume groups or -S for selection or use -a for all.WARNING: Volume groups with missing PVs will be imported with --force.VG %s is exported, use the --import option.VG %s is partial, it must be complete.Device %s has active LVs, deactivate first.PV with UUID %s is part of VG %s, but is not included in the devices to import.All PVs in the VG must be imported together.Device %s was not found in VG %s.The devices to import must match the devices in the VG.Failed to add device id for %s.Devices file not enabled, ignoring importdevices.Devices file does not exist, ignoring importdevices.Failed to find PVID for device %s.Devices must be from the same VG.Internal error: Old vg name %s is too long.Temporary vg name %s1 is too long.Failed to generated temporary vg name, %s%u is too long.Can't get lock for new VG name %sFailed to read VG %s from devices being imported.Error reading VG %s from devices being imported.Failed to update VG on devices being imported.Not importing devices for VG %s with missing PV %s.Failed to set up devices file.Failed to create devices file.Added %u devices to devices file.Checking for volume group "%s"vgmerge not allowed for lock_type %sDuplicate volume group name "%s"Removing pool metadata spare %s.Failed to generate new random LVID for %sWriting out updated volume groupVolume group "%s" successfully merged into "%s"Please enter 2 or more volume groups to mergeVolume Groups must always contain at least one PV.Removing PV with UUID %s from VG %s.LVs still present on PV with UUID %s: Can't remove from VG %s.WARNING: Partial LV %s needs to be repaired or removed. There are still partial LVs in VG %s.To remove them unconditionally use: vgreduce --removemissing --force.To remove them unconditionally from mirror LVs use: vgreduce --removemissing --mirrorsonly --force.WARNING: Proceeding to remove empty missing PVs.Non-mirror-image LV %s found: can't remove.WARNING: Removing partial LV %s.Failed to write out a consistent VG for %sPlease give volume group name and physical volume paths.Please give volume group name.--mirrorsonly requires --removemissing.Please enter physical volume paths or option -a.Option -a and physical volume paths mutually exclusive.Please only specify the volume group.Volume group "%s" is already consistent.Wrote out consistent volume group %s.WARNING: %d physical volumes are currently missing from the system.Do you really want to remove volume group "%s" containing %u logical volumes? [y/n]: Please enter one or more volume group paths or use --select for selection.New VG name must differ from the old VG name.New VG name "%s" already existsNew VG name "%s" matches the UUID of existing VG %sRenaming path is too long %s/%s %s/%sVolume group "%s" successfully renamed to "%s"Old and new volume group names need specifyingFound %svolume group "%s" using metadata type %sCannot notify dbus: lvm is not built with dbus support.Cannot notify dbus: notify_dbus is disabled in lvm config.Ignoring vgscan --cache command because lvmetad is no longer used.Logical volume %s (part of %s) must be inactive.Logical volume %s must be inactive.Can't split LV %s between two Volume GroupsCan't split Logical Volume %s between two Volume GroupsCan't split snapshot %s between two Volume GroupsCan't split mirror %s between two Volume GroupsCan't split external origin %s and pool %s between two Volume Groups.Can't split pool data and metadata %s between two Volume Groups.Cannot split cache origin %s and its cache pool data %s into separate VGs.Cannot split cache origin %s and its cache pool metadata %s into separate VGs.Cannot split cache pool data %s and its metadata %s into separate VGs.Cannot split cache origin %s and its cachevol %s into separate VGs.Existing VG, new VG and either physical volumes or logical volume required.A logical volume name cannot be given with physical volumes.Failed to lock new VG name %s.Volume group "%s" exists, but new VG option specifiedCannot split: Nowhere to store metadata for new Volume GroupWriting out updated volume groups%s volume group "%s" successfully split from "%s"Too many arguments. Limit is %d.Internal error: Bad format string at '%s'Internal error: Do not use %%d and use correct 64bit formInternal error: Bad format string '%s'%s: Opening daemon socket to %s for protocol %s version %d.%s: Daemon socket path too long.Daemon %s: requested protocol %s != %sDaemon %s: requested protocol version %d != %dInternal error: Daemon send: socket fd cannot be negative %dInternal error: Daemon send: no memory availableClosing daemon socket (fd %d).device_mapper/datastruct/bitset.cdevice_mapper/ioctl/libdm-iface.cCould not determine kernel version used.%s: Wrong device number: (%u, %u) instead of (%u, %u)Failed to set up list of device-mapper major numbersFailure to communicate with kernel device-mapper driver.Check that device-mapper is available in the kernel.Buffer for version is to short.Failed to get device-mapper versiondevice-mapper ioctl protocol version %u failed. Trying protocol version 1.Using device-mapper ioctl protocol version 1Incompatible libdevmapper %s%s and kernel driver %s.Get read ahead request failed: device name unrecorded.Internal error: Corrupted message structure returned: start %d > end %dInternal error: Message response doesn't contain terminating NUL characterFailed to mangle new device UUID "%s"New device uuid mangled [%s]: %s --> %sdm_task_set_newuuid: strdup(%s) faileddm_task_set_message: strdup faileddm_task_set_geometry: sprintf failedTarget type name %s is too long.create_target: malloc(%zu) failedcreate_target: strdup(params) failedcreate_target: strdup(type) failedRan out of memory building ioctl parameterInternal error: dm '%s' ioctl should not define parameters.targets and message are incompatibletargets and rename are incompatibletargets and geometry are incompatiblemessage and rename are incompatiblegeometry and rename are incompatiblegeometry and message are incompatiblemessage is required with sectorOverriding major number of %d with %u for persistent device.Missing major number for persistent device.Unable to find name for device (%u:%u)device (%u:%u) is %s for compatibility with old kernelNo flush flag unsupported by kernel. Buffers will be flushed.Secure data flag unsupported by kernel. Buffers will not be wiped after use.WARNING: Inactive table query unsupported by kernel. It will use live table.WARNING: Setting UUID unsupported by kernel. Aborting operation.WARNING: IMA measurement unsupported by kernel. Aborting operation.Failed to revert device creation.Failed to create device-mapper task structreload %u:%u diff start %llu %llu type %s %sreload %u:%u diff length %llu %llu type %s %sreload %u:%u diff params ignore for type %sreload %u:%u diff params for type %sAttempting to suspend a device that is already suspended (%u:%u)Internal error: Attempt to suspend device %s%s%s%.0d%s%.0d%s%sthat uses already-suspended device (%u:%u)_do_dm_ioctl_unmangle_string: failed to unmangle %s "%s"Couldn't create ioctl argument.Cookie value is not set while trying to call %s ioctl. Please, consider using libdevmapper's udev synchronisation interface or disable it explicitly by calling dm_udev_set_sync_support(0).Switching off device-mapper and all subsystem related udev rules. Falling back to libdevmapper node creation.dm %s %s%s %s%s%s %s%.0d%s%.0d%s%s[ %s%s%s%s%s%s%s%s%s%s] %.0lu %s [%u] (*%u)device-mapper: %s ioctl on %s %s%s%.0d%s%.0d%s%s failed: %sUevent not generated! Calling udev_complete internally to avoid process lock-up.Internal error: unknown device-mapper task %dInternal error: Performing unsafe table load while %d device(s) are known to be suspended: %s%s%s %s%.0d%s%.0d%s%sWARNING: libdevmapper buffer too small for dataHold of control device is now %sset.libdevmapper exiting with %d device(s) still suspended.Failed to build dev path for "%s".Suspended device counter increased to %dAttempted to decrement suspended device counter below zero.Suspended device counter reduced to %ddm_task_create: malloc(%zu) failedThe %s "%s" seems to be mangled more than once. This is not allowed in auto mode.Internal error: mangle_string: supplied buffer too smallThe %s "%s" contains mixed mangled and unmangled characters or it's already mangled improperly.Mangled form of the %s too long for "%s".Internal error: unmangle_string: supplied buffer too smallThe %s "%s" should be mangled but it contains blacklisted characters.Hex encoding mismatch detected in %s "%s" while trying to unmangle it.Failed to mangle device name "%s".Device name mangled [%s]: %s --> %s_dm_task_set_name: strdup(%s) failedName "%s" invalid. It contains "/".Couldn't create /dev path for %s_task_get_string_mangled: strdup failed_task_get_string_unmangled: strdup failedFailed to unmangle device name "%s".Failed to mangle device uuid "%s".Failed to unmangle device uuid "%s".Non empty new name is required.Failed to mangle new device name "%s"New device name mangled [%s]: %s --> %sdm_task_set_newname: strdup(%s) failedDevice uuid mangled [%s]: %s --> %sdm_task_set_uuid: strdup(%s) failedmatchpathcon failed for %s: %sPreparing SELinux context for %s to %s.Resetting SELinux context to default value.Setting SELinux context for %s to %s.A non-block device file at '%s' is already presentUnable to unlink device node for '%s'%s not set up by udev: Falling back to direct node creation.Node %s was not removed by udev. Falling back to direct node removal.The node %s should have been renamed to %s by udev but old node is still present. Falling back to direct old node removal.The node %s should have been renamed to %s by udev but new node is not present. Falling back to direct node rename.Unable to rename device node from '%s' to '%s'%sdev/block/%u:%u/bdi/read_ahead_kbEmpty device name passed to BLKRAGET%s (%d:%d): Setting read ahead to %u%s: retaining kernel read ahead of %u (requested %u)%s: %s NODE_ADD (%u,%u) %u:%u 0%o%s%s%s: %s NODE_READ_AHEAD %u (flags=%u)%s%sInsufficient memory to stack mknod operationInvalid directory value, %s: not an absolute name.Invalid directory value, %s: name too long.Failed to parse mountinfo line.Mount info task creation failed.Replacing mountinfo device (%u:%u) with matching DM device %s (%u:%u)._sysfs_get_dm_name: failed to allocate temporary buffers_sysfs_get_dm_name: dm_snprintf failed_sysfs_get_dm_name: supplied buffer too smallCouldn't create path for %s/%s._sysfs_get_kernel_name: failed to allocate temporary buffers_sysfs_get_kernel_name: dm_snprintf failedCould not locate device kernel name in sysfs path %s_sysfs_get_kernel_name: output buffer too smallWARNING: sysfs_path dm_snprintf failed.Device %s (%u:%u) appears to be mounted on %s.Kernel not configured for semaphores (System V IPC). Not using udev synchronisation code.Udev is not running. Not using udev synchronisation code.Could not get udev state. Assuming udev is not running.Udev is running and DM_DISABLE_UDEV environment variable is set. Bypassing udev, device-mapper library will manage device nodes in device directory.Could not continue to access notification semaphore identified by cookie value %u (0x%x). Incorrect cookie prefix.Could not find notification semaphore identified by cookie value %u (0x%x)No permission to access notificaton semaphore identified by cookie value %u (0x%x)Failed to access notification semaphore identified by cookie value %u (0x%x): %ssemid %d: semop failed for cookie 0x%x: %ssemid %d: sem_ctl GETVAL failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) incremented to %dsemid %d: semop failed for cookie 0x%x: incorrect semaphore stateUdev cookie 0x%x (semid %d) decremented to %dCould not cleanup notification semaphore identified by cookie value %u (0x%x): %sUdev cookie 0x%x (semid %d) destroyedFailed to open /dev/urandom to create random cookie valueFailed to initialize notification cookieNot enough memory to create notification semaphoreLimit for the maximum number of semaphores reached. You can check and set the limits in /proc/sys/kernel/sem.Failed to create notification semaphore: %sUdev cookie 0x%x (semid %d) createdCould not set notification semaphore identified by cookie value %u (0x%x)Udev cookie 0x%x (semid %d) assigned to %s task(%d) with flags%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s (0x%x)Could not signal waiting process using notification semaphore identified by cookie value %u (0x%x)Failed to set a proper state for notification semaphore identified by cookie value %u (0x%x) to initialize waiting for incoming notifications.Udev cookie 0x%x (semid %d) waiting for zeroCould not set wait state for notification semaphore identified by cookie value %u (0x%x): %sFailed to allocate config pool.Failed to allocate config tree.dm_pool_begin_object failed for config linevsnprintf failed for config linedm_vasprintf failed for config linedm_pool_grow_object failed for config line_write_value: Unknown value type: %dParse error at byte %td (line %d): expected a string token.WARNING: Ignoring duplicate config node: %s (seeking %s)Parse error at byte %td (line %d): unexpected tokenParse error at byte %td (line %d): empty section identifierWARNING: Ignoring duplicate config value: %sWARNING: Invalid creation_time found in metadata (repaired with next metadata update).Parse error at byte %td (line %d): expected a valueWARNING: Ignoring unsupported value for %s.%s not found in config: defaulting to "%s"%s not found in config: defaulting to %ld%s not found in config: defaulting to %f%s not found in config: defaulting to %dFailed to clone config string value.Cannot clone NULL config node.Failed to clone config node key.Failed to create config node's key.dtree uuid hash creation failed_create_dm_tree_node alloc failed.dtree node hash insertion faileddtree uuid hash insertion failedMatched uuid %s (missing suffix -%s) in deptree.Matched uuid %s (missing prefix) in deptree.Not matched uuid %s in deptree.Resetting %s udev_flags from 0x%x to 0x%x._deps: failed to set major:minor for (%u:%u)._deps: failed to set inactive table for (%u:%u)_deps: task run failed for (%u:%u)_deps: failed to get info for (%u:%u)Inconsistent dtree major number: %u != %uInconsistent dtree minor number: %u != %u_info_by_dev: Failed to set device number.Node %s %d:%d has open_count %dDeactivation dm_task creation failed for %sFailed to set device number for %s deactivation_node_clear_table failed: missing nameFailed to obtain dependencies for %s before clearing table.Clearing inactive table %s (%u:%u)Table clear dm_task creation failed for %sFailed to set device number for %s table clear_node_clear_table failed: info missing after running task for %sFailed to deactivate no-longer-used device %s (%u:%u)Cannot add device without name and uuid.Rename dm_task creation failed for %sFailed to set name for %s rename.Suspend dm_task creation failed for %s.Failed to set device name for %s resumption.Failed to set device number for %s resumption.WARNING: Failed to set read ahead.Suspend dm_task creation failed for %sFailed to set device number for %s suspension.WARNING: Failed to set skip_lockfs flag.WARNING: Failed to set no_flush flag.WARNING: Can't set no_flush flag.Expected thin-pool target for %s and got %s.Found transaction id %lu for thin pool %s with status line: %s.Expected vdo target for %s and got %s.Failed to set message major minor.Failed to process message "%s".Thin pool %s already contain thin device with device_id %u.Manual intervention may be required to remove device dev_id=%u in thin pool metadata.Optionally new thin volume with device_id=%u can be manually added into a volume group.WARNING: When uncertain how to do this, contact support!Thin pool %s transaction_id matches %lu, skipping messages.Thin pool %s transaction_id is %lu, while expected %lu.Cannot send messages to thin pool %s%s%s%s.Thin pool %s transaction_id is %lu and does not match expected %lu.VDO needs message for compression %u(%u) and deduplication %u(%u).Unable to deactivate open %s (%u:%u).Unable to deactivate %s (%u:%u).Sent messages to thin-pool %s and skipping suspend of its children.Failed to rename %s (%u:%u) to %sCreate dm_task creation failed for %sFailed to set device name for %sFailed to set device number for %s creation.Failed to set read only flag for %sInternal error: Unable to get DM task info for %s.Failed to format %s device number for %s as dm target (%u,%u)Failed to get %s target versionsWARNING: Ignoring RAID1 stripe size%s 0 %u %s %d fix_padding block_size:%u internal_hash:%sCan create VDO data volume path for %s.V2 %s %lu %u %lu %u %s %s %s maxDiscard %u ack %u bio %u bioRotationInterval %u cpu %u hash %u logical %u physical %uNo parameters supplied for %s target %u:%u.Adding target to (%u:%u): %lu %lu %s %sInsufficient space for target parameters.Insufficient space in params[%zu] for target parameters.Target parameter size too big. Aborting.Reload dm_task creation failed for %s.Failed to set device number for %s reload.Failed to set read only flag for %s.WARNING: Failed to suppress reload of identical tables.Suppressed %s identical table reload.Table size changed from %lu to %lu for %s.%sResume of table of extended device %s delayed.WARNING: Failed to get uuid for dtree node %s.dtree node segment allocation failedCouldn't find snapshot origin uuid %s.Couldn't find snapshot COW device uuid %s.Couldn't find merging snapshot uuid %s.Couldn't find mirror log uuid %s.Unsupported cache's feature flags set %lu.Invalid cache's feature flag %lu.Data block size %u is lower then %u sectors.Data block size %u is higher then %u sectors.Missing cache's metadata uuid %s.Missing cache's origin uuid %s.Cache policy parameter %s is without integer value.Missing writecache's cache uuid %s.Missing writecache's origin uuid %s.Missing integrity's meta uuid %s.Missing integrity's origin uuid %s.Replicator segment is unsupported.Replicator targer is unsupported.Node %s must have only one segment.Device id %u is higher then %u.Failed to allocate thin message.Cannot use same device id for origin and its snapshot.New transaction id must be sequential.Current transaction id is different from thin pool.Missing thin external origin uuid %s.Failed to allocate target segment area.dm_tree_node_add_target_area called without deviceDevice %s is not a block device.dm_tree_node_add_null_area() called on an unsupported segment typeExisting path %s is not a directory.Failed to duplicate directory name.Cannot open lockfile [%s], error was [%s]Cannot lock lockfile [%s], error was [%s]Cannot truncate pidfile [%s], error was [%s]Cannot write pid to pidfile [%s], error was [%s]Cannot write pid to pidfile [%s], shortwrite of[%zu] bytes, expected [%zu] Cannot get close-on-exec flag from pidfile [%s], error was [%s]Cannot set close-on-exec flag from pidfile [%s], error was [%s]Cannot check lock status of lockfile [%s], error was [%s]Matching regular expression. [regex]Not matching regular expression. [regex]Equal to. [number, size, percent, string, string list, time]Not equal to. [number, size, percent, string, string_list, time]Greater than or equal to. [number, size, percent, time]Greater than. [number, size, percent, time]Less than or equal to. [number, size, percent, time]Less than. [number, size, percent, time]Since specified time (same as '>='). [time]After specified time (same as '>'). [time]Until specified time (same as '<='). [time]Before specified time (same as '<'). [time]Set if item passes selection criteria.dm_report_field_string: dm_pool_strdup faileddm_report_field_percent: dm_pool_alloc failed for sort_value.dm_report_field_percent: dm_pool_alloc failed for percent report string.dm_report_field_percent: percentage too large.dm_report_field_string_list: dm_pool_zalloc failed for sort_valuedm_report_fiel_string_list: dm_pool_zalloc failed for sort value itemsdm_report_field_string_list: dm_pool_strdup faileddm_report_field_string_list: malloc faileddm_report_field_int: dm_pool_alloc faileddm_report_field_int: int too big: %ddm_report_field_uint32: dm_pool_alloc faileddm_report_field_uint32: uint32 too big: %udm_report_field_int32: dm_pool_alloc faileddm_report_field_int32: int32 too big: %ddm_report_field_uint64: dm_pool_alloc faileddm_report_field_uint64: uint64 too big: %luInternal error: Using string as sort value for numerical field.Internal error: Field type undefined.-------------------------------------------------------------------------------dm_report: field not match: %sdm_report: struct field_properties allocation faileddm_report: Ignoring duplicate sort field: %s.dm_report: Missing sort field namedm_report: Unrecognised field: %.*sInternal error: dm_report_init: definition of report types given contains reserved identifier_canonicalize_field_ids: dm_pool_alloc failed_canonicalize_field_dup: dm_pool_alloc failed.dm_report_init: allocation of memory pool faileddm_report_set_output_field_name_prefix: dm_pool_strdup failedInternal error: _cmp_field_int: unsupported number comparison type for field %sInternal error: _cmp_field_double: unsupported number comparison type for selection field %sInternal error: _cmp_field_string: unsupported string comparison type for selection field %sInternal error: _cmp_field_time: unsupported time comparison type for field %sInternal error: _cmp_field_string_list: unknown list typeInternal error: _cmp_field_string_list: unsupported string list type found, expecting either AND or OR list for selection field %s_compare_selection_field: field without value :%dInternal error: _compare_selection_field: unknown field type for field %sInternal error: _do_report_object: dm_report handler is NULL.Internal error: _do_report_object: output not requested and selected output variable is NULL too._do_report_object: struct row allocation failed_do_report_object: row sort value structure allocation failed_do_report_object: struct dm_report_field allocation failed_do_report_object: no data assigned to field %s_do_report_object: report function failed for field %sdm_report_enable_compact_output: dm report handler is NULL.dm_report: Unrecognized field: %.*sInternal error: %s reserved value handler for field %s has missing implementation of DM_REPORT_RESERVED_PARSE_FUZZY_NAME actionError occured while processing %s reserved value handler for field %sFailed to create cache for values used during reporting.Internal error: _check_reserved_values_supported: global reserved value for type 0x%x not supportedInternal error: _check_reserved_values_supported: field-specific reserved value of type 0x%x for field %s not supportedRegular expression expected for selection field %sFailed to parse regex value for selection field %s._add_item_to_string_list: memory allocation failed for string list item_tok_value_string_list: memory allocation failed for selection listInvalid operator in selection list.List ended with incorrect character, expecting '%s'.Only one type of logical operator allowed in selection list at a time.Missing list end for selection field %sInternal error: _tok_value_string_list: list has no items_tok_value_string_list: memory allocation failed for sort arrayField selection value %s out of supported range for field %s.Specified minutes out of range.Specified seconds out of range.Full date specification needed._tok_value_time: dm_pool_strndup failedtok_value_time: dm_pool_strndup failedFailed to parse string value for selection field %s.Failed to parse string list value for selection field %s.Failed to parse numeric value for selection field %s.Found percent value but %s value expected for selection field %s.Found size unit specifier but %s value expected for selection field %s.Failed to parse time value for selection field %s.Internal error: Forbidden NULL custom detected.Internal error: %s reserved value handler for field %s has missingimplementation of DM_REPORT_RESERVED_GET_DYNAMIC_VALUE actionUnable to create selection with field '%s' which is not included in current report.dm_report: incompatible comparison type for selection field %sdm_report: struct field_selection allocation failed for selection field %sdm_report: could not get reserved value while processing selection field %sdm_report: malloc failed to store regex value for selection field %sdm_report: failed to create regex matcher for selection field %sdm_report: dm_pool_strndup for value of selection field %sString value %s found in selection is reserved.Numeric value %lu found in selection is reserved.Size value %f found in selection is reserved.Percent value %s found in selection is reserved.String list value found in selection is reserved.Time value found in selection is reserved.Internal error: _create_field_selection: unknown type of selection field %sInternal error: Forbiden NULL custom detected.dm_report: struct selection_node allocation failed field - Reporting field. number - Non-negative integer value. size - Floating point value with units, 'm' unit used by default if not specified. percent - Non-negative integer with or without %% suffix. string - Characters quoted by ' or " or unquoted. string list - Strings enclosed by [ ] or { } and elements delimited by either "all items must match" or "at least one item must match" operator. regular expression - Characters quoted by ' or " or unquoted._display_selection_help: dm_pool_begin_object failed Logical and grouping operators:Unrecognised selection field: %sSelection field is uncomparable: %s.Unrecognised comparison operator: %sOperator can be used only with number, size, time or percent fields: %sOperator can be used only with time fields: %sFailed to allocate report selection structure.Internal error: dm_report_init_with_selection: trying to register unsupported reserved value type, skipping report selectiondm_report: dm_pool_begin_object failed for headingsdm_report: Could not allocate memory for heading buffer.dm_report: snprintf heading faileddm_report: Failed to generate report headings for printingdm_report: sort array allocation faileddm_report: Unable to extend output linedm_report: Failed to copy field namedm_report: Could not allocate memory for output line buffer.dm_report: left-aligned snprintf() faileddm_report: right-aligned snprintf() faileddm_report: Unable to allocate output linedm_report: Failed to extend row for field namedm_report: Failed to extend row with separatordm_report: Failed to terminate rowdm_report: Unable to terminate output linedm_report: dm_report_output: interleaved reports detected for JSON outputdm_report: dm_report_output: unfinished JSON output detecteddm_report: dm_report_init_group: failed to allocate mem pooldm_report: failed to allocate report group structuredm_report: faile to allocate root report group itemdm_report: unable to add more than one report to current report groupdm_report: failed to duplicate json item namedm_report: can't use unnamed object at top level of JSON outputdm_report: dm_report_group_push: group item allocation faileddm_report: dm_report_group_pop: group has no itemsdm_report: struct field_selection_value allocation failed for selection field %sInternal error: dm_split_lvm_name: Forbidden NULL parameter detected.build_dm_name: Allocation failed for %zu for %s %s %s.build_dm_name: Allocation failed for %zu %s %s.no memory for size display bufferInternal error: Inconsistent units: %c and %c.Failed to parse invalid snapshot params.Failed to allocate snapshot status structure.Failed to parse snapshot params: %s. <#devices> and and Failed to parse %sraid params: %s %u %lu/%lu %u %lu/%lu %lu %lu %lu %lu %lu %lu %lu %dFailed to parse cache params: %sFailed to parse writecache params: %s.Failed to parse integrity params: %s.Failed to parse invalid thin params.Failed to parse thin pool params: %s.Failed to allocate thin_pool status structure.Failed to allocate thin status structure.Failed to parse thin params: %s.Failed to alloc mem pool to parse mirror status.Internal error: More then 8 reported in mirror status.Allocation of log type string failed.Failed to parse mirror status %s.device_mapper/libdm-timestamp.cCouldn't create memory pool %s (size %zu)Internal error: pool_free asked to free pointer not in poolOut of memory. Requested %zu bytes.You have a memory leak (not released memory pool):Internal error: Unreleased memory pool(s) found.Internal error: Pool %s is already locked.Internal error: Pool %s is already unlocked.Internal error: Pool %s crc mismatch.(rx->type != OR) || (rx->left && rx->right)Internal error: Unknown calc node typedevice_mapper/regex/parse_rx.cBadly quoted character at end of expressionmissing ')' in regular expressionRegex charset allocation failedVDO minimum io size %u is unsupported.device_mapper/vdo/vdo_target.cVDO block map cache size %u out of range.VDO index memory size %u out of range.VDO slab size %u out of range.VDO max discard %u out of range.VDO ack threads %u out of range.VDO bio threads %u out of range.VDO bio rotation %u out of range.VDO cpu threads %u out of range.VDO hash zone threads %u out of range.VDO logical threads %u out of range.VDO physical threads %u out of range.Internal error: VDO write policy %u is unknown.Value of vdo_hash_zone_threads(%u), vdo_logical_threads(%u), vdo_physical_threads(%u) must be all zero or all non-zero.VDO logical size is by %luKiB bigger then limit %luTiB.Failed to allocate memory for hash.Failed to allocate slots for hash../base/data-struct/radix-tree-adaptive.cunused value is not UNSET (n4) unused value is not UNSET (n16) referencing value past nr_entries (n48) not all values are referenced (n48) incorrect number of entries in n48, n48->nr_entries = %u, actual = %u unused value is not UNSET (n48) incorrect number of entries in n256, n256->nr_entries = %u, actual = %u incorrect entry count: rt->nr_entries = %u, actual = %u activate/activate.cNo host tag matches %sGetting driver versionGetting target version for %sFound %s target v%u.%u.%u./sbin/modprobe%smodule/dm_%sModule directory %s exists.kvdodm-%sLogical volume %s in use.idle (no device driver)Counted %d open LVs in VG %s.tpoolvpoolrealMonitoredUnmonitored%s %s for eventsSkipping %smonitor of %s.%s%s already monitored. [Test mode: skipping this]Monitoring %s with %s.%s%s already not monitored.Not monitoring %s with %s%sNot m origin without snapshotsSkipping: Suspending %s%s.already suspendedRequiring flush for LV %s.suspend_lvslv_list alloc failed.suspendingfailed suspend (reverting)Skipping: Resuming %s%s%s. pool only thin only if activeResuming LV %s%s%s%s.resumedSkipping: Deactivating %s.deactivatingdeactivatedSkipping: Activating %s. temporary noscanActivating %s%s%s%s%s.LV %s is already active.%s-%s-missing_%u_0Found active component LV %s.Found active holder LV %s.locking for suspendunlocking on resumeunlocking on revertcache/lvmcache.cnot chosenis inis not inis notPV %s: %s %s dm. %s %s dm.hashas nois used foris not used forPV %s: %s %s LV. %s %s LV.of previous preferencedevice is used by LVdevice size is correctdevice name matches previousdevice has fs mounteddevice is in dm subsystemdevice is in subsystemdevice was seen firstNo size for %s./dev/mdlvmcache label scan beginResolving duplicate devicesAdding chosen duplicate %slvmcache label scan donelvmcache: %s: clearing VGIDlvmcache %s: now in VG %s %sno longerFound PVID %s on %sAdding pvid to hash failed %sDestroy lvmcache content#orphans_lvm2PV %s size is zero.device is an md componentdevice is partitioneddevice has a signaturedevice is missing sysfs infodevice type is unknowndevice is not in devices filedevice is not in devices listdevice is an LVdevice is filtereddevice cannot be useddevice is a duplicatedevice not foundwritecache/writecache.cwritecache_block_sizehigh_watermarklow_watermarkwriteback_jobsautocommit_blocksautocommit_timemax_agewritecache_setting_keywritecache_setting_valwritecache = "%s"writecache_block_size = %uhigh_watermark = %llulow_watermark = %lluwriteback_jobs = %lluautocommit_blocks = %lluautocommit_time = %llunofua = %ucleaner = %umax_age = %uwritecache_setting_key = "%s"writecache_setting_val = "%s"Initialised segtype: %sintegrity/integrity.cdata_sectorstag_sizeinternal_hashmeta_devjournal_sectorsinterleave_sectorsbuffer_sectorsjournal_watermarkbitmap_flush_intervalsectors_per_bitdata_sectors = %llutag_size = %uinternal_hash = "%s"meta_dev = "%s"recalculate = %ujournal_sectors = %uinterleave_sectors = %ubuffer_sectors = %ujournal_watermark = %ucommit_time = %ubitmap_flush_interval = %usectors_per_bit = %llu Setting %scache_segtype/cache.c Chunk size %s Metadata format %u Mode %s Policy %scache_modepolicy_settingschunk_size = %ucache_mode = "%s"metadata = "%s"metadata_format = %u%s: %s failed: %sFound kernel symbol%s.fcloseCache supports %s.cache_pool_corigmetadata_startmetadata_lenmetadata_idcache_pool = "%s"cleaner = 1metadata_start = %lumetadata_len = %lumetadata_id = "%s"LVM-cache-pool and aliases cache-mqmigration_thresholdsequential_thresholdrandom_thresholdread_promote_adjustmentwrite_promote_adjustmentdiscard_promote_adjustmentSMQcommands/toolcontext.clocalhostWARNING: %s: fopen failed: %sunamelvmlocalappmachineid%s/machine-idLVM_SYSTEM_DIRLVM_RUN_BY_DMEVENTD%s/mounts%s%s%s failed: %s_get_sysfs_dir fopensysfsfilelinemessagedebug_file_fieldsdebug_output_fieldsLogging initialised at %sDM_DISABLE_UDEVLVM will %s.LVM_ configuration invalid.Set umask from %04o to %04o%s//dev/ioerror stat failed: %sunknown deviceSetting host tag: %shost_listhost_filterhost_filter not supported yet%s/lvm%s%s.confFailed to create config treeprofile_params alloc failed/dev/_init_hostnamearchive_init failed.backup_init failed.LVM_LVMPOLLD_SOCKET/run/lvm/lvmpolld.socket/etc/lvmsetlocale failedsetvbufReloading config filescCxXyYdeHImMSuUVwWyundefinedmerged filescommand profilemetadata profilespecial purpose(root)How LVM uses block devices. shellHost tag settings. abort_on_errorsprofile_dir#S/devloopfilesobtain_device_list_from_udevexternal_device_info_sourcepreferred_namesuse_devicesfilesystem.devicessearch_for_devnames#Sa|.*|global_filtercache_dircache_file_prefixwrite_cache_statesysfs_scanscan_lvsmultipath_component_detectionmultipath_wwids_file/etc/multipath/wwidsmd_component_detectionmd_component_checksfw_raid_component_detectionmd_chunk_alignmentdefault_data_alignmentdata_alignment_detectionignore_suspended_devicesignore_lvm_mirrorsdisable_after_error_countrequire_restorefile_with_uuidpv_min_sizeissue_discardsallow_mixed_block_sizescling_tag_listmaximise_clinguse_blkid_wiping@DEFAULT_USE_BLKID_WIPING@raid_stripe_all_devicescache_pool_cachemodeCache mode. cache_metadata_formatcache_pool_chunk_sizecache_pool_max_chunksthin_pool_crop_metadatathin_pool_zerothin_pool_discardsthin_pool_chunk_size_policygenericzero_metadatathin_pool_chunk_sizephysical_extent_sizevdo_use_compressionvdo_use_deduplicationvdo_use_metadata_hintsvdo_minimum_io_sizevdo_block_map_cache_size_mbvdo_block_map_periodvdo_check_point_frequencyvdo_use_sparse_indexvdo_index_memory_size_mbvdo_slab_size_mbvdo_ack_threadsvdo_bio_threadsvdo_bio_rotationvdo_cpu_threadsvdo_hash_zone_threadsvdo_logical_threadsvdo_physical_threadsvdo_write_policyvdo_max_discardreport_command_logcommand_log_sortlog_seq_numcommand_log_colscommand_log_selectionsilentsyslogoverwritelevelindentcommand_namesactivate_filedebug_classesbackup_dirarchive_dirretain_minretain_dayshistory_sizeumasksi_unit_consistencyfallback_to_lvm1format_librariessegment_libraries/procLocation of proc filesystem. /etc@CONFDIR@locking_typewait_for_locksfallback_to_clustered_lockingfallback_to_local_lockinglocking_dir/run/lock/lvm@DEFAULT_LOCK_DIR@prioritise_write_lockslibrary_dirlocking_libraryliblvm2clusterlock.soabort_on_internal_errorsmetadata_read_onlymirror_segtype_default@DEFAULT_MIRROR_SEGTYPE@support_mirrored_mirror_lograid10_segtype_defaultraid10@DEFAULT_RAID10_SEGTYPE@sparse_segtype_default@DEFAULT_SPARSE_SEGTYPE@event_activationuse_lvmetadlvmetad_update_wait_timeuse_aiouse_lvmlockdlvmlockd_lock_retriessanlock_lv_extendlvmlockctl_kill_commandthin_check_executable/usr/sbin/thin_check@THIN_CHECK_CMD@thin_dump_executable/usr/sbin/thin_dump@THIN_DUMP_CMD@thin_repair_executable/usr/sbin/thin_repair@THIN_REPAIR_CMD@thin_check_optionsthin_repair_options#Sthin_disabled_featurescache_disabled_featurescache_check_executable/usr/sbin/cache_check@CACHE_CHECK_CMD@cache_dump_executable/usr/sbin/cache_dump@CACHE_DUMP_CMD@cache_repair_executable/usr/sbin/cache_repair@CACHE_REPAIR_CMD@cache_check_optionscache_repair_optionsvdo_format_executable/usr/bin/vdoformat@VDO_FORMAT_CMD@vdo_format_optionsvdo_disabled_featuresfsadm_executable/usr/sbin/fsadm@FSADM_PATH@system_id_sourcesystem_id_fileuse_lvmpolld@DEFAULT_USE_LVMPOLLD@notify_dbusio_memory_sizeudev_syncudev_rulesverify_udev_operationsretry_deactivationmissing_stripe_filleruse_linear_targetreserved_stackreserved_memoryprocess_priorityauto_activation_volume_listread_only_volume_listmirror_region_sizeraid_region_sizeraid_fault_policywarnmirror_image_fault_policymirror_log_fault_policyallocatemirror_device_fault_policysnapshot_autoextend_thresholdsnapshot_autoextend_percentthin_pool_autoextend_percentvdo_pool_autoextend_thresholdvdo_pool_autoextend_percentmlock_filteruse_mlockallpolling_intervalauto_set_activation_skipactivation_modedegradedauto_lock_start_listcheck_pv_device_sizesrecord_lvs_historylvs_history_retention_timepvmetadatasizepvmetadataignoredirsdisk_areasdisk_areastart_sectoroutput_formatbasiccompact_outputcompact_output_colslist_item_separator,columns_as_rowsbinary_values_as_numerictime_format%Y-%m-%d %T %zdevtypes_sortdevtype_namedevtypes_colsdevtypes_cols_verboselvs_sortvg_name,lv_namelvs_colslvs_cols_verbosevgs_sortvg_namevgs_colsvgs_cols_verbosepvs_sortpv_namepvs_colspvs_cols_verbosevg_name,lv_name,seg_startpvsegs_sortpv_name,pvseg_startpvsegs_colspvsegs_cols_verbosevgs_cols_fullvg_allpvs_cols_fullpv_alllvs_cols_fulllv_allpvsegs_cols_fullpvseg_all,pv_uuid,lv_uuidseg_all,lv_uuidvgs_sort_fullpvs_sort_fulllvs_sort_fullpvsegs_sort_fullpv_uuid,pvseg_startlv_uuid,seg_startmark_hidden_devicestwo_word_unknown_devicemirror_libraryraid_librarysnapshot_librarythin_librarylvm lvextend --use-policiesvdo_librarylibdevmapper-event-lvm2vdo.so/usr/sbin/dmeventd@DMEVENTD_PATH@hosttagssystem_idextra_system_idshost_idconfig/config.cFailed to duplicate filename.%s is not a regular file%s is emptyconfig_tree allocation failedLoading config file: %sFailed to load config file %sread#< string float integer boolean section array with values of type:optionSetting %s to %s%s# Configuration %s %s. %s# %s%s#%s%s - %s%s%s%s%s%s%s # stdoutDumping configuration to %sFailure while writing to %sUndefined profile name.profile allocation failed%s/%s.profileIgnoring invalid %s %s.%s%s%s/%s.cache%s/%s/%s.cachedatastruct/btree.cstr_list allocation faileddatastruct/str_list.cWARNING: %s failed: %s.device/bcache.cio_destroymisaligned data bufferio_geteventsio_setup failed %dunable to allocate sync_iosome blocks are still lockedCannot extend bcache fd tabledevice/dev-cache.cfilename strdup failed%s: New preferred namelstat/dev/nvmeFound nvme device %sfgets%sdev/block/%d:%d/dm/uuid%s: Not available device node%sblock/%s/dev%sdev/block/%d:%d/holders/opendirclosedirFound dev %d:%d %s - new.Dir path %s is too longPath %s/%s is too long.%sdev/blockFailed to udev_enumerate_new.%s: Not in udev dbDrop alias for %d:%d %s.not found in configpreferred device name matcherdev_cachestrdup dev_dir failed.Ignoring %s: %s.Ignoring %s: Not a directory.dir_list allocation failedNot a block device %s.Failed to get device %sNo devno %d:%d in dev cache.dev_iter allocation failed%s/devices/dmeventd.devicesFailed to copy devices path%s/devicesCreating %s.Failed to create %s %d%s/devices/%spvcreatevgcreateCannot access device %s.Invaild device type %s./dev/%sFound %s for %d:%d from sys%sdev/block/%d:%d/dm/name/dev/mapper/%s/proc/partitions%u %u %llu %sFound %s for %d:%d from proc/run/lvm/searched_devnamesdevice/device_id.cunlink %s errno %dunlink %sstat %s errno %d%sdev/block/%d:%d/%spartmpath-CRYPT-QEMU HARDDISKdevice/serialmd/uuidloop/backing_file(deleted)sys_wwidsys_serialdevnamempath_uuidcrypt_uuidlvmlv_uuidmd_uuidloop_filedevice_ids_read already donedevice_ids_read %sSYSTEMIDread devices file systemid %sVERSIONread devices file version %sIDTYPEIDNAMEDEVNAMEPVIDPARTCreating devices file %s%s_neww+SYSTEMID=%s VERSION=%u.%u.%uWrote devices file %sDevices file update skipped.missing deviceDevice not added./dev/dm-/dev/mapper/Match device_id %s %s to %sDevice not found for %s.Drop incorrectly matched %sSearch for PVID %s.Search for PVIDs filtering.usablempathfwraid%s/D_%sdevice/dev-ext.cdevice/dev-io.c%s: size is %lu sectors%s: read_ahead is %u sectors (test mode - suppressed)%s: Not using O_NOATIME%s: Not using O_DIRECT O_EXCLRWROOpened %s %s%s%sClosed %sdevice/dev-md.cIntel Raid ISM Cfg Sig. ID_FS_TYPElinux_raid_member%s/dev/block/%d:%d/md/%sdm_snprintf md %s failed%s/block/md%d/md/%sdm_snprintf old md %s failedDevice %s %s is %lu bytes.Device %s %s is %s.raid%draid_disksDevice %s %s is %d.metadata_version1.00.90blacklist_exceptionsblacklistmultipath wwid %s in %s %sdevice/dev-mpath.c/etc/multipath.conf/etc/multipath/conf.d/etc/multipath/conf.d/%smpath pool creation failed.Device name is not valid.%sdev/block/%d:%dreadlink%sblock/%s/dm/uuidmpath_memberDM_MULTIPATH_DEVICE_PATH%sblock/%s/holdersPath %s is not a directory.Device %s has no holders dir%s/dev/block/%d:%d/slavesDevice %s has no slaves dir%s/block/%s/device/wwidscsi_debugSWAP-SPACESWAPSPACE2S1SUSPENDS2SUSPENDULSUSPENDV device/dev-swap.cSCSI diskIDE diskMultiple Disk (MD/SoftRAID)Loop deviceRAM diskMapped devicePartitionable MDDAC960Network Block DeviceCompaq SMART2Compaq CCISS arrayATA RaidEMC Powerpathi2o Block DiskiSeries disksNetwork block deviceATA over EthernetXen virtual block devicePlayStation 3 internal diskVirtIO diskMMC block deviceExtended device partitionsFusion IOMicron PCIe SSDViolin MemorySTECbcache block device cacheNVM ExpressZFS ZvolsVeritas Dynamic Multipathingdevice/dev-type.cFailed to read %s.blkextdrbddasdemcpowerVxDMPlooppower2device-mapperNVMEDMDRBDDASDEMCPOWERPOWER2VXDMPBLKEXTLOOPFailed to parse %s '%s'.%sdev/block/%d:%d/partition%s/dev/block/%d:%d/partitionID_PART_TABLE_TYPEDEVTYPE%s/dev/block/%d:%d%s/block/%s/devsysfs file %s does not exist.BLOCK_SIZELVM2_memberLVM1_memberDM_snapshot_cowSBMAGIC_OFFSETSBMAGICPTTYPEPTMAGIC_OFFSETPTMAGICpartition tableUSAGELABELAborted wiping of %s.Wiping %s on %s.Failed to wipe %s on %s.software RAID md superblockswap signatureLUKS signature%s/dev/block/%d:%d/%sDevice %s: %s is %lu%s.alignment_offsetqueue/minimum_io_sizequeue/optimal_io_sizequeue/discard_max_bytesqueue/discard_granularityqueue/rotationalqueue/daxdevice/dev-luks.cLUKSdevice/dev-dasd.cioctl BIODASDINFO2Failed to open %sdevice/online.cNo info in %sNo device numbers in %svg:No vgname in %sdev:No devname in %s/run/lvm/pvs_onlineFound PVs online %d for %s/run/lvm/vgs_onlineUnlink vg online: %sunlinkCreate vg online: %sFailed to create %s: %d%d:%d vg:%s dev:%s Create pv online: %s %d:%d %sCheck pv online: %sCheck pv online %s: yesCheck pv online %s: no/run/lvm/pvs_lookup/run/lvmCreating run_dir.Creating pvs_online_dir.Creating vgs_online_dir.Creating pvs_lookup_dir.cling_by_tagsnext freedisplay/display.cclvmPVS%.2fPercentage %d does not fit.--- Physical Segments ---Physical extent %u to %u: Logical volume %s%s/%s Logical extents %d to %d FREENEW --- %sPhysical volume ---PV Name %s (exported)VG Name %s%sPV Size %s(but full)Allocatable yes %sAllocatable NOPE Size %sPE Size (KByte) %uTotal PE %uFree PE %uAllocated PE %uPV UUID %sPV Name %s NOT Total PE / Free PE %u / %uLV Name %s%sVG Name %sLV UUID %sLV Creation time %sLV Removal time %sread/writeread only--- Logical volume ---LV Name %sInternal LV Name %sLV Write Access %sLV Creation host, time %s, %sINACTIVELV Pool name %sLV Thin origin name %sLV External origin name %sLV merging to %sLV merged with %sLV Pool metadata %sLV Pool data %sLV origin of Cache LV %sLV Cache pool name %sLV Cache origin name %sLV VDO Pool data %sLV VDO Pool usage %s%%LV VDO Pool saving %s%%LV VDO Operating mode %sLV VDO Index state %sLV VDO Compression st %sLV VDO Used size %sLV VDO Pool name %s (partial)# open %uLV Size %sCache used blocks %s%%Cache metadata blocks %s%%Cache dirty blocks %s%%Cache demotions %luCache promotions %luAllocated pool data %s%%Allocated metadata %s%%Mapped size %s%%Current LE %uCOW-table size %sCOW-table LE %uAllocated to snapshot %s%%Snapshot chunk size %sMirrored volumes %uSegments %uAllocation %sRead ahead sectors autoRead ahead sectors 0Read ahead sectors %u- currently set to %uPersistent major %dPersistent minor %dBlock device %d:%dMissing%sPhysical volume %s%sPhysical extents %d to %d%sLogical volume %s%sLogical extents %d to %d%sUnassigned area--- Segments ---VirtualLogical%s extents %u to %u: Type %s Monitoring %s--- Volume group ---VG Name %sSystem ID %sFormat %sMetadata Areas %dMetadata Sequence No %dexported/Clustered yesShared %sMAX LV %uCur LV %uOpen LV %uMax PV %uCur PV %uAct PV %uVG Size %sAlloc PE / Size %u / %sFree PE / Size %u / %sVG UUID %sr/wName is zero length.WARNING: Invalid input '%s'.[n] Accepted input: [%c]erroerror/errseg.cimporting unknown segmentunknown/unknown.cstart_extentFailed to allocate name.filters/filter-composite.ccompositeComposite filter initialised.filters/filter-persistent.cgoodbadfilter caching %s %sfilters/filter-regex.cfilter dm_regexFailed to allocate regex.Failed to create bitset.Invalid filter pattern "%s".%s: Skipping (regex)filter regexRegex filter initialised.failed to create sysfs pathfilters/filter-sysfs.c%s: Skipping (sysfs)Sysfs filter initialised.filters/filter-md.cmd filter allocation failedMD filter initialised.filters/filter-fwraid.cfilters/filter-mpath.clvmdevicesmpath filter initialised.filters/filter-partitioned.cfilters/filter-type.cLVM type filter initialised.Too small to hold a PVfilters/filter-usable.c%s: Skipping: %s%s: Skipping unusable device.filters/filter-signature.c%s: Skipping lvm1 device%s: Skipping gfs-pool devicesignature filter initialised.%s: Skipping (deviceid)filters/filter-deviceid.cdeviceiddeviceid filter initialised.format_text/archive.cExpiring archive %s%s/%s_%05u-%d.vgArchive file name too long.Archive rename failed for %sFile: %s/%sUnable to read archive file.VG name: %sDescription: %sBackup Time: %sNo archives found in %s.Archive file %s not found.archive_params alloc failedformat_text/archiver.cFailed to allocate desc.*before**after*Created %s executing '%s'Failed to build desc.backup_params alloc failedFailed to find device for PV.Zeroing start of device %s%s not wiped: abortinguname failed: %sformat_text/export.cBuffer reallocation failed.# %g %s# Hint only2.03.16(2) (2022-05-18)version = %ddescription = "%s"creation_time = %lu # %sstatus = %sflags = %s%s = %sseqno = %uformat = "%s"# informationalsystem_id = "%s"lock_type = "%s"lock_args = "%s"extent_size = %umax_lv = %umax_pv = %uallocation_policy = "%s"profile = "%s"metadata_copies = %uphysical_volumes {%s {device = "%s"device_id_type = "%s"device_id = "%s"dev_size = %lupe_start = %luba_start = %luba_size = %lusegment%u {start_extent = %uextent_count = %ureshape_count = %utype = "%s%s"%ss = ["%s", %u%s"%s", "%s"%s%s = %lucreation_timecreation_host = "%s"read_ahead = -1# Noneread_ahead = %umajor = %dminor = %dsegment_count = %uremoval_timeorigin = "%s%s"descendants = %shistorical_logical_volumes {text pv_namespv%dKilobytesMegabytesGigabytesTerabytesPetabytesExabytesEXPORTEDRESIZEABLEPVMOVEREADWRITEWRITE_LOCKEDNOAUTOACTIVATECLUSTEREDSHAREDALLOCATABLEMISSINGFIXED_MINORVISIBLENOTSYNCEDREBUILDRESHAPE_DATA_OFFSETRESHAPE_DELTA_DISKS_PLUSRESHAPE_DELTA_DISKS_MINUSREMOVE_AFTER_RESHAPEWRITEMOSTLYACTIVATION_SKIPERROR_WHEN_FULLMETADATA_FORMATCROP_METADATACACHE_VOLCACHE_USES_CACHEVOLformat_text/flags.cStatus value is not a string.PARTIALUnknown status flag '%s'.+%sformat_text/format-text.c LVM2 x[5A%r0N*>Failed to read vg %s from %sVG %s not found on %sWARNING: No cache info for %sWrite from %s.Write[%u] from %s.VG %s metadata writing failed(ignored)(used)empty preFailed to read VG %s from %sRead volume group %s from %sfdopenWriting %s metadata to %sfsyncRenaming %s to %s%s: rename to %s failed: %sUnlinking %sTest mode: Skipping renamemda_context allocation failedPV %s missing from cache%s.tmppe_startMDA1 startdisk sizepe_endMDA0 endlabel scan sizeba_endFailed to allocate dir_listtext_orphanInitialised format: %sformat_text/import.cformat_text/import_vsn1.ccontentsmissing contents fieldText Format Volume Groupunrecognised contents fieldmissing version numberunrecognised version number_mimagetmpCouldn't find uuid.Invalid uuid.Could not find status flags.Could not read status flags.Could not read flags.Empty pv section.dev_sizeEmpty segment section.reshape_countSegment allocation failedsegment_countImporting logical volume %s.creation_hostEmpty logical volume section.Couldn't find section '%s'.read_vgmax_lvmax_pvmetadata_copiesphysical_volumeshistorical_logical_volumesdescriptionCouldn't read pv summariesLVM2 001format_text/text_label.cs, mda2 ( mda1 ( da1 ( ba1 (Retrying metadata scan.Scanning %s found no mdas.Scanning %s mda1 summary.Scanning %s mda2 summary.freeseg/freeseg.clabel/label.cFailed to open device %sLABELONEFailed to write label to %slabel allocaction failed%s: No lvm label detectedrwexrwFailed to set bcache fd.open %s %s di %d fd %dclose %s errno %dScan failed to open %d:%d %s.Scanning submitted %d readsScan failed to read %s.Scan failed to process %sFailed to set up sync io.Failed to set up devices.Filtering devices to scanReading labels for pvid%s cannot read label.%s not an lvm device.Finding devices to scanlvconvertclose and reopen excl %sclose and reopen rw %sdev_read bcache not set up %sclose and reopen to write %s/run/lvm/hints/run/lvm/nohints/run/lvm/newhintslabel/hints.cnohints_exist errno %d %snewhints_exist errno %d %snewhints createdtouch_hints errno %d %stouch_hints close errno %d %sunlink_nohints errno %d %sunlink_hints errno %d %sunlink_newhints errno %d %sclear_hints open errno %dclear_hints flush errno %d %sclear_hints close errno %d %slock_hints existing fd %dlock_hints open errno %d %slock_hints close errno %d %sunlock_hints no existing fdunlock_hints flock errno %dReading hint filehints_version:%d.%dglobal_filter:scan_lvs:devices_file:devs_hash:scan:pvid:devn:%d:%dadd hint %s %s %d:%d %sread_hint_file close errno %daccept hints found %dWriting hint file %d# info: duplicate_pvs # info: duplicate_vgnames # Created by %s pid %d %shints_version: %d.%d global_filter:%s scan_lvs:%d devices_file:%s devices_file:. devs_hash: %u %u clear_hint_filepvscan_recreate_hints_beginget_hints: pvscan recreateget_hints: nohints fileget_hints: newhints fileget_hints: no fileget_hints: lock failget_hints: read failget_hints: needs refreshget_hints: no entries#global%s/P_%slocking/file_locking.c%s/V_%slocking/locking.cFailed to activate %sglobal flock already held exstderrdup2dup2(%d, %d) returned %dLVM_LOG_FILE_EPOCH%s_%s_%d_%lluLVM_LOG_FILE_MAX_LINESLVM_EXPECTED_EXIT_STATUSLVM_SUPPRESS_SYSLOGfailed to write log file: %s failed to write log file %H:%M:%S.%06ld DM_ABORT_ON_INTERNAL_ERRORSInternal error: failed to report cmdstatusCODE_LINE=650CODE_FILE=log/log.c%s%s %s:%d%s%s %s:%d%s%s%s %sMESSAGE=lvm command %sCODE_LINE=877PRIORITY=%iLVM_CMD_ID=%sLVM_CMD_NAME=%sfatalnoticeprocessingcmdlabelmetadata/cache_manip.cUnknown cache mode: %s.Setting chunk size to %s.another LVCan't convert internal LV %s.%s_cpoolFlushing of %s aborted.smqUse cache metadata format 2.reporter_poolmetadata/writecache_manip.clvol%dFailed to deactivate %s.flush_on_suspendRemoving previous wcorig %sFailed to update VG.%s=%s%s=%llu%s_imetametadata/integrity_manip.cbitmapJlvcreatecrc32cLV update and reload failedFailed to add integrity.metadata/lv.cunassigned:%u-%u(%u)nopassdownnot monitored%s is %son %slvfullname snprintf faileddm_pool_alloc failedlvpath snprintf faileddm_build_dm_name failedlv_dmpath snprintf failed%s/%s%sreshapeFailed to duplicate hostnameActivating logical volume %s.Thin volume %s is active.publicmultithinoriginmultithickoriginmultiextthinoriginthinsnapshotthicksnapshotraid0raid0_metaraid4raid5raid5_nraid5_laraid5_raraid5_lsraid5_rsraid6raid6_zrraid6_nrraid6_ncwritecacheoriginintegrityoriginmetadata/lv_manip.cFailed to allocate memory %s/%s uses %sStack %s:%u[%u] on LV %s:%u.Internal error: Meta le != 0.Failed to suspend %s.Failed to reactivate %s.dm_pool_begin_object faileddm_pool_grow_object failed with PV tags: Changing Consideringmetadata areaup to %u %s%s of %u extents eachCling_to_allocated is %ssetSorting %u log areasSorting %u areascontiguous _mimage_0rimage%s_%s_%u%s_%s%s_rmeta_%uNo meta_areas for RAID typeFailed to extend %s in %s.Failed to remove LVFailed to commit VG %sFailed to insert layer for %shistorical Cannot rename locked LV %sFailed to create new nameHistorical lv_info failed: aborting. and open--dry-run--verbose--yes--forcephysicallogicalat most Extending %u mirror images.Using default stripesize %sNew size of 0 not permitted.Invalid stripe size %s.Can't resize reshaping LV %s.ReducExtendFilesystem check failed.Filesystem resize failed.Failed to activate %s.%s: discarding failed.Problem deactivating %s.Live by historical LVCreating logical volume %spv_list allocation failedLV %s in VG %s is now hidden. with %u snapshots(s) merging origin with snapshot %s clustered and DISCARDFailed to remove cachevol %s.Failed to deactivate LV %sFailed to update pool %s.Removing snapshot volume %s.lvremovevgremovePostponing write and commit.WARNING: Failed to unlock %s.Historical lcache originexternal originVDO pool (origin only)Layer segment found: %s:%uLayer is not linear: %s:%uMissing error segtypelv_list alloc failedCan't move snapshot segment.Removing layer %s for %sFailed to find layer %s in %s_mimageCreation of layer LV failedInserting layer %s for %sInserting %s:%u-%u of %s/%sInterrupted initialization ofFailed to wipe signatures on%s logical volume %s.BLKZEROOUTioctlFailed to initializeInterrupted initialization%s_voriginAdding integrity to new LVCache pool is prepared.Failed to activate thin %s.Failed to activate new LV %s.snapshot exception storestart of new LVAborting. Failed to wipe %s.Couldn't create snapshot.thin-poolvdo-poolvpool%dLogical volume "%s" created.metadata/merge.cno meta areasnon power of 2 stripe sizenon-zero region_sizenon-zero write behindnon-zero min recovery ratenon-zero max recovery ratenon power of 2 region sizenon-zero stripe sizeminimum 2 areas requiredminimum 5 areas requiredminimum 4 areas requirednon-zero writebehindnon-zero origin LVnon-zero cow LVnon-zero origin_listno raid image SubLVvisible raid image LVno raid meta SubLVvisible raid meta LVzero area countzero areasextents_copied too largeno DataLVDataLV size variationsno MetaLVMetaLV size variationsbogus RAID segment typemirror image is not mirroredis not flagged as cache LVis missing cache pool LVsets cleaner_policyis missing cache policy namehas invalid chunk size.sets METADATA_FORMAT flagsets cache metadata formatsets cache modesets policy namesets policy settingslog LV is not a mirror logregion size is zero_mlogregion size is non power of 2is missing a pool data LVis missing a pool metadata LVzero_new_blocks is invalidsets zero_new_blockssets discardssets thin_messages listsets CROP_METADATA flagis missing thin pool LVhas too large device idsets device_idsets external LVsets merge LVsets indirect_origin LVis not flagged as VDO pool LVis missing a VDO pool data LVis not VDO pool data LVsets vdo_pool_header_sizesets vdo_pool_virtual_extentssets vdo_paramsis not flagged as VDO LVis missing VDO pool LVsets pool LVsets chunk_sizesets transaction_idset segtype_privateLV %s: has no segment._cmetametadata/metadata.cvg_remove_mdas %s failed%s: Couldn't get size.Adding PVs to VG %s.Adding PV %s to VG %s.PV %s has wrong block size.Failed to add tag %s to %s/%s2.4.vg_createsnprintf random bit failed.Failed to allocate pvid hash.Failed to hash pvid.Failed to allocate uuid hashFailed to hash lvname.Failed to hash lvid.Failed to write VG %s.vg_devs_checkpv allocation failed#orphansSkipping clustered VG %s.Volume group %s is read-onlyReading VG %s without a lock.Volume group %s is exportedformat_instanceFailed to hash mda.SettingClearingignoredin-useLV %s dev %s is pmem.LV %s dev %s not pmem.LV %s on pmemReading VG %s %sRescanning devices for %s %sReading orphan VG %s.Can't get lock for %s.VG name not found for vgid %sVolume group "%s" not foundVolume group "%s" not found.naVolume group %s is read-only.Failed to import written VG.metadata/mirror.cAborting. Unable to tag.LV %s assigned to be split._mimage_%d%s_mimage_%%dUnable to allocate memory. and no log volumeFailed to add mirror images.All mimages of %s are gone.%u image(s) removed from %s.lvs list alloc failed._mlogtmp_%dFailed to create mirror log.Failed to form mirrored log.coreFailed to convert mirror logNo conversion is requested.Not a mirror segment.metadata/pool_manip.cDiscarding message for LV %s._cdata_tdata%s_pmsparemetadata/pv.cmetadata/pv_list.cAllocation of list failed.Skipping invalid tag %s.Failed to clone PV name.pv_segment allocation failedmetadata/pv_manip.c%s %u: %6u %6u: %s(%u:%u)Gap in pvsegs: %u, %uWrong lvseg area typeInconsistent pvseg pointersInconsistent length: %u %uUpdating physical volume "%s"Physical volume "%s" changedmetadata/pv_map.cpvl->pv->devcreate_pv_maps alloc failedto_go <= pva->countmetadata/raid_manip.c_mlog__mimage__rmeta__rimage_Failed to get device count.Failed to get device health.Memory allocation failed.Failed to resume %s.Post callout function failed.Shifting images in %s.Shifting %s and %s by %u.rmetaFailed to allocate new name.%s_%s_%%dReaWrite of VG %s failed.Too few stripes requested.LV %s already has %u stripes._rimage_0Adding %s to %s.Failed to add %s to %s.recoverExtracting %u %s from %s.Failed to extract %s from %s.raid1 with reducingenhancingLogical volume %s NOT split.Failed to add sublv %s.Data LV renamed to %s.Removing mirror log %s.Failed to remove mirror log.Renaming %s to %s.Setting new segtype for %s.Adjust data LVs of %s.raid10_near (same as %s%s) losing %s resilienceCan't convert %s LV %s to %s.Adding metadata LVs to %s._extractedCan't convert %s to %s.--stripes-I/--stripesize-R/--regionsize to %s type? [y/n]: dm_snprintf failed.Converting %s from %s to %s.%s has enough space for %s.LV %s in not partial.%s_iorigmetadata/segtype.cmetadata/snapshot_manip.csnapshot%dlocked volumespvmoved volumeshidden volumescache type volumesthin pool type volumesmirror subvolumesraid subvolumesraid with integritymetadata/thin_manip.cAdded %s message. has read-only metadata is erroring needs check is out of data space is failed or lower by 1no free space in volume groupLV %s has no segment.Cannot find free device_id.Found free pool device_id %u.performanceCropping metadata size to %s.Setting chunk size %s.EnablingDisabling%s pool zeroing on default.metadata/vdo_manip.cofflineclosedopeningclosingrecoveringnormalasyncasync-unsafe%s/block/dm-%d/vdo/%sFailed to build kvdo path.%skvdo/%s/%sstrtoolstatistics/data_blocks_used--logical-size=%luK--slab-bits=%u--uds-checkpoint-frequency=%u--uds-memory-size=%u--uds-memory-size=0.%u--uds-sparseCommand %s failed.Skiping VDO formating %s._vdataUnknown VDO write policy %s.metadata/vg.cFailed to allocate VG name.Allocated VG %s at %p.Freeing VG %s at %p. free space allocated space PV segment start PV segment length area length extents moved virtual extents pvseg start pvseg length area startMaxLogicalVolume limit is 255vg_set_lock_type %s no memInternal error: VG is NULL.No device found for PV.vgreduce_single VG %s PV %s Mirrors %umirror/mirrored.c Mirror size %u Mirror log volume %s Mirror region size %s Mirror original: Mirror destinations:mirror_countextents_movedmirror_count = %uextents_moved = %umirror_log = "%s"region_size = %uFound mirror log at %d:%dStatus of log (%d:%d): %c.Found mirror image at %d:%dStatus of image %d: %c.misc/lvm-exec.cExecuting:%sforkexecvpChild %u exited abnormally%s failed: %u/dev/nullpipePiping:%spipe[0]STDOUTpipe[1]STDINwaitpidmisc/lvm-file.cgethostnamenohostname%s/.lvm_%s_%d_%d%s: rename to %s failedsync_dir failed in strdupF_WRLCKF_RDLCKLocking %s (%s, %hd)fcntlUnlocking fd %d%s: write error_drop_shared_flock %s.misc/lvm-flock.c_undo_flock %sUnlocking %sflock_do_flock %s %c%cGiving up waiting for lock.:auxUnrecognised lock type: %dLocking %s %c%c convertLocking %s %c%c[unknown]misc/lvm-globals.c%s[%d]LVM udev checking enabledLVM udev checking disabledLVM activation checks enabledSIGINTSIGTERMInterrupted...misc/lvm-signal.csigprocmasksigactionSIG_SETMASK_block_signalssigfillsetmisc/lvm-string.cmisc/lvm-wrappers.cUdev library context not set.Could not get udev state.Assuming udev is not running.read_urandom: /dev/urandom[vdso][vsyscall][vectors]locale/locale-archive/LC_MESSAGES/gconv/gconv-modules.cache/ld-2./libaio.so./libattr.so./libblkid.so./libbz2.so./libcap.so./libdl-/libdw-/libelf-/libgcrypt.so./libgpg-error.so./liblz4.so./liblzma.so./libmount.so./libncurses.so./libpcre.so./libpcre2-/libreadline.so./libedit.so./libresolv-/libselinux.so./libsepol.so./libsystemd.so./libtinfo.so./libudev.so./libuuid.so./libz.so./etc/selinuxmm/memlock.cmunlock%lx-%lx %c%c%c%c%nFailed to parse maps line: %smunlockalllseekUnl%socked %ld bytesgetpriorityLocking memory%s/self/mapsproc_dir too longUnlocking memoryLeaving section (%s).memlock reset.Failed to connect to dbus: %dnotify/lvmnotify.ccom.redhat.lvmdbus1Nofify dbus at %s.ExternalEventcom.redhat.lvmdbus1.Manager/com/redhat/lvmdbus1/ManagerWARNING: %s: %sFunction not implementedproperties/prop_common.cInvalid property name %s Raid Data LV%2draid/raid.c Raid Metadata LV%2d %sdevice_countstripe_countNo areas found for segment %sstripe_sizeraid0_lvsstripe_count = %ustripe_size = %uraid0_lv# lineardevice_count = %uwritebehind = %umin_recovery_rate = %umax_recovery_rate = %udata_offset = %uRaid transient status %s.shrinkingrebuild+emptymetareshapingreport/properties.clv_full_namelv_pathlv_dm_pathlv_parentlv_layoutlv_rolelv_initial_image_synclv_image_syncedlv_merginglv_convertinglv_allocation_policylv_allocation_lockedlv_fixed_minorlv_skip_activationlv_autoactivationlv_when_fulllv_activelv_active_locallylv_active_remotelylv_active_exclusivelylv_majorlv_minorlv_read_aheadlv_sizelv_metadata_sizeseg_countorigin_uuidorigin_sizelv_ancestorslv_full_ancestorslv_descendantslv_full_descendantsraid_mismatch_countraid_sync_actionraid_write_behindraid_min_recovery_rateraid_max_recovery_rateintegritymismatchesmove_pvmove_pv_uuidconvert_lvconvert_lv_uuidmirror_log_uuidmetadata_lvmetadata_lv_uuidpool_lvpool_lv_uuidlv_tagslv_profilelv_lockargslv_timelv_time_removedlv_hostlv_moduleslv_historicallv_kernel_majorlv_kernel_minorlv_kernel_read_aheadlv_permissionslv_suspendedlv_live_tablelv_inactive_tablelv_device_opensnap_percentmetadata_percentcopy_percentsync_percentcache_used_blockscache_dirty_blockscache_read_hitscache_read_missescache_write_hitscache_write_misseskernel_cache_settingskernel_cache_policykernel_metadata_formatlv_health_statuskernel_discardslv_check_neededlv_merge_failedlv_snapshot_invalidvdo_operating_modevdo_compression_statevdo_index_statevdo_used_sizevdo_saving_percentwritecache_total_blockswritecache_free_blockswritecache_writeback_blockswritecache_errorlv_attrpv_fmtpv_majorpv_minorpv_mda_freepv_mda_sizepv_ext_vsnpv_sizepv_freepv_usedpv_attrpv_allocatablepv_exportedpv_missingpv_pe_countpv_pe_alloc_countpv_tagspv_mda_countpv_mda_used_countpv_ba_startpv_ba_sizepv_in_usepv_duplicatepv_device_idpv_device_id_typevg_fmtvg_uuidvg_attrvg_permissionsvg_extendablevg_exportedvg_autoactivationvg_partialvg_allocation_policyvg_clusteredvg_sharedvg_sizevg_freevg_sysidvg_systemidvg_lock_typevg_lock_argsvg_extent_sizevg_extent_countvg_free_countvg_missing_pv_countlv_countsnap_countvg_seqnovg_tagsvg_profilevg_mda_countvg_mda_used_countvg_mda_freevg_mda_sizevg_mda_copiesdata_stripesreshape_lenreshape_len_lenew_data_offsetparity_chunksthin_countthin_idseg_start_peseg_size_peseg_tagsseg_pe_rangesseg_le_rangesseg_metadata_le_rangesmetadata_devicesseg_monitorvdo_compressionvdo_deduplicationvdo_block_map_cache_sizevdo_block_map_era_lengthvdo_index_memory_sizevdo_slab_sizevdo_header_sizepvseg_sizeagotodayyesterdaySundaySunMondayMonTuesdayTueWednesdayWedThursdayThuFridayFriSaturdaySatnoonmidnightsecondsecminutehourhrAMPMweekmonthyearyrJanuaryJanFebruaryFebMarchMarAprilAprMayJuneJunJulyJulAugustAugSeptemberSepOctoberOctNovemberNovDecemberDecreport/report.ctime_now@%ld:@%ldundefwriteableread-writeunmanagedinitial image syncimage syncedallocation lockedfixed minorfixedactive locallyactive remotelyactive exclusivelymerge failedsnapshot invalidlive table presentlive tableliveinactive table presentinactive tableinactiveskip activationcheck neededread-only-overridero-overrider-overrideerror when fullerror if no spacequeuequeue when fullqueue if no spaceFailed to get segtype name.lvname snprintf faileddm_pool_strdup failed_dup_Failed to allocate buffer.refresh neededmismatches existout_of_dataCommand Logvg_Logical Volumelv_Logical Volume Device InfoLogical Volume Device StatusPhysical Volumepv_Physical Volume LabelLogical Volume SegmentPhysical Volume Segmentpvseg_Device Typesdevtype_Unique identifier.LV layout.LV role.Set if LV is being converted.LV allocation policy.Active state of the LV.Size of LV in current units.Number of segments in LV.The integrity modeThe integrity block sizeTags, if any.Set if the LV is historical.The writecache block sizeLV permissions.Set if LV is suspended.Set if LV device is open.Total cache blocks.Used cache blocks.Dirty cache blocks.Cache read hits.Cache read misses.Cache write hits.Cache write misses.Cache policy used in kernel.LV health status.Set if snapshot merge failed.Total writecache blocks.Total writecache free blocks.Total writecache errors.Type of metadata.Name.Device major number.Device minor number.PV header extension version.Size of PV in current units.Set if PV is used.Device ID such as the WWID.VG permissions.Set if VG is extendable.Set if VG is exported.Set if VG is partial.VG allocation policy.Set if VG is clustered.Set if VG is shared.Number of PVs in VG.Number of LVs.Number of snapshots.Type of LV segment.Number of data copies.Sparse indexing (vdopool).IO enqueue (vdopool).Number of extents in segment.Description of Device Type.Log sequence number.Log type.Current context.Current object type.Current object name.Current object ID.Current object group.Current object group ID.Log message.Errno.Return code.lvm2_snapshot-mergesnapshot/snapshot.cmerging_storecow_storecow_store = "%s"merging_store = "%s"snapshot-origin Stripes %ustriped/striped.c Stripe size %s Stripe size %u KB Stripe %d:stripethin/thin.c Discards %s Thin count %u Transaction ID %lu Zero new blocks %stransaction_id = %ludiscards = "%s"zero_new_blocks = 1crop_metadata = %umessage%d {create = "%s"delete = %dThin pool create_%s %s.Thin pool delete %u. Device ID %uthin_poolthin_pool = "%s"device_id = %dexternal_origin = "%s"merge = "%s"discards_non_power_2metadata_resizeexternal_origin_extenduuid/uuid.czero/zero.cactivate/dev_manager.cblocked_mirrors block_on_error%d:%d %d:%dunusable_thinsinvalid snapshotsfrozen raidfrozenCRYPT-TEMPCRYPT-SUBDEVstratis-cryptostratis%s: %s device %s not usable.Removing dm dev %u:%uCached as inactive %s.%*u:%*u %uPrelLV percent: %sdev_managerChecking device id for LV %s.Found holder %s of %s.%sblock/dm-%u/holdersCached as not present %s.-Vbetterolder-cmetaRunning check command on %smissing_%d_%dAdding new LV %s%s%s to dtreeDeleting tracked UUID %s. origin-onlyCreating %s%s tree for %s.activate/fs.cCreating directory %smkdirRemoving directory %sCouldn't create path for %s.Removing %s%s/groupLinking %s -> %ssymlinkRemoving link %sSyncing device nameslvmpolld/lvmpolld-client.creasonprogress_infolvid = %sabort = %ldsysdir = %sin_progresssignalnot_foundlvname = %svgname = %scmdline = %sinterval = %sFailed to create %s request.handle_missing_pvs = %lddevicesfile = %sOK abort/run/lvm/lvmlockd.socketlocking/lvmlockd.c/run/lvmlockd.pidNO_LOCKSPACESNO_GL_LSNO_LMDUP_GL_LSWARN_GL_REMOVEDSH_EXISTSlockd_result reply error %dlockd_result bad responselockd_result no op_resultresult_flagspath_num = %ldFailed to create pvs request.path[%d] = %%sFail to any PVs for VG %sVG %s find PV device %spid = %ldcmd = %slv_lock_args = %svg_lock_args = %svg_lock_type = %slv_uuid = %slv_name = %svg_name = %sopts = %smode = %slvmlockd %s %s result %d %xsanlock lvmlock LV removedFailed to refresh %s.find_free_lockinit_vgVG %s init failed: %dUnknown sector size %u.Failed to create internal lv.free_vgbusy_vgUnknown lock_type.Failed to unlock LV %s/%s.start_initstart_vghost_id = %ldversion = %ldvg_uuid = %sVG %s starting %s lockspaceVG %s start failed: %dlockd stop VG %s lock_type %sstop_vgVG %s stop failed: %dstart_waitLock start failedlockd global lock_type %sUnknown lock-gl modelock_glRetrying %s global lockEnabling sanlock global lockGlobal lock failed: error %dlockd global mode %sGlobal lock failed: error %d.lockd VG %s mode %slock_vgRetrying %s lock on VG %sVG %s lock failed: removedVG %s lock skipped: error %dVG %s lock failed: error %dvg_updatelockd query LV %s/%squery_lock_lvlvextendlvresizelvchangeLocking failed for LV %s/%sRefresh lvmlockNo vdo pool for %s/%s/etc/mtabgfs2ocfs2shupdatenorefresh%s/%s/%sinit_lvlv_lock_argslv_lock_args not returnedfree_lv_free_lv lvmlockd result %dFailed to find vdo pool %s/%sFailed to lock vdo pool %s/%srename_vg_beforerename_vg_finalrunning_lmlvmlockd found sanlocklvmlockd found dlmlvmlockd found idmrefresh_lvpath = %sLV refresh failed for LV %svdo/vdo.c %s %svdo_poolvdo_offsetvdo_pool = "%s"vdo_offset = %u Virtual size %s Header size %sCompression DeduplicationMetadata hints Minimum IO size %s Block map cache sz %s Block map era length %uSparse index Index memory size %s Slab size %s # Ack threads %u # Bio threads %u Bio rotation %u # CPU threads %u # Hash zone threads %u # Logical threads %u # Physical threads %u Max discard %u Write policy %sUnknown logical volume %s.header_size = %uvirtual_extents = %uuse_compression = 1use_deduplication = 1use_metadata_hints = 1minimum_io_size = %ublock_map_cache_size_mb = %ublock_map_era_length = %uuse_sparse_index = 1index_memory_size_mb = %umax_discard = %uslab_size_mb = %uack_threads = %ubio_threads = %ubio_rotation = %ucpu_threads = %uhash_zone_threads = %ulogical_threads = %uphysical_threads = %uwrite_policy = %sInitialised segtypes: %s, %s.online_renamenone_VALERRconststr_VALConstStringconstnum_VALConstNumberbool_VALBooly|nsnumber_VALSNumber[+|-]Numberpnumber_VALPNumber[+]Numberuint32_VALUint32string_VALvg_VALlv_VALpv_VALtag_VALTagselect_VALSelectactivationmode_VALActivationModepartial|degraded|completeactivation_VALActivey|n|aycachemetadataformat_VALCacheMetadataFormatauto|1|2cachemode_VALCacheModediscards_VALDiscardspassdown|nopassdown|ignoremirrorlog_VALMirrorLogcore|diskssizekb_VALSSizeKB[+|-]Size[k|UNIT]ssizemb_VALSSizeMB[+|-]Size[m|UNIT]psizemb_VALPSizeMB[+]Size[m|UNIT]NSizeMB[-]Size[m|UNIT]regionsizemb_VALRegionSizesextents_VALSExtents[+|-]Number[PERCENT]pextents_VALPExtents[+]Number[PERCENT]nextents_VALNExtents[-]Number[PERCENT]permission_VALPermissionrw|rmetadatatype_VALMetadataTypeunits_VALUnitssegtype_VALSegTypealloc_VALAlloclocktype_VALLockTypesanlock|dlm|nonereadahead_VALReadaheadauto|none|Numbervgmetadatacopies_VALMetadataCopiesVGall|unmanaged|Numberpvmetadatacopies_VALMetadataCopiesPV0|1|2unusedpolloperation_VALPollOpwritemostly_VALWriteMostlyPVPV[:t|n|y]syncaction_VALSyncActioncheck|repairreportformat_VALReportFmtbasic|jsonconfigreport_VALConfigReportlog|vg|lv|pv|pvseg|segconfigtype_VALConfigTyperepairtype_VALRepairTypedumptype_VALDumpTypeVAL_COUNTARG_UNUSEDabort_ARG--abortactivationmode_ARG--activationmodeaddtag_ARG--addtagadddev_ARG--adddevdeldev_ARG--deldevaddpvid_ARG--addpviddelpvid_ARG--delpvidaligned_ARG--alignedalloc_ARG--allocatomic_ARG--atomicatversion_ARG--atversion--autoactivationsetautoactivation_ARG--setautoactivationbinary_ARG--binarybootloaderareasize_ARG--bootloaderareasizecache_long_ARG--cachecachemetadataformat_ARG--cachemetadataformatcachemode_ARG--cachemodecachepool_ARG--cachepoolThe name of a cache pool. cachevol_ARG--cachevolThe name of a cache volume. cachedevice_ARG--cachedevicecachesize_ARG--cachesizeThe size of cache to use. check_ARG--checkcommandprofile_ARG--commandprofilecompression_ARG--compression--configconfigreport_ARG--configreportSee \fBlvmreport\fP(7). configtype_ARG--typeconfigdataalignment_ARG--dataalignmentdataalignmentoffset_ARG--dataalignmentoffsetdeduplication_ARG--deduplicationdeltag_ARG--deltagdetachprofile_ARG--detachprofiledeviceidtype_ARG--deviceidtype--devicesdevicesfile_ARG--devicesfilediscards_ARG--discardsdriverloaded_ARG--driverloadeddump_ARG--dumperrorwhenfull_ARG--errorwhenfullforce_long_ARGforeign_ARG--foreignhandlemissingpvs_ARG--handlemissingpvsignoreadvanced_ARG--ignoreadvancedignorelocal_ARG--ignorelocalignorelockingfailure_ARG--ignorelockingfailureignoremonitoring_ARG--ignoremonitoringignoreskippedcluster_ARG--ignoreskippedclusterNo longer used. ignoreunsupported_ARG--ignoreunsupportedimportdevices_ARG--importdevicesjournal_ARG--journallabelsector_ARG--labelsectorlistlvs_ARG--listlvslistvg_ARG--listvgcheckcomplete_ARG--checkcompletelockopt_ARG--lockoptlockstart_ARG--lockstartlockstop_ARG--lockstoplocktype_ARG--locktypelogonly_ARG--logonlylonghelp_ARG--longhelpDisplay long help text. --maxrecoveryratemerge_ARG--mergemergemirrors_ARG--mergemirrorsmergesnapshot_ARG--mergesnapshotmergethin_ARG--mergethinmergedconfig_ARG--mergedconfigmetadataignore_ARG--metadataignoremetadataprofile_ARG--metadataprofile--metadatasizeminor_ARG--minor--minrecoveryratemirrorlog_ARG--mirrorlogmirrorsonly_ARG--mirrorsonlymknodes_ARG--mknodesmonitor_ARG--monitornameprefixes_ARG--nameprefixesnoheadings_ARG--noheadingsnohints_ARG--nohintsnohistory_ARG--nohistorynolocking_ARG--nolockingnorestorefile_ARG--norestorefilenosuffix_ARG--nosuffixnosync_ARG--nosyncnotifydbus_ARG--notifydbusnoudevsync_ARG--noudevsyncoriginname_ARG--originnamesetphysicalvolumesize_ARG--setphysicalvolumesize--settings--pollpolloperation_ARG--polloperationpooldatasize_ARG--pooldatasizepoolmetadata_ARG--poolmetadatapoolmetadatasize_ARG--poolmetadatasizepoolmetadataspare_ARG--poolmetadataspare--profilepvmetadatacopies_ARG--pvmetadatacopiesraidintegrity_ARG--raidintegrityraidintegrityblocksize_ARG--raidintegrityblocksizeraidintegritymode_ARG--raidintegritymodereadonly_ARG--readonlyrefresh_ARG--refreshremovemissing_ARG--removemissing--rebuildrepair_ARG--repairrepairtype_ARG--repairtypereplace_ARG--replacereportformat_ARG--reportformat--restorefilerestoremissing_ARG--restoremissingresync_ARG--resyncrows_ARG--rowsOutput columns as rows. segments_ARG--segmentsseparator_ARG--separatorshared_ARG--sharedsinceversion_ARG--sinceversionsplitcache_ARG--splitcachesplitmirrors_ARG--splitmirrorssplitsnapshot_ARG--splitsnapshotshowdeprecated_ARG--showdeprecatedshowunsupported_ARG--showunsupportedstartpoll_ARG--startpollstripes_long_ARGswapmetadata_ARG--swapmetadata--syncactionsysinit_ARG--sysinitsystemid_ARG--systemidthinpool_ARG--thinpoolThe name of a thin pool LV. trackchanges_ARG--trackchangestrustcache_ARG--trustcache--typeudevoutput_ARG--udevoutputunbuffered_ARG--unbuffereduncache_ARG--uncacheupdate_ARG--updatecachepolicy_ARG--cachepolicycachesettings_ARG--cachesettingsunconfigured_ARG--unconfiguredunits_ARG--unitsunquoted_ARG--unquotedusepolicies_ARG--usepoliciesvalidate_ARG--validatevdo_ARG--vdovdopool_ARG--vdopoolvdosettings_ARG--vdosettings--versionDisplay version information. vgmetadatacopies_ARG--vgmetadatacopiesvgonline_ARG--vgonlinewithsummary_ARG--withsummarywithcomments_ARG--withcommentswithgeneralpreamble_ARG--withgeneralpreamblewithlocalpreamble_ARG--withlocalpreamblewithspaces_ARG--withspaceswithversions_ARG--withversions--writebehind--writemostlycorelog_ARG--corelogresizable_ARG--resizableallocation_ARG--allocationavailable_ARG--availableraidrebuild_ARG--raidrebuildraidsyncaction_ARG--raidsyncactionraidwritemostly_ARG--raidwritemostlyraidminrecoveryrate_ARG--raidminrecoveryrateraidmaxrecoveryrate_ARG--raidmaxrecoveryrateraidwritebehind_ARG--raidwritebehindvirtualoriginsize_ARG--virtualoriginsizesplit_ARG--split--metadatacopiesactivate_ARG--activateall_ARG--allautobackup_ARG--autobackupactivevolumegroups_ARG--activevolumegroupsbackground_ARG--backgroundbasevgname_ARG--basevgnameblockdevice_ARG--blockdevicechunksize_ARG--chunksizeclustered_ARG--clusteredcolon_ARG--coloncolumns_ARG--columnscontiguous_ARG--contiguousdebug_ARG--debugexported_ARG--exportedphysicalextent_ARG--physicalextent--fileforce_ARG--full--helpDisplay help text. --historyhelp2_ARGimport_ARG--importinterval_ARG--intervaliop_version_ARG--iop_versionstripes_ARGstripesize_ARGlogicalvolume_ARG--logicalvolumemaxlogicalvolumes_ARG--maxlogicalvolumesextents_ARG--extents--listlvmpartition_ARG--lvmpartitionOnly report PVs. --sizepersistent_ARG--persistentmajor_ARG--majorsetactivationskip_ARG--setactivationskipignoreactivationskip_ARG--ignoreactivationskipmaps_ARG--maps--mirrorsmetadatatype_ARG--metadatatype--namenofsck_ARG--nofscknovolumegroup_ARG--novolumegroupoldpath_ARG--oldpathoptions_ARG--optionssort_ARG--sortmaxphysicalvolumes_ARG--maxphysicalvolumespermission_ARG--permissionpartial_ARG--partialphysicalvolume_ARG--physicalvolumequiet_ARG--quietreadahead_ARG--readaheadresizefs_ARG--resizefsreset_ARG--resetregionsize_ARGphysicalextentsize_ARG--physicalextentsize--snapshotshort_ARG--shortstdin_ARG--stdinselect_ARG--selecttest_ARG--test--thinupdatemetadata_ARG--updatemetadatauuid_ARG--uuiduuidstr_ARGuuidlist_ARG--uuidlistverbose_ARG--volumegroupvirtualsize_ARG--virtualsizewipesignatures_ARG--wipesignaturesallocatable_ARG--allocatableresizeable_ARG--resizeableyes_ARGzero_ARG--zeroARG_COUNTLVP_NONEis_locked_LVPlv_is_lockedis_partial_LVPlv_is_partialis_virtual_LVPlv_is_virtualis_merging_LVPlv_is_mergingis_merging_origin_LVPlv_is_merging_originis_converting_LVPlv_is_convertingis_external_origin_LVPlv_is_external_originis_virtual_origin_LVPlv_is_virtual_originis_not_synced_LVPlv_is_not_syncedis_pending_delete_LVPlv_is_pending_deleteis_error_when_full_LVPlv_is_error_when_fullis_pvmove_LVPlv_is_pvmoveis_removed_LVPlv_is_removedis_vg_writable_LVPlv_is_vg_writableis_thinpool_data_LVPlv_is_thinpool_datais_thinpool_metadata_LVPlv_is_thinpool_metadatais_cachepool_data_LVPlv_is_cachepool_datais_cachepool_metadata_LVPlv_is_cachepool_metadatais_mirror_image_LVPlv_is_mirror_imageis_mirror_log_LVPlv_is_mirror_logis_raid_image_LVPlv_is_raid_imageis_raid_metadata_LVPlv_is_raid_metadatais_origin_LVPlv_is_originis_thick_origin_LVPlv_is_thick_originis_thick_snapshot_LVPlv_is_thick_snapshotis_thin_origin_LVPlv_is_thin_originis_thin_snapshot_LVPlv_is_thin_snapshotis_cache_origin_LVPlv_is_cache_originis_merging_cow_LVPlv_is_merging_cowis_cow_covering_origin_LVPlv_is_cow_covering_originis_visible_LVPlv_is_visibleis_historical_LVPlv_is_historicalis_raid_with_tracking_LVPlv_is_raid_with_trackingis_raid_with_integrity_LVPlv_is_raid_with_integrityLVP_COUNTLVT_NONElinear_LVTstriped_LVTsnapshot_LVTthin_LVTthinpool_LVTcachepool_LVTvdo_LVTvdopool_LVTvdopooldata_LVTvdopooldatamirror_LVTraid_LVTraid0_LVTraid1_LVTraid4_LVTraid5_LVTraid6_LVTraid10_LVTerror_LVTzero_LVTwritecache_LVTintegrity_LVTLVT_COUNTCMD_NONEdevtypes_general_CMDdevtypes_generalformats_general_CMDformats_generalfullreport_general_CMDfullreport_generalhelp_general_CMDhelp_generallastlog_general_CMDlastlog_generallvchange_activate_CMDlvchange_activatelvchange_monitor_CMDlvchange_monitorlvchange_persistent_CMDlvchange_persistentlvchange_poll_CMDlvchange_polllvchange_properties_CMDlvchange_propertieslvchange_rebuild_CMDlvchange_rebuildlvchange_refresh_CMDlvchange_refreshlvchange_resync_CMDlvchange_resynclvchange_syncaction_CMDlvchange_syncactionlvconvert_change_mirrorloglvconvert_change_region_sizelvconvert_integrity_CMDlvconvert_integritylvconvert_merge_CMDlvconvert_mergelvconvert_merge_mirror_imageslvconvert_merge_snapshot_CMDlvconvert_merge_snapshotlvconvert_merge_thin_CMDlvconvert_merge_thinlvconvert_plain_CMDlvconvert_plainlvconvert_raid_types_CMDlvconvert_raid_typeslvconvert_repair_CMDlvconvert_repairlvconvert_replace_pv_CMDlvconvert_replace_pvlvconvert_split_cow_snapshotlvconvert_split_mirror_imageslvconvert_start_poll_CMDlvconvert_start_polllvconvert_swap_pool_metadatalvconvert_to_cachepool_CMDlvconvert_to_cachepoollvconvert_to_thinpool_CMDlvconvert_to_thinpoollvconvert_to_vdopool_CMDlvconvert_to_vdopoollvconvert_to_vdopool_paramlvconvert_to_writecache_CMDlvconvert_to_writecachelvcreate_and_attach_cachepoollvcreate_cachepool_CMDlvcreate_cachepoollvcreate_cow_snapshot_CMDlvcreate_cow_snapshotlvcreate_error_vol_CMDlvcreate_error_vollvcreate_linear_CMDlvcreate_linearlvcreate_mirror_CMDlvcreate_mirrorlvcreate_mirror_or_raid1_CMDlvcreate_mirror_or_raid1lvcreate_raid_any_CMDlvcreate_raid_anylvcreate_striped_CMDlvcreate_stripedlvcreate_thin_snapshot_CMDlvcreate_thin_snapshotlvcreate_thin_vol_CMDlvcreate_thin_vollvcreate_thinpool_CMDlvcreate_thinpoollvcreate_vdo_vol_CMDlvcreate_vdo_vollvcreate_zero_vol_CMDlvcreate_zero_vollvdisplay_general_CMDlvdisplay_generallvextend_by_policy_CMDlvextend_by_policylvextend_by_pv_CMDlvextend_by_pvlvextend_by_size_CMDlvextend_by_sizelvmchange_general_CMDlvmchange_generallvmconfig_general_CMDlvmconfig_generallvmdevices_check_CMDlvmdevices_checklvmdevices_edit_CMDlvmdevices_editlvmdevices_list_CMDlvmdevices_listlvmdevices_update_CMDlvmdevices_updatelvmdiskscan_general_CMDlvmdiskscan_generallvmsadc_general_CMDlvmsadc_generallvmsar_general_CMDlvmsar_generallvpoll_general_CMDlvpoll_generallvreduce_general_CMDlvreduce_generallvremove_general_CMDlvremove_generallvrename_lv_lv_CMDlvrename_lv_lvlvrename_vg_lv_lv_CMDlvrename_vg_lv_lvlvresize_by_pv_CMDlvresize_by_pvlvresize_by_size_CMDlvresize_by_sizelvs_general_CMDlvs_generallvscan_general_CMDlvscan_generalpvchange_properties_all_CMDpvchange_properties_allpvchange_properties_some_CMDpvchange_properties_somepvck_dump_CMDpvck_dumppvck_general_CMDpvck_generalpvck_repair_CMDpvck_repairpvck_repair_type_CMDpvck_repair_typepvcreate_general_CMDpvcreate_generalpvdata_general_CMDpvdata_generalpvdisplay_general_CMDpvdisplay_generalpvmove_any_CMDpvmove_anypvmove_one_CMDpvmove_onepvremove_general_CMDpvremove_generalpvresize_general_CMDpvresize_generalpvs_general_CMDpvs_generalpvscan_cache_CMDpvscan_cachepvscan_display_CMDpvscan_displaysegtypes_general_CMDsegtypes_generalsystemid_general_CMDsystemid_generaltags_general_CMDtags_generalversion_general_CMDversion_generalvgcfgbackup_general_CMDvgcfgbackup_generalvgcfgrestore_by_file_CMDvgcfgrestore_by_filevgcfgrestore_by_vg_CMDvgcfgrestore_by_vgvgcfgrestore_list_by_file_CMDvgcfgrestore_list_by_filevgcfgrestore_list_by_vg_CMDvgcfgrestore_list_by_vgvgchange_activate_CMDvgchange_activatevgchange_lockstart_CMDvgchange_lockstartvgchange_lockstop_CMDvgchange_lockstopvgchange_locktype_CMDvgchange_locktypevgchange_monitor_CMDvgchange_monitorvgchange_poll_CMDvgchange_pollvgchange_properties_CMDvgchange_propertiesvgchange_refresh_CMDvgchange_refreshvgchange_systemid_CMDvgchange_systemidvgck_general_CMDvgck_generalvgck_update_metadata_CMDvgck_update_metadatavgconvert_general_CMDvgconvert_generalvgcreate_general_CMDvgcreate_generalvgdisplay_general_CMDvgdisplay_generalvgexport_all_CMDvgexport_allvgexport_some_CMDvgexport_somevgextend_general_CMDvgextend_generalvgimport_all_CMDvgimport_allvgimport_some_CMDvgimport_somevgimportclone_general_CMDvgimportclone_generalvgimportdevices_all_CMDvgimportdevices_allvgimportdevices_some_CMDvgimportdevices_somevgmerge_general_CMDvgmerge_generalvgmknodes_general_CMDvgmknodes_generalvgreduce_all_CMDvgreduce_allvgreduce_by_pv_CMDvgreduce_by_pvvgreduce_missing_CMDvgreduce_missingvgremove_general_CMDvgremove_generalvgrename_by_name_CMDvgrename_by_namevgrename_by_uuid_CMDvgrename_by_uuidvgs_general_CMDvgs_generalvgscan_general_CMDvgscan_generalvgsplit_by_lv_CMDvgsplit_by_lvvgsplit_by_pv_CMDvgsplit_by_pvCMD_COUNTdevtypesdumpconfigformatsfullreportDisplay full reportDisplay help for commandslastlogChange logical volume layoutCreate a logical volumelvdisplayAdd space to a logical volumelvmchangelvmconfigManage the devices filelvmdiskscanlvmsadcCollect activity datalvmsarCreate activity reportlvpolllvreducelvrenameRename a logical volumeResize a logical volumelvscanpvchangepvckpvdatapvdisplaypvremovepvresizeResize physical volume(s)pvscanList all physical volumessegtypesList available segment typesvgcfgbackupvgcfgrestorevgchangevgckvgconvertCreate a volume groupvgdisplayvgexportvgextendvgimportvgimportcloneImport a VG from cloned PVsvgimportdevicesvgmergeMerge volume groupsvgmknodesvgreduceRemove volume group(s)vgrenameRename a volume groupvgsvgscanSearch for all volume groupsvgsplit%c%c _longcommand.cCannot find command %s.OO_OO:IO:OP:DESC:AUTOTYPE:FLAGS:RULE:ID:Failer to duplicate name %s.Failer to duplicate line %s.--uuidstr prev SECONDARY_SYNTAXPREVIOUS_SYNTAXParsing command defs: no mem.LV_lv_is_OO_ALL:OO_ALL %s ... -%c|%s (, [ --type %s ] (implied)[ --type %s|%s ] (implied) [ -l|--extents [ [ COMMON_OPTIONS ] Common options for lvm: Common options for command:Incorrect version format.dumpconfig.ccurrentdiffFailed to load profile %s.LVM configuration valid.LVM configuration invalid.profilableprofilable-commandprofilable-metadatalvchange.cdoes not Monitoring LV %sUnmonitoring LV %sPolling LV %score-logged disk-logged clustered Failed to clear %s %s for %s.intermediate%s device number not changed.Cannot deactivate %s.%s: reactivation failed.No settings changed.No --rebuild found!%s:y(inherited)Logical volume %s changed. and %u other snapshot(s)Failed to prepare message.lvconvert.cMergedConverted_mimagetmp_%dlayer name creation failed.Failed to insert resync layerSetting logging type to %s.No usable images left in %s.Logical volume %s converted.Cannot convert LV %s.Logical volume %s not split.Conversion aborted.WARNING: %s not zeroed.Merging of volume %s started.Volume %s replaced origin %s.-i-otransaction="%s_meta%%dManual repair required.Can't convert locked LV %s.pvmove_tmetaMetadata LV %s not found.Unknown pool metadata LV %s. and withWITHOUT and metadata volumesCreation of pool LV failed.Failed to lock pool LV %s.Converted %s to %s pool.%s_cvolLVM_VG_NAMEvg/lv string alloc failed.Device %s not found.PV %s not found in VG.%s_cache%s_cache%%dFailed to create cachevol LVLV %s is already in use.Cache pool %s not found.Thin pool %s not found.Cannot find cache %s.Cannot activate %s.Invalid writecache settings._wcorig/proc/meminfoMemTotal:%*s%llu%*sInvalid cachevol LV.LV %s could not be zeroed.LV does not have integrity.lvconvert_poll.cpmove_tmeta%s: %s: %s%%LV %s is not merged.lvcreate.c, %ORIGINmay not be negativemay not be zeroSetting logging type to %sUsing 2 stripes for %s.Using 3 stripes for %s.is unsupported with cacheis supported only with cacheis unsupported with snapshotsis unsupported with mirrorsis unsupported with raidsis supported only with raidsis unsupported with thinsis supported only with thinsis unsupported with VDOsSetting chunksize to %s.Failed to get tag.is only available with poolsskipped from activation auto activated inactive read-only origin %s%s%s%s%s%s%swith generated name as snapshot of Failed to remove new LV %s.Incompatible options selectedlvdisplay.cstub.hlvmcmdline.cOption %s %s.yesyyalnylFFRSpecified %%%s is unknown.Can't parse size argument.Size is too big (>=16EiB).Size may not be negative.Size may not be positive.Number may not be negative.Extents may not be negative.Extents may not be positive.wrRegion size may not be zero.pvsegpv_headerlabel_headerheadersmetadata_allmetadata_searchmetadata_areabackup_to_rawCorrect command syntax is:Command requires options: %s%s: no such command.%s - %s Unrecognised option %d (%c). -Option requires argument.Invalid argument for %s: %ssystem ID: %sLVM version: %sLibrary version: %sDriver version: %sConfiguration: %sInvalid devices file name.Invalid units specificationAvailable lvm commands:%-16.16s%sCouldn't copy command line.skiplvskipvgskipglLVM_LVMLOCKD_SOCKETTZ:/etc/localtimeVersion: %sParsing: %sIgnore opt %dProcessing command: %sCommand pid: %dSystem ID: %sO_DIRECT will be usedCompleted: %sstdin stream openstdin stream open: %s stdout stream openstderr stream open: %s %s: invalid file descriptor.LVM_OUT_FDLVM_ERR_FDLVM_REPORT_FD/proc/%u/cmdline/proc/self/fd/%u Parent PID %d: %s LVM_SUPPRESS_FD_WARNINGSRLIMIT_NOFILEgetrlimitToo many arguments: %squitexitlvm.staticinitrd-lvm/usr/sbin/lvmLVM_DID_EXECunsetenv-h-?kmgtpebslvmdevices.cFound PVID %s on %s.Devices file not enabled.Devices file does not exist.No device found for %s.Invalid PVID.Device not removed.No devices file entry for %s.Unknown device_id type. PART=%ddev_iter_create failedlvmdiskscan.c%-*s [%15s] %sCouldn't get size of "%s"LVM physical volume%d disk%s%d partition%s%d LVM physical volume%sMovedUnknown polling operation %slvpoll.cProvide LV namelvremove.clvrename.clvresize.cACTIVE OriginalSnapshot%s%s '%s%s/%s' [%s] %slvscan.cpolldaemon.cCan't find LV in %s for %s.Missing LV uuid within: %s/%safterpvchange.cChanging uuid of %s to %s.pvck.cCHECK: no mem for printing %swxFailed to create file %sid = seqno = description = creation_time = -- mda_header.magic wrappedprecommitlabel_header at %llulabel_header.idlabel_header.id %slabel_header.sector %llulabel_header.crc 0x%xlabel_header.offset %ulabel_header.typelabel_header.type %spv_header at %llupv_header.pv_uuidpv_header.pv_uuid %spv_header.device_size %llupv_header_extension at %llupv_header_extension.flags %umda_header_%d.checksum 0x%xmda_header_%d.magic 0x%smda_header_%d.version %umda_header_%d.start %llumda_header_%d.size %lluzero metadata copiesCHECK: second mda not foundNo mda location.metadata_offsetbackup_filemda_offsetmda2_offsetmda2_sizedevice_sizemda_numInvalid setting: %s %63[^=]=%63s %nInvalid setting at: %sWrite LVM header to device? Skip writing in test mode.Write new LVM header to %s? Failed to write new headerInvalid metadata file.Failed to write new mda textNo lvm label found on device.No mda1 offset found.No mda2 offset found.# GeneratedCannot open file: %sCannot access file: %sEmpty file: %sCannot read file: %sFailed to set up device %s.Cannot use %s: %s.Cannot access %s.Unknown dump value.Unknown repair value.pvcreate.cpvdisplay.cpvmove.cCan't find sub LV %s.Can't find PVs for sub LV %s.pvmove%dSkipping locked LV %s.Logical volume %s not found.No data to move for %s.Failed to find an LV name.Failed to allocate lvid.Failed to clone LV name.pvmove_poll.cRemoving temporary pvmove LVpvremove.cpvresize.cpvscan.c%-*s with UUID %sInvalid PV name with uuid.PV %-*s %-*s %s [%s]of exported volume group(s)in no volume groupUnlink pvs_lookup: %sRemove pv online devno %d:%dUnlink pv online %sDid not create %s: %dwrite_lookup_file %signore lookup file line %sWARNING: Failed to open %s.pvscan autoactivating VG %s.%s: autoactivation failed.VG %s skip autoactivation.VG %s run autoactivation.autoactivate quickautoactivate slow/dev/disk/lvm-pv-uuiddm-uuidwwn-online_devs %s %signore %s with no lvm info.pvscan[%d] PV %s not used.PV %s has no VG metadata.PV %s not found in VG %s.PV %s missing device size.ignore md component %s.PV %s ignore shared VG.PV %s ignore foreign VG.PV %s ignore exported VG.pvscan[%d] PV %s online.VG %s complete after recheck.PV %s online, VG unknown.VG unknownVG %s finishedLVM_VG_NAME_COMPLETE='%s' VG %s completeLVM_VG_NAME_INCOMPLETE='%s' VG %s incompleteFailed to find LVs using %s.LV %s completeFailed to check partial lvs.LV %s incompletemissing device idpvscan[%d] %s excluded: %s./dev/sda/dev/vdaLVM_EVENT_ACTIVATION=0No VGs to autoactivate.reporter.c in VG subreport_optionsInvalid options string: %s%s: unknown report format.Failed to create log report.No log report stored.toollib.cfork failed: %sredirect(lvm2)unknown Skipping volume group %sAllocation of vg_name failed.lock_type %s is invalidSetting lock_type to %s%s pool zeroing.Setting pool discards to %s.Using default stripesize %s.use_Unknown VDO setting "%s".Interrupted.Failed to find device "%s".successdev_iter creation failed.strlist allocation failed.Skipping invalid tag: %sInvalid volume group name %s.Selection failed for VG %s.Selection failed for LV %s.Selection failed for PV %s.Processing VG %s %sRunning command for VG %s %sProcessing each VGNo volume groups found.%s Processing LV %s in VG %s.positiondevice_id_list alloc failed.Cannot use %s: %sProcessing device %s.Skipping PV %s in VG %s.Processing PV %s in VG %s.Processing PVs in VG %sProcessing each PVCan't get device size of %s.No PV found on device %s.Checking %s to confirm %.32s.Check confirm arg %s no info.strdup failed.No devices to process.Failed to rescan devs exclCannot read orphans VG %s.alloc pvl failed.Using existing orphan PV %s.Failed to find PV %sCreating a new PV on %s.Zeroing start of device %s.%s not wiped: aborting.%s: command failed for %s.Failed to allocate filename.vgcfgbackup.cvgcfgrestore.cNo devices found.Restore aborted.Restore failed.Restored volume group %s.vgchange.cDeaVG %s is incomplete.Refreshing volume group "%s"(no profile)Unable to set system ID. for VG No volume groups changed.Failed to deativate %s.VG lock type not changed.No global lock for lock startautonowaitFailed to write VG.vgck.cFailed to commit VG.vgcreate.cFailed to get tag with system ID Failed to start locking--- Physical volumes ---vgdisplay.cvgexport.cvgextend.cNo PV has been restored.Volume group %s not changedvgimport.cvgimportclone.cVG is missing a device.Failed to find device %s.scan new devsDevice %s is excluded: %s.No VG found on devices.get other devicesscan other devicesBase vg name %s is too long.%s1%s%uUsing new VG name %s.import vg on new devicesCan't get lock for VG name %sFailed to write devices file.vgimportdevices.cNo devices to add.vgmerge.cChanged LVID for %s to %svgmknodes.cvgreduce.cvgremove.cVolume group "%s" not removedCan't get lock for %svgrename.cRenaming "%s" to "%s"Test mode: Skipping rename.Renaming "%s" to "%s" failedexported vgscan.cvgsplit.cPhysical Volume %s not foundInvalid vg name %s.Failed to create new VG %s.Failed to read VG %s.ExistingNewHandle initialisation failed.lvmcmdlib.cCmdline copy failed.No command supplied_memlock_inc_memlock_dec_dmeventd_thin_command_dmeventd_vdo_commandconfig-util.c%.*s= %ld %.*s= "%s" %b%.*s%sFailed to duplicate node key.%tdaemon-client.cconnectSending daemon %s: helloDaemon %s returned error %dprotocoldaemon_openrequest = %sdaemon_closerequest ## reloadremove_alldepswaiteventclearsetgeometryarmpolltarget-version%u %255s %s: No entry for %s found/proc/devices/proc/misc%s: Wrong inode typeCreating device %s (%u, %u)mknod_control_fdcontrol(compat)(unknown version)Unknown add node parameterUuid "%s" too longnew UUIDhex%s %s %s %sreload %u:%u diff type %s %sreload params1 %sreload params2 %s) key setDM_DEVICE_REMOVEDM_DEVICE_RENAMEDM_DEVICE_RESUMEenablechecks ima_measurement securedata deferredremove retryremove skiplockfs readonly noflush noopencount UUID DM_DEFAULT_NAME_MANGLING_MODEDM_DEBUG_WITH_LINE_NUMBERS%s:%d device_mapper/libdm-common.c1.02.185 (2022-05-18)Couldn't create path for %s#+-.:=@_\x5cx\x%02x%2x%sName "%s" too long.Device %s not found%s/../%sName "%s" too longSELinux context resetsetfscreateconlsetfilecon%s: mknod for %s failed: %schownCreated %sRemoved %sRenamed %s to %sFailed to build sysfs_path.%s (%d:%d): read ahead is %uBLKRAGET%s: read ahead is %uFailed to build size in kB.BLKRASET [trust_udev] [verify_udev]%s: %s NODE_DEL%s%s%s: %s NODE_RENAME to %s%s%sUnstackingStackingProcessingSkippingNew uuid prefix %s too long.%*u %*u %u:%u %4096s %4096s%sdev/block/%u:%u/dm/name%s/block/bdiqueueuremovableslavetraceuevent%sblock/%s/%s/dev%sdev/block/%u:%u%sdev/block/%u:%u/holders%sfs%sfs/%s/%sFailed to get driver versionDM udev checking enabledDM udev checking disabledsemid %d: semctl failed: %sCREATERELOADREMOVE_ALLINFODEPSWAITEVENTLISTCLEARMKNODESLIST_VERSIONSTARGET_MSGSET_GEOMETRY SUBSYSTEM_7 SUBSYSTEM_6 SUBSYSTEM_5 SUBSYSTEM_4 SUBSYSTEM_3 SUBSYSTEM_2 SUBSYSTEM_1 SUBSYSTEM_0 PRIMARY_SOURCE DISABLE_LIBRARY_FALLBACK LOW_PRIORITY DISABLE_OTHER_RULES DISABLE_DISK_RULES DISABLE_SUBSYSTEM_RULES DISABLE_DM_RULESdevice_mapper/libdm-config.c%f0%lo%s}[%s,%sconfig_outputFailed to allocate valueFailed to allocate type valueFailed to read int token.Failed to read float token.Failed to duplicate token.truefalseFailed to clone config value.Failed to clone config node.Failed to create config node.Failed to allocate dtree.device_mapper/libdm-deptree.cdtree hash creation faileddtree link allocation failedMatched uuid %s in deptree.name pool_strdup failedis used by another deviceconstains a filesystem in useDevice %s (%u:%u) %s.Removing %s (%u:%u)Renaming %s (%u:%u) to %sResuming %s (%u:%u). with device flush with filesystem syncSuspending %s (%u:%u)%s%sFailed to set major minor.no targetParsing VDO status: %screate_snap %u %ucreate_thin %udelete %uset_transaction_id %lu %lureserve_metadata_snaprelease_metadata_snapNode %s is missing a segment. which needs check first with read only metadata in failed statecompression oncompression offindex-enableindex-disableUUID "%s" does not match.Unable to suspend %s (%u:%u)Unable to resume %s.Creating %sFailed to set uuid for %s%s%s %luclustered-userspace %u %s clustered-%s%s %u nosync 1 handle_errors%s %d %u rebuild %u min_recovery_rate %u max_recovery_rate %u write_mostly %u max_write_behind %u region_size %u raid10_copies %u delta_disks %d data_offset %d metadata2 passthrough writeback writethrough migration_threshold %u %s %lu%s %s %s %u %d high_watermark %llu low_watermark %llu writeback_jobs %llu autocommit_blocks %llu autocommit_time %llu fua nofua cleaner max_age %u meta_device:%s recalculate journal_sectors:%u ineterleave_sectors:%u buffer_sectors:%u journal_watermark:%u commit_time:%u bitmap_flush_interval:%u sectors_per_bit:%llu read_only error_if_no_space no_discard_passdown ignore_discard skip_block_zeroing%s %s %d %lu %d%s%s%s%s%s/dev/dm-%u%s %d%s%s %s %c %d%u %u %s%s%s%s%s %s %lu Loading table for %s. (Ignoring.)Dropping callback for %s.Reverting %s.Unable to deactivate %s.log uuid pool_strdup failedUnsupported raid type %s.Missing cache's data uuid %s.No integrity meta uuid.Node %s has segment type %s.Missing metadata uuid %s.Ignoring %lu of device.Missing pool uuid %s.Unsupported message type %d.Missing thin pool uuid %s.Couldn't find area uuid %s.Missing VDO's data uuid %s.device_mapper/libdm-file.cCreating directory "%s"process is already running=~!~!=>=<=sinceuntil&&All fields must match||At least one field must matchLogical negationLeft parenthesisRight parenthesisList startList endList subset startList subset endSpecialspecial_Show help.device_mapper/libdm-report.cstring list%s Fields%*.*s %sall%-*s - %sAll fields in this section.unselectable %-*s - %s%s%s%s%s%s: field name too long.Unrecognised field: %.*sdm_report_init: malloc failedUnsupported selection typeMissing end quote.type-specificfield-specificSpecified month out of range.Specified day out of range.Specified hours out of range.Selection operandsReserved values %-*s - %s [%s]Selection operators------------------- Comparison operators: %6s - %s %4s - %sExpecting field nameMissing value after operatorreport selectionExpecting logical operator%-*.*s\": [report_groupdevice_mapper/libdm-string.cFailed to duplicate lvm name.Missing lvm name for split.:@0%s%s%.*f%s Exabyte EB Petabyte PB Terabyte TB Gigabyte GB Megabyte MB Kilobyte Byte B Exbibyte EiB Pebibyte PiB Tebibyte TiB Gibibyte GiB Mebibyte MiB Kibibyte KiB kB B Units UnU Sectors Sedevice_mapper/libdm-targets.c%lu/%lu %luInvalidMerge failedOverflow<#devs> %s %u %s %lu/%luErrorFailwritethrough writeback passthrough metadata2 no_discard_passdown Unknown feature in status: %s%d ro needs_check%llu %llu %llu %llu%llu %llu %s%lu %lu/%lu %lu/%lu%nout_of_data_spacero Allocation of devs failed.%u:%u %nuserspaceAllocation of logs failed.get_timestampclock_gettimedevice_mapper/mm/pool-fast.cdevice_mapper/mm/pool.c [%p] %sPool %s is locked.Pool %s is unlocked.device_mapper/regex/matcher.c(.*(%s)%c)Couldn't parse regexregex fingerprintIncomplete rangespecificationBadly formed 'or' expressionParse error in regexRegex optimisation errordevice_mapper/regex/ttree.ccouldn't get token for '%s'couldn't parse '%s'out of memorycouldn't get token for deviceoperating modeindex statecompression stateused blockstotal blockstoo many tokensbase/data-struct/hash.cbase/data-struct/list.chead->nhead1->nn4 != NULLn16 != NULLn48 != NULLduplicate entry (n48) %u value in UNSET (n48) unknown value type: %u shouldn't get here values[i].type != UNSETjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-pvmovesnapshot_cdata_cmeta_corig_cpool_cvol_wcorig_mimage_mlog_rimage_rmeta_tdata_tmeta_vdata_imeta_iorig_pmspare_voriginD-Bus notification failedraid0raid0_metaraid1raid10 raid10_near raid4@raid5raid5_nraid5_laraid5_lsraid5_raraid5_rsraid6@raid6_n_6raid6_ncraid6_nr raid6_zr@raid6_ls_6raid6_rs_6raid6_la_6raid6_ra_601noyesunknown'*  ''''''''' !!" !##$ #%#&#' '( () )* *+,/)0)1)2)3)4)5)6)7)8)9):) '9gyGkvthin-poolthinglobal/thin_disabled_features0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ!#Ru%PRELOADACTIVATEDEACTIVATESUSPENDSUSPEND_WITH_LOCKFSCLEANMRTR[RpRRT UU)U>U\^ ^]](]_free_vg_busy_vgkvdoglobal/vdo_disabled_features*OO_ALL: --commandprofile String, --config String, --debug, --driverloaded Bool, --help, --nolocking, --lockopt String, --longhelp, --profile String, --quiet, --verbose, --version, --yes, --test, --devicesfile String, --devices PV, --nohints --journal String OO_REPORT: --aligned, --all, --binary, --configreport ConfigReport, --foreign, --ignorelockingfailure, --logonly, --nameprefixes, --noheadings, --nosuffix, --options String, --readonly, --reportformat ReportFmt, --rows, --select String, --separator String, --shared, --sort String, --unbuffered, --units Units, --unquoted OO_CONFIG: --atversion String, --typeconfig ConfigType, --file String, --ignoreadvanced, --ignoreunsupported, --ignorelocal, --list, --mergedconfig, --metadataprofile String, --sinceversion String, --showdeprecated, --showunsupported, --validate, --withsummary, --withcomments, --withgeneralpreamble, --withlocalpreamble, --withspaces, --unconfigured, --withversions OO_LVCHANGE: --autobackup Bool, --force, --ignoremonitoring, --noudevsync, --reportformat ReportFmt, --select String OO_LVCHANGE_META: --addtag Tag, --deltag Tag, --alloc Alloc, --contiguous Bool, --compression Bool, --deduplication Bool, --detachprofile, --metadataprofile String, --profile String, --permission Permission, --readahead Readahead, --setactivationskip Bool, --setautoactivation Bool, --errorwhenfull Bool, --discards Discards, --zero Bool, --cachemode CacheMode, --cachepolicy String, --cachesettings String, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, --vdosettings String, --writebehind Number, --writemostly WriteMostlyPV, --persistent n lvchange OO_LVCHANGE_META VG|LV|Tag|Select ... OO: --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_properties DESC: Change a general LV attribute. DESC: For options listed in parentheses, any one is DESC: required, after which the others are optional. RULE: all not lv_is_pvmove lv_is_mirror_log lv_is_mirror_image RULE: all and lv_is_vg_writable RULE: --contiguous not --alloc RULE: --profile not --detachprofile RULE: --metadataprofile not --detachprofile RULE: --minrecoveryrate --maxrecoveryrate and LV_raid RULE: --writebehind --writemostly and LV_raid1 RULE: --cachemode --cachepolicy --cachesettings and LV_cache LV_cachepool LV_writecache RULE: --errorwhenfull --discards --zero and LV_thinpool RULE: --permission not lv_is_external_origin lv_is_raid_metadata lv_is_raid_image LV_thinpool RULE: --alloc --contiguous --metadataprofile --persistent --profile --readahead not lv_is_thick_origin RULE: --alloc --discards --zero --cachemode --cachepolicy --cachesettings not lv_is_partial lvchange --resync VG|LV_raid_mirror|Tag|Select ... OO: --activate Active, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_resync DESC: Resyncronize a mirror or raid LV. DESC: Use to reset 'R' attribute on a not initially synchronized LV. RULE: all not lv_is_pvmove lv_is_locked lv_is_raid_with_integrity RULE: all not LV_raid0 lvchange --syncaction SyncAction VG|LV_raid|Tag|Select ... OO: OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_syncaction DESC: Resynchronize or check a raid LV. RULE: all not LV_raid0 lvchange --rebuild PV VG|LV_raid|Tag|Select ... OO: OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_rebuild DESC: Reconstruct data on specific PVs of a raid LV. RULE: all not LV_raid0 lvchange --activate Active VG|LV|Tag|Select ... OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool, --ignoreactivationskip, --ignorelockingfailure, --sysinit, --readonly, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_activate DESC: Activate or deactivate an LV. lvchange --refresh VG|LV|Tag|Select ... OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_refresh DESC: Reactivate an LV using the latest metadata. lvchange --monitor Bool VG|LV|Tag|Select ... OO: OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_monitor DESC: Start or stop monitoring an LV from dmeventd. RULE: all not lv_is_pvmove lvchange --poll Bool VG|LV|Tag|Select ... OO: --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_poll DESC: Start or stop processing an LV conversion. lvchange --persistent y --minor Number LV OO: --major Number, --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_persistent DESC: Make the minor device number persistent for an LV. RULE: all not LV_thinpool LV_cachepool LV_vdopool OO_LVCONVERT_POOL: --poolmetadata LV, --poolmetadatasize SizeMB, --poolmetadataspare Bool, --readahead Readahead, --chunksize SizeKB, --zero Bool, --metadataprofile String OO_LVCONVERT_THINPOOL: --discards Discards, --errorwhenfull Bool OO_LVCONVERT_CACHE: --cachemetadataformat CacheMetadataFormat, --cachemode CacheMode, --cachepolicy String, --cachesettings String, --zero Bool OO_LVCONVERT_VDO: --metadataprofile String, --readahead Readahead, --compression Bool, --deduplication Bool, --vdosettings String, --zero Bool OO_LVCONVERT: --alloc Alloc, --background, --force, --noudevsync lvconvert --type linear LV OO: OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to linear. RULE: all not lv_is_locked lv_is_pvmove lvconvert --type striped LV OO: --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to striped. RULE: all not lv_is_locked lv_is_pvmove lvconvert --type mirror LV OO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to type mirror (also see type raid1), RULE: all not lv_is_locked lv_is_pvmove lvconvert --type raid LV OO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to raid or change raid layout DESC: (a specific raid level must be used, e.g. raid1). RULE: all not lv_is_locked lv_is_pvmove RULE: lv_is_raid_with_integrity not --stripes_long --stripesize --regionsize --interval lvconvert --mirrors SNumber LV OO: --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to raid1 or mirror, or change number of mirror images. RULE: all not lv_is_locked lv_is_pvmove lvconvert --stripes_long Number LV_raid OO: OO_LVCONVERT, --interval Number, --regionsize RegionSize, --stripesize SizeKB OP: PV ... ID: lvconvert_raid_types DESC: Convert raid LV to change number of stripe images. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity RULE: all not LV_raid0 LV_raid1 lvconvert --stripesize SizeKB LV_raid OO: OO_LVCONVERT, --interval Number, --regionsize RegionSize ID: lvconvert_raid_types DESC: Convert raid LV to change the stripe size. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity RULE: all not LV_raid0 LV_raid1 lvconvert --regionsize RegionSize LV_raid OO: OO_LVCONVERT ID: lvconvert_change_region_size DESC: Change the region size of an LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity RULE: all not LV_raid0 FLAGS: SECONDARY_SYNTAX lvconvert --splitmirrors Number --name LV_new LV_raid1_mirror_cache OO: OO_LVCONVERT OP: PV ... ID: lvconvert_split_mirror_images DESC: Split images from a raid1 or mirror LV and use them to create a new LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity lvconvert --splitmirrors Number --trackchanges LV_raid1_cache OO: OO_LVCONVERT OP: PV ... ID: lvconvert_split_mirror_images DESC: Split images from a raid1 LV and track changes to origin for later merge. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity lvconvert --mergemirrors LV_linear_raid|VG|Tag ... OO: OO_LVCONVERT ID: lvconvert_merge_mirror_images DESC: Merge LV images that were split from a raid1 LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow lv_is_raid_with_integrity lvconvert --mirrorlog MirrorLog LV_mirror OO: OO_LVCONVERT OP: PV ... ID: lvconvert_change_mirrorlog DESC: Change the type of mirror log used by a mirror LV. RULE: all not lv_is_locked lv_is_pvmove FLAGS: SECONDARY_SYNTAX lvconvert --type thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zero OO: --thin, --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_thin_with_external DESC: Convert LV to a thin LV, using the original LV as an external origin. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zero OO: --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_thin_with_external DESC: Convert LV to a thin LV, using the original LV as an external origin. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --type cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata OO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_cache_with_cachepool DESC: Attach a cache pool to an LV, converts the LV to type cache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata OO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_cache_with_cachepool DESC: Attach a cache pool to an LV. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long FLAGS: SECONDARY_SYNTAX AUTOTYPE: cache lvconvert --type writecache --cachevol LV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT, --cachesettings String ID: lvconvert_to_writecache DESC: Attach a writecache to an LV, converts the LV to type writecache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity lvconvert --type cache --cachevol LV LV_linear_striped_raid_thinpool OO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKB ID: lvconvert_to_cache_with_cachevol DESC: Attach a cache to an LV, converts the LV to type cache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity lvconvert --cache --cachevol LV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKB ID: lvconvert_to_cache_with_cachevol DESC: Attach a cache to an LV, converts the LV to type cache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity FLAGS: SECONDARY_SYNTAX lvconvert --type writecache --cachedevice PV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings String ID: lvconvert_to_writecache_with_device DESC: Add a writecache to an LV, using a specified cache device. RULE: all and lv_is_visible lvconvert --type cache --cachedevice PV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings String, --chunksize SizeKB ID: lvconvert_to_cache_with_device DESC: Add a cache to an LV, using a specified cache device. RULE: all and lv_is_visible lvconvert --type thin-pool LV_linear_striped_raid_cache_writecache_error_zero OO: --stripes_long Number, --stripesize SizeKB, OO_LVCONVERT_THINPOOL, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_thinpool DESC: Convert LV to type thin-pool. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --thinpool LV_linear_striped_raid_cache_writecache_thinpool OO: --stripes_long Number, --stripesize SizeKB, OO_LVCONVERT_THINPOOL, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_thinpool_or_swap_metadata DESC: Convert LV to type thin-pool (variant, use --type thin-pool). DESC: Swap metadata LV in a thin pool (variant, use --swapmetadata). FLAGS: PREVIOUS_SYNTAX RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long AUTOTYPE: thin-pool lvconvert --type cache-pool LV_linear_striped_raid OO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_cachepool DESC: Convert LV to type cache-pool. RULE: --poolmetadata not --readahead --stripesize --stripes_long RULE: all not lv_is_raid_with_integrity lvconvert --cachepool LV_linear_striped_raid_cachepool_error_zero OO: --type cache-pool, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_cachepool_or_swap_metadata DESC: Convert LV to type cache-pool (variant, use --type cache-pool). DESC: Swap metadata LV in a cache pool (variant, use --swapmetadata). FLAGS: PREVIOUS_SYNTAX RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --type vdo-pool LV_linear_striped_raid_cache OO: --name LV_new, --virtualsize SizeMB, OO_LVCONVERT_VDO, OO_LVCONVERT ID: lvconvert_to_vdopool DESC: Convert LV to type vdopool. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrity lvconvert --vdopool LV_linear_striped_raid_cache OO: OO_LVCONVERT_VDO, OO_LVCONVERT, --name LV_new, --virtualsize SizeMB, ID: lvconvert_to_vdopool_param DESC: Convert LV to type vdopool. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrity FLAGS: SECONDARY_SYNTAX AUTOTYPE: vdo-pool lvconvert --splitcache LV_cachepool_cache_thinpool_vdopool_writecache OO: OO_LVCONVERT, --cachesettings String ID: lvconvert_split_and_keep_cache DESC: Detach a cache from an LV. lvconvert --uncache LV_cache_thinpool_vdopool_writecache OO: OO_LVCONVERT, --cachesettings String ID: lvconvert_split_and_remove_cache DESC: Detach and delete a cache from an LV. FLAGS: SECONDARY_SYNTAX lvconvert --swapmetadata --poolmetadata LV LV_thinpool_cachepool OO: --chunksize SizeKB, OO_LVCONVERT ID: lvconvert_swap_pool_metadata DESC: Swap metadata LV in a thin pool or cache pool (for repair only). FLAGS: SECONDARY_SYNTAX lvconvert --merge LV_linear_striped_raid_thin_snapshot|VG|Tag ... OO: --background, --interval Number, OO_LVCONVERT ID: lvconvert_merge DESC: Merge LV that was split from a mirror (variant, use --mergemirrors). DESC: Merge thin LV into its origin LV (variant, use --mergethin). DESC: Merge COW snapshot LV into its origin (variant, use --mergesnapshot). RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow FLAGS: SECONDARY_SYNTAX lvconvert --mergethin LV_thin ... OO: OO_LVCONVERT ID: lvconvert_merge_thin DESC: Merge thin LV into its origin LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow RULE: all and lv_is_visible lvconvert --mergesnapshot LV_snapshot ... OO: --background, --interval Number, OO_LVCONVERT ID: lvconvert_merge_snapshot DESC: Merge COW snapshot LV into its origin. RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow RULE: all and lv_is_visible lvconvert --splitsnapshot LV_snapshot OO: OO_LVCONVERT ID: lvconvert_split_cow_snapshot DESC: Separate a COW snapshot from its origin LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_origin lv_is_external_origin lv_is_merging_cow FLAGS: SECONDARY_SYNTAX lvconvert --type snapshot LV LV_linear_striped OO: --snapshot, --chunksize SizeKB, --zero Bool, OO_LVCONVERT ID: lvconvert_combine_split_snapshot DESC: Combine a former COW snapshot (second arg) with a former DESC: origin LV (first arg) to reverse a splitsnapshot command. RULE: all not lv_is_locked lv_is_pvmove RULE: all and lv_is_visible lvconvert --snapshot LV LV_linear_striped OO: --chunksize SizeKB, --zero Bool, OO_LVCONVERT ID: lvconvert_combine_split_snapshot DESC: Combine a former COW snapshot (second arg) with a former DESC: origin LV (first arg) to reverse a splitsnapshot command. RULE: all not lv_is_locked lv_is_pvmove RULE: all and lv_is_visible FLAGS: SECONDARY_SYNTAX AUTOTYPE: snapshot lvconvert --repair LV_cache_cachepool_mirror_raid_thinpool OO: --usepolicies, --interval Number, --poolmetadataspare Bool, OO_LVCONVERT OP: PV ... ID: lvconvert_repair DESC: Replace failed PVs in a raid or mirror LV. DESC: Repair a thin pool. DESC: Repair a cache pool. RULE: all not lv_is_locked lv_is_pvmove RULE: --poolmetadataspare and LV_cache LV_cachepool LV_thinpool lvconvert --replace PV LV_raid OO: OO_LVCONVERT OP: PV ... ID: lvconvert_replace_pv DESC: Replace specific PV(s) in a raid LV with another PV. RULE: all not lv_is_locked lv_is_pvmove lvconvert --startpoll LV_mirror_raid OO: OO_LVCONVERT ID: lvconvert_start_poll DESC: Poll LV to continue conversion. RULE: all and lv_is_converting lvconvert LV_mirror_raid OO: OO_LVCONVERT ID: lvconvert_plain DESC: Poll LV to continue conversion (also see --startpoll) DESC: or waits till conversion/mirror syncing is finished FLAGS: SECONDARY_SYNTAX lvconvert --raidintegrity Bool LV_raid OO: --raidintegritymode String, --raidintegrityblocksize Number, OO_LVCONVERT OP: PV ... ID: lvconvert_integrity DESC: Add or remove data integrity checksums to raid images. OO_LVCREATE: --addtag Tag, --alloc Alloc, --autobackup Bool, --activate Active, --contiguous Bool, --ignoreactivationskip, --ignoremonitoring, --major Number, --metadataprofile String, --minor Number, --monitor Bool, --name String, --nosync, --noudevsync, --permission Permission, --persistent Bool, --readahead Readahead, --reportformat ReportFmt, --setactivationskip Bool, --wipesignatures Bool, --zero Bool, --setautoactivation Bool OO_LVCREATE_CACHE: --cachemode CacheMode, --cachepolicy String, --cachesettings String, --chunksize SizeKB, --cachemetadataformat CacheMetadataFormat OO_LVCREATE_POOL: --poolmetadatasize SizeMB, --poolmetadataspare Bool, --chunksize SizeKB OO_LVCREATE_THINPOOL: --discards Discards, --errorwhenfull Bool OO_LVCREATE_VDO: --compression Bool, --deduplication Bool, --vdosettings String lvcreate --type error --size SizeMB VG OO: OO_LVCREATE ID: lvcreate_error_vol DESC: Create an LV that returns errors when used. FLAGS: SECONDARY_SYNTAX lvcreate --type zero --size SizeMB VG OO: OO_LVCREATE ID: lvcreate_zero_vol DESC: Create an LV that returns zeros when read. FLAGS: SECONDARY_SYNTAX lvcreate --type linear --size SizeMB VG OO: OO_LVCREATE OP: PV ... IO: --mirrors 0, --stripes 1 ID: lvcreate_linear DESC: Create a linear LV. FLAGS: SECONDARY_SYNTAX lvcreate --size SizeMB VG OO: OO_LVCREATE OP: PV ... IO: --mirrors 0, --stripes 1 ID: lvcreate_linear DESC: Create a linear LV. AUTOTYPE: linear lvcreate --type striped --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_striped DESC: Create a striped LV (also see lvcreate --stripes). FLAGS: SECONDARY_SYNTAX lvcreate --stripes Number --size SizeMB VG OO: --stripesize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_striped DESC: Create a striped LV. AUTOTYPE: striped lvcreate --type mirror --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --mirrors PNumber, --mirrorlog MirrorLog, --regionsize RegionSize, OO_LVCREATE OP: PV ... ID: lvcreate_mirror DESC: Create a mirror LV (also see --type raid1). FLAGS: SECONDARY_SYNTAX lvcreate --mirrors PNumber --size SizeMB VG OO: --stripesize SizeKB, --mirrorlog MirrorLog, --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, OO_LVCREATE OP: PV ... IO: --stripes 1 ID: lvcreate_mirror_or_raid1 DESC: Create a raid1 or mirror LV. AUTOTYPE: raid1 AUTOTYPE: mirror lvcreate --type raid --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --mirrors PNumber, --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, --raidintegrity Bool, --raidintegritymode String, --raidintegrityblocksize Number, OO_LVCREATE OP: PV ... ID: lvcreate_raid_any DESC: Create a raid LV (a specific raid level must be used, e.g. raid1). lvcreate --mirrors PNumber --stripes Number --size SizeMB VG OO: --stripesize SizeKB, --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_raid_any DESC: Create a raid10 LV. AUTOTYPE: raid10 lvcreate --type snapshot --size SizeMB LV OO: --snapshot, --stripes Number, --stripesize SizeKB, --chunksize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_cow_snapshot DESC: Create a COW snapshot LV of an origin LV DESC: (also see --snapshot). FLAGS: SECONDARY_SYNTAX lvcreate --snapshot --size SizeMB LV OO: --stripes Number, --stripesize SizeKB, --chunksize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_cow_snapshot DESC: Create a COW snapshot LV of an origin LV. AUTOTYPE: snapshot lvcreate --type snapshot --size SizeMB --virtualsize SizeMB VG OO: --snapshot, --chunksize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_cow_snapshot_with_virtual_origin DESC: Create a sparse COW snapshot LV of a virtual origin LV DESC: (also see --snapshot). FLAGS: SECONDARY_SYNTAX lvcreate --type thin-pool --size SizeMB VG OO: --thinpool LV_new, --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thinpool DESC: Create a thin pool. lvcreate --thin --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thinpool DESC: Create a thin pool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin-pool lvcreate --size SizeMB --thinpool LV_new VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thinpool DESC: Create a thin pool named in --thinpool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin-pool lvcreate --type cache-pool --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_cachepool DESC: Create a cache pool. lvcreate --type cache-pool --size SizeMB --cachepool LV_new VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_cachepool DESC: Create a cache pool named by the --cachepool arg DESC: (variant, uses --cachepool in place of --name). FLAGS: SECONDARY_SYNTAX lvcreate --type thin --virtualsize SizeMB --thinpool LV_thinpool VG OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in a thin pool. FLAGS: SECONDARY_SYNTAX lvcreate --type thin --virtualsize SizeMB LV_thinpool OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in a thin pool named in the first arg DESC: (variant, also see --thinpool for naming pool). FLAGS: SECONDARY_SYNTAX lvcreate --virtualsize SizeMB --thinpool LV_thinpool VG OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in a thin pool. AUTOTYPE: thin lvcreate --virtualsize SizeMB LV_thinpool OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in the thin pool named in the first arg DESC: (also see --thinpool for naming pool.) FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --type thin LV_thin OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot DESC: Create a thin LV that is a snapshot of an existing thin LV. FLAGS: SECONDARY_SYNTAX lvcreate --thin LV_thin OO: OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot DESC: Create a thin LV that is a snapshot of an existing thin LV. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --snapshot LV_thin OO: OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot DESC: Create a thin LV that is a snapshot of an existing thin LV. AUTOTYPE: thin lvcreate --type thin --thinpool LV_thinpool LV OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot_of_external DESC: Create a thin LV that is a snapshot of an external origin LV. lvcreate --snapshot --thinpool LV_thinpool LV OO: OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot_of_external DESC: Create a thin LV that is a snapshot of an external origin LV. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --type vdo --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --vdo, --virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_vdo_vol DESC: Create a LV that returns VDO when used. lvcreate --vdo --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_vdo_vol DESC: Create a VDO LV with VDO pool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: vdo lvcreate --vdopool LV_new --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --virtualsize SizeMB, OO_LVCREATE_VDO, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_vdo_vol DESC: Create a VDO LV with VDO pool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: vdo lvcreate --type thin --virtualsize SizeMB --size SizeMB --thinpool LV_new VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named by the --thinpool arg. FLAGS: SECONDARY_SYNTAX lvcreate --virtualsize SizeMB --size SizeMB --thinpool LV_new VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named by --thinpool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --type thin --virtualsize SizeMB --size SizeMB LV_new|VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named in the first arg, DESC: or the new thin pool name is generated when the first DESC: arg is a VG name. FLAGS: SECONDARY_SYNTAX lvcreate --thin --virtualsize SizeMB --size SizeMB LV_new|VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named in the first arg, DESC: or the new thin pool name is generated when the first DESC: arg is a VG name. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --size SizeMB --virtualsize SizeMB VG OO: --stripes Number, --stripesize SizeKB, --snapshot, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_with_thinpool_or_sparse_snapshot DESC: Create a thin LV, first creating a thin pool for it. DESC: Create a sparse snapshot of a virtual origin LV DESC: Chooses type thin or snapshot according to DESC: config setting sparse_segtype_default. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin AUTOTYPE: snapshot lvcreate --type cache --size SizeMB --cachepool LV_cachepool VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachepool DESC: Create a new LV, then attach the specified cachepool DESC: which converts the new LV to type cache. lvcreate --size SizeMB --cachepool LV_cachepool VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachepool_v2 DESC: Create a new LV, then attach the specified cachepool DESC: which converts the new LV to type cache. FLAGS: SECONDARY_SYNTAX AUTOTYPE: cache lvcreate --type cache --size SizeMB LV_cachepool OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachepool_v3 DESC: Create a new LV, then attach the specified cachepool DESC: which converts the new LV to type cache. DESC: (variant, also use --cachepool). FLAGS: SECONDARY_SYNTAX lvcreate --cache --size SizeMB LV OO: OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE, --stripes Number, --stripesize SizeKB OP: PV ... ID: lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepool DESC: When the LV arg is a cachepool, then create a new LV and DESC: attach the cachepool arg to it. DESC: (variant, use --type cache and --cachepool.) DESC: When the LV arg is not a cachepool, then create a new cachepool DESC: and attach it to the LV arg (alternative, use lvconvert.) FLAGS: SECONDARY_SYNTAX AUTOTYPE: cache lvcreate --type cache --size SizeMB --cachevol LV VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_CACHE, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachevol_for_cache DESC: Create a new LV, then attach the specified cachevol DESC: which converts the new LV to type cache. lvcreate --type cache --size SizeMB --cachedevice PV VG OO: --stripes Number, --stripesize SizeKB, --cachesize SizeMB, OO_LVCREATE_CACHE, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachedevice_for_cache DESC: Create a new LV, then attach a cachevol created from DESC: the specified cache device, which converts the DESC: new LV to type cache. lvcreate --type writecache --size SizeMB --cachevol LV VG OO: OO_LVCREATE, --cachesettings String, --stripes Number, --stripesize SizeKB OP: PV ... ID: lvcreate_and_attach_cachevol_for_writecache DESC: Create a new LV, then attach the specified cachevol DESC: which converts the new LV to type writecache. lvcreate --type writecache --size SizeMB --cachedevice PV VG OO: OO_LVCREATE, --cachesize SizeMB, --cachesettings String, --stripes Number, --stripesize SizeKB OP: PV ... ID: lvcreate_and_attach_cachedevice_for_writecache DESC: Create a new LV, then attach a cachevol created from DESC: the specified cache device, which converts the DESC: new LV to type writecache. lvdisplay OO: --aligned, --all, --binary, --colon, --columns, --configreport ConfigReport, --foreign, --history, --ignorelockingfailure, --logonly, --maps, --noheadings, --nosuffix, --options String, --sort String, --readonly, --segments, --select String, --separator String, --shared, --unbuffered, --units Units OP: VG|LV|Tag ... IO: --partial, --ignoreskippedcluster, --reportformat ReportFmt ID: lvdisplay_general lvextend --size PSizeMB LV OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB, --type SegType OP: PV ... ID: lvextend_by_size DESC: Extend an LV by a specified size. lvextend LV PV ... OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --type SegType ID: lvextend_by_pv DESC: Extend an LV by specified PV extents. lvextend --poolmetadatasize PSizeMB LV_thinpool OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --stripes Number, --stripesize SizeKB, --type SegType OP: PV ... ID: lvextend_pool_metadata_by_size DESC: Extend a pool metadata SubLV by a specified size. lvextend --usepolicies LV_thinpool_snapshot OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --type SegType OP: PV ... ID: lvextend_by_policy DESC: Extend an LV according to a predefined policy. lvmconfig OO: OO_CONFIG OP: String ... ID: lvmconfig_general lvmdevices ID: lvmdevices_list DESC: Print devices in the devices file. lvmdevices --check ID: lvmdevices_check DESC: Check the devices file and report incorrect values. lvmdevices --update ID: lvmdevices_update DESC: Update the devices file to fix incorrect values. lvmdevices --adddev PV OO: --deviceidtype String ID: lvmdevices_edit DESC: Add a device to the devices file. lvmdevices --deldev PV|String OO: --deviceidtype String ID: lvmdevices_edit DESC: Remove a device from the devices file. lvmdevices --addpvid String OO: --deviceidtype String ID: lvmdevices_edit DESC: Find the device with the given PVID and add it to the devices file. lvmdevices --delpvid String ID: lvmdevices_edit DESC: Remove the devices file entry for the given PVID. lvreduce --size NSizeMB LV OO: --autobackup Bool, --force, --nofsck, --noudevsync, --reportformat ReportFmt, --resizefs ID: lvreduce_general lvremove VG|LV|Tag|Select ... OO: --autobackup Bool, --force, --nohistory, --noudevsync, --reportformat ReportFmt, --select String ID: lvremove_general lvrename VG LV LV_new OO: --autobackup Bool, --noudevsync, --reportformat ReportFmt ID: lvrename_vg_lv_lv lvrename LV LV_new OO: --autobackup Bool, --noudevsync, --reportformat ReportFmt ID: lvrename_lv_lv lvresize --size SSizeMB LV OO: --alloc Alloc, --autobackup Bool, --force, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB, --type SegType OP: PV ... ID: lvresize_by_size DESC: Resize an LV by a specified size. lvresize LV PV ... OO: --alloc Alloc, --autobackup Bool, --force, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --type SegType ID: lvresize_by_pv DESC: Resize an LV by specified PV extents. lvresize --poolmetadatasize PSizeMB LV_thinpool OO: --alloc Alloc, --autobackup Bool, --force, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --stripes Number, --stripesize SizeKB, --type SegType OP: PV ... ID: lvresize_pool_metadata_by_size DESC: Resize a pool metadata SubLV by a specified size. lvs OO: --history, --segments, OO_REPORT OP: VG|LV|Tag ... IO: --partial, --ignoreskippedcluster, --trustcache ID: lvs_general lvscan OO: --all, --blockdevice, --ignorelockingfailure, --readonly, --reportformat ReportFmt IO: --partial, --cache_long ID: lvscan_general OO_PVCHANGE: --autobackup Bool, --force, --reportformat ReportFmt, --uuid OO_PVCHANGE_META: --allocatable Bool, --addtag Tag, --deltag Tag, --uuid, --metadataignore Bool pvchange --all OO_PVCHANGE_META OO: OO_PVCHANGE IO: --ignoreskippedcluster ID: pvchange_properties_all DESC: Change properties of all PVs. pvchange OO_PVCHANGE_META PV|Select ... OO: --select String, OO_PVCHANGE IO: --ignoreskippedcluster ID: pvchange_properties_some DESC: Change properties of specified PVs. pvresize PV ... OO: --setphysicalvolumesize SizeMB, --reportformat ReportFmt ID: pvresize_general pvck PV ... OO: --labelsector Number ID: pvck_general DESC: Check for metadata on a device pvck --dump DumpType PV OO: --settings String, --file String, --pvmetadatacopies MetadataCopiesPV, --labelsector Number ID: pvck_dump DESC: Check and print LVM headers and metadata on a device pvck --repairtype RepairType PV OO: --settings String, --file String, --labelsector Number ID: pvck_repair_type DESC: Repair LVM headers or metadata on a device pvck --repair --file String PV OO: --settings String, --labelsector Number ID: pvck_repair DESC: Repair LVM headers and metadata on a device pvcreate PV ... OO: --dataalignment SizeKB, --dataalignmentoffset SizeKB, --bootloaderareasize SizeMB, --force, --labelsector Number, --metadatatype MetadataType, --pvmetadatacopies MetadataCopiesPV, --metadatasize SizeMB, --metadataignore Bool, --norestorefile, --setphysicalvolumesize SizeMB, --reportformat ReportFmt, --restorefile String, --uuidstr String, --zero Bool ID: pvcreate_general RULE: --norestorefile not --restorefile RULE: --bootloaderareasize not --restorefile pvdisplay OO: --aligned, --all, --binary, --colon, --columns, --configreport ConfigReport, --foreign, --ignorelockingfailure, --logonly, --maps, --noheadings, --nosuffix, --options String, --readonly, --select String, --separator String, --shared, --short, --sort String, --unbuffered, --units Units OP: PV|Tag ... IO: --ignoreskippedcluster, --reportformat ReportFmt ID: pvdisplay_general pvmove PV OO: --abort, --alloc Alloc, --atomic, --autobackup Bool, --background, --interval Number, --name LV, --noudevsync, --reportformat ReportFmt OP: PV ... ID: pvmove_one DESC: Move PV extents. pvmove OO: --abort, --background, --interval Number ID: pvmove_any DESC: Continue or abort existing pvmove operations. pvremove PV ... OO: --force, --reportformat ReportFmt ID: pvremove_general pvs OO: --segments, OO_REPORT OP: PV|Tag ... IO: --partial, --ignoreskippedcluster, --trustcache ID: pvs_general pvscan OO: --ignorelockingfailure, --reportformat ReportFmt, --exported, --novolumegroup, --short, --uuid ID: pvscan_display DESC: Display PV information. pvscan --cache_long OO: --ignorelockingfailure, --reportformat ReportFmt, --major Number, --minor Number, --noudevsync OP: PV|String ... IO: --background ID: pvscan_cache DESC: Record that a PV is online or offline. pvscan --cache_long --activate ay OO: --ignorelockingfailure, --reportformat ReportFmt, --major Number, --minor Number, --noudevsync, --autoactivation String OP: PV|String ... IO: --background ID: pvscan_cache DESC: Record that a PV is online and autoactivate the VG if complete. pvscan --cache_long --listvg PV OO: --ignorelockingfailure, --checkcomplete, --vgonline, --udevoutput, --autoactivation String ID: pvscan_cache DESC: Record that a PV is online and list the VG using the PV. pvscan --cache_long --listlvs PV OO: --ignorelockingfailure, --checkcomplete, --vgonline ID: pvscan_cache DESC: Record that a PV is online and list LVs using the PV. pvscan --listlvs PV ID: pvscan_cache DESC: List LVs using the PV. pvscan --listvg PV ID: pvscan_cache DESC: List the VG using the PV. vgcfgbackup OO: --file String, --foreign, --ignorelockingfailure, --readonly, --reportformat ReportFmt OP: VG ... IO: --partial ID: vgcfgbackup_general OO_VGCFGRESTORE: --force_long, --metadatatype MetadataType vgcfgrestore VG OO: OO_VGCFGRESTORE ID: vgcfgrestore_by_vg DESC: Restore VG metadata from last backup. vgcfgrestore --file String VG OO: OO_VGCFGRESTORE ID: vgcfgrestore_by_file DESC: Restore VG metadata from specified file. vgcfgrestore --list VG OO: OO_VGCFGRESTORE ID: vgcfgrestore_list_by_vg DESC: List all VG metadata backups. vgcfgrestore --list --file String OO: OO_VGCFGRESTORE OP: VG ID: vgcfgrestore_list_by_file DESC: List one VG metadata backup file. OO_VGCHANGE: --autobackup Bool, --ignoremonitoring, --noudevsync, --reportformat ReportFmt, --select String, --force OO_VGCHANGE_META: --addtag Tag, --deltag Tag, --logicalvolume Uint32, --maxphysicalvolumes Uint32, --alloc Alloc, --uuid, --pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG, --physicalextentsize SizeMB, --resizeable Bool, --profile String, --detachprofile, --metadataprofile String, --setautoactivation Bool vgchange OO_VGCHANGE_META OO: --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_properties DESC: Change a general VG attribute. DESC: For options listed in parentheses, any one is DESC: required, after which the others are optional. vgchange --monitor Bool OO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_monitor DESC: Start or stop monitoring LVs from dmeventd. vgchange --poll Bool OO: --ignorelockingfailure, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_poll DESC: Start or stop processing LV conversions. vgchange --activate Active OO: --activationmode ActivationMode, --ignoreactivationskip, --partial, --sysinit, --readonly, --ignorelockingfailure, --monitor Bool, --poll Bool, --autoactivation String, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_activate DESC: Activate or deactivate LVs. vgchange --refresh OO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_refresh DESC: Reactivate LVs using the latest metadata. vgchange --systemid String VG ID: vgchange_systemid DESC: Change the system ID of a VG. vgchange --lockstart OO: --select String OP: VG|Tag|Select ... ID: vgchange_lockstart DESC: Start the lockspace of a shared VG in lvmlockd. vgchange --lockstop OO: --select String OP: VG|Tag|Select ... ID: vgchange_lockstop DESC: Stop the lockspace of a shared VG in lvmlockd. vgchange --locktype LockType VG ID: vgchange_locktype DESC: Change the lock type for a shared VG. vgck OO: --reportformat ReportFmt OP: VG|Tag ... ID: vgck_general DESC: Read and display information about a VG. vgck --updatemetadata VG ID: vgck_update_metadata DESC: Rewrite VG metadata to correct problems. vgcreate VG_new PV ... OO: --addtag Tag, --alloc Alloc, --autobackup Bool, --clustered Bool, --maxlogicalvolumes Uint32, --maxphysicalvolumes Uint32, --metadataprofile String, --metadatatype MetadataType, --physicalextentsize SizeMB, --force, --zero Bool, --labelsector Number, --metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG, --reportformat ReportFmt, --dataalignment SizeKB, --dataalignmentoffset SizeKB, --shared, --systemid String, --locktype LockType, --setautoactivation Bool ID: vgcreate_general vgdisplay OO: --activevolumegroups, --aligned, --binary, --colon, --columns, --configreport ConfigReport, --foreign, --ignorelockingfailure, --logonly, --noheadings, --nosuffix, --options String, --readonly, --select String, --shared, --short, --separator String, --sort String, --unbuffered, --units Units OP: VG|Tag ... IO: --partial, --ignoreskippedcluster, --reportformat ReportFmt ID: vgdisplay_general OO_VGEXPORT: --reportformat ReportFmt vgexport VG|Tag|Select ... OO: --select String, OO_VGEXPORT ID: vgexport_some DESC: Export specified VGs. vgexport --all OO: OO_VGEXPORT ID: vgexport_all DESC: Export all VGs. vgextend VG PV ... OO: --autobackup Bool, --force, --zero Bool, --labelsector Number, --metadatatype MetadataType, --metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV, --metadataignore Bool, --dataalignment SizeKB, --dataalignmentoffset SizeKB, --reportformat ReportFmt, --restoremissing ID: vgextend_general OO_VGIMPORT: --force, --reportformat ReportFmt vgimport VG|Tag|Select ... OO: --select String, OO_VGIMPORT ID: vgimport_some DESC: Import specified VGs. vgimport --all OO: OO_VGIMPORT ID: vgimport_all DESC: Import all VGs. vgimportclone PV ... OO: --basevgname VG, --import, --importdevices ID: vgimportclone_general vgimportdevices VG|Tag|Select ... OO: --select String, --foreign, --reportformat ReportFmt ID: vgimportdevices_some DESC: Add devices from specific VGs to the devices file. vgimportdevices --all OO: --foreign, --reportformat ReportFmt ID: vgimportdevices_all DESC: Add devices from all accessible VGs to the devices file. vgmerge VG VG OO: --autobackup Bool, --list, --poolmetadataspare Bool ID: vgmerge_general vgmknodes OO: --ignorelockingfailure, --refresh, --reportformat ReportFmt OP: VG|LV|Tag ... ID: vgmknodes_general OO_VGREDUCE: --autobackup Bool, --force, --reportformat ReportFmt vgreduce VG PV ... OO: OO_VGREDUCE ID: vgreduce_by_pv DESC: Remove a PV from a VG. vgreduce --all VG OO: OO_VGREDUCE ID: vgreduce_all DESC: Remove all unused PVs from a VG. vgreduce --removemissing VG OO: --mirrorsonly, OO_VGREDUCE ID: vgreduce_missing DESC: Remove all missing PVs from a VG. vgremove VG|Tag|Select ... OO: --force, --noudevsync, --reportformat ReportFmt, --select String ID: vgremove_general vgrename VG VG_new OO: --autobackup Bool, --force, --reportformat ReportFmt ID: vgrename_by_name DESC: Rename a VG. vgrename String VG_new OO: --autobackup Bool, --force, --reportformat ReportFmt ID: vgrename_by_uuid DESC: Rename a VG by specifying the VG UUID. vgs OO: OO_REPORT OP: VG|Tag ... IO: --partial, --ignoreskippedcluster, --trustcache ID: vgs_general vgscan OO: --ignorelockingfailure, --mknodes, --notifydbus, --reportformat ReportFmt IO: --partial, --cache_long ID: vgscan_general OO_VGSPLIT: --autobackup Bool, --poolmetadataspare Bool OO_VGSPLIT_NEW: --alloc Alloc, --maxlogicalvolumes Uint32, --maxphysicalvolumes Uint32, --metadatatype MetadataType, --vgmetadatacopies MetadataCopiesVG vgsplit VG VG PV ... OO: OO_VGSPLIT, OO_VGSPLIT_NEW ID: vgsplit_by_pv DESC: Split a VG by specified PVs. vgsplit --name LV VG VG OO: OO_VGSPLIT, OO_VGSPLIT_NEW ID: vgsplit_by_lv DESC: Split a VG by PVs in a specified LV. config OO: OO_CONFIG OP: String ... ID: lvmconfig_general dumpconfig OO: OO_CONFIG OP: String ... ID: lvmconfig_general devtypes OO: --aligned, --binary, --nameprefixes, --noheadings, --nosuffix, --options String, --reportformat ReportFmt, --rows, --select String, --separator String, --sort String, --unbuffered, --unquoted ID: devtypes_general fullreport OO: OO_REPORT OP: VG ... IO: --partial, --ignoreskippedcluster, --trustcache ID: fullreport_general lastlog OO: --reportformat ReportFmt, --select String ID: lastlog_general lvpoll --polloperation PollOp LV ... OO: --abort, --autobackup Bool, --handlemissingpvs, --interval Number ID: lvpoll_general formats ID: formats_general help OP: String ... ID: help_general version ID: version_general pvdata ID: pvdata_general segtypes ID: segtypes_general systemid ID: systemid_general tags ID: tags_general lvmchange ID: lvmchange_general lvmdiskscan OO: --lvmpartition, --readonly ID: lvmdiskscan_general lvmsadc ID: lvmsadc_general lvmsar OO: --full, --stdin ID: lvmsar_general vgconvert VG ... OO: --force, --labelsector Number, --bootloaderareasize SizeMB, --metadatatype MetadataType, --pvmetadatacopies MetadataCopiesPV, --metadatasize SizeMB, --reportformat ReportFmt ID: vgconvert_general (+)+)+)(+)+)((+)u(YLLLLLLLLLLLLLLLLLLLLLLLL0YLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLlPMjNONeOLVM_COMMAND_PROFILEmetadata profileGiving preference to command profile specified on command line over the one specified via environment variable.command profileFailed to add %s %s.Setting global %s "%s".Failed to apply %s %s./proc/self/fdPhysical extent size may not be negative.&:Nbv(6F88гh9C: <0=P>p>EGԴGII4JTvKt4P&SXԵY[N\4_Taxe-ffܶxghj<hm\o|qMt-vܷnxyz<{\~|q~ܸG<\|jzܹa<\|^}ܺΤ @@[` ʫ$DdUjļ5$,DcdbuĽ$SD²dٳ ľ\е$%DԶd35ȿ(>HhH q(Hh}s ,Ll!Fm h,LlVN y,$L/lOo ,"Llv*j .,&L;lQf3H ,Ll.L2 ,]LlKC i,LQl ,CLlm ,Lql ,L lm )X0<Pp0'"" &'#(0*P,p/q0003464G7X[7x8Q:y::y<wD<D\D||EFXFF>GSG<G\ H|'IJ\NQlU:W<\\c^|^wddd-ee<f\g|aggg+jj &l@fm`nmsvEwpxy$yDvzdx\qȐ(HhbےgT0P@x[=$(LYlyY ~,Ll;4Xq|w$DdPC$pDd(Hh49 k,7P&p 68vXx&<'\)(|S,5-`... 0DZ6hDEsGGGDJ,LPTNpOPQVRRX4YTSZt`8c@efgBh8lXm|+n]nnnnVo<o\p|ErSrdrrt Uu@tu`Ev{b{^$эLlBZ͛ɜA0P4ps=k0Pa|il(?LrlJY( @`| R @`g#[ @`*x @`<O @`'!'Ff$Dd(x(Hh W \ {  4Tt! 8XxW ?q8XxXq!s$)-<0.\/|002223 6@6`c77889}:$*Q X,Lp+8Xx"B#x$$ $@?%`c&&'))A2$5D36d<@xBuKOU(9YHZhevfjjj Ck( kH kh >l l u v  w ?w4 ^wT yt Lz z }  g 8 X x :    ˊ X8 ܋X @x ԏ : |  - N@ Ěd  ' f S 4Tqt }8XXxae P#N8XGxRu(H h p4"XxkA(ALpD8XMxV  v  @_dt`$DdGOjz$|Dd ?  !#$$l$D7(dQ(j,g-~--.$.D.d /#/:////$/D)0df000000$1D?p@:BBBBC4+CTTCt}CDDDtEGF4GTHtIJoJVOCRGS@]UdVZv^,ff Ah,ViLol;rp| ق 4 څT t    A !4!(T!.t!؞!o!!§!8"8"۵X"x"i""I"A"#8#X#Lx#8#n####$8$WX$x$7$$$O$%8%SX%x%%%%%&B8&G\&|&o&&&p&'<'1\'^|'1'N''X'(3<(a\(|(5((((})<)\)>|)))A)o)*n<*\*r|***3*p*+<+w\+$|++M++9,m(,H,h,,E,,, -,-L-l-d---N- .,.}L.l.5.V.!.').. /4,/N6L/X8l/K:/C/#E/F/F 0G,0GL0PIp0J06L0L0M0vN1OD1 Sd1fS1S1[1[1\2H_02`T2bx2c2:d2f2f2 g3g83hX3Ps|3s3t3u3v3w4]{<4{\4||4}4_~4A4"4͂5!@5`5p55i55E6$6D6+d66B6665707P7p77j7 7m7848T8t88:878819[49T9-t9m9899: :@:0`:F:}:::;a$;D;d;;<;o; ; <,<mL<p<$<f<9<"=R# =$@=:h=>=nB=uD=EE=Z>[<>\\>]|>^>3`>`>e?f ?jH?jh?k?o?9??@<@я\@|@ @“@@PA ADAߩdASAVAA#AGB Lc lc c cccd0dPdOpd*dddde!4e"Te$xe$e%e&e+f-(fb/LfY2pf7f8f8f9fC;gA<4g>Tge?tg@gX@g@g=AgAhB8hgC\hED|hDhDh"FhFiHG$iHDiIdiIiAJiJiKiKjL$j&NHjxOhjQjQjRTj:Vj\ k`0k`Pk,bpkbkhkqlknkql]v0yTtԇ 4XxUi؈ @X`t"c wDJdȊx(H hD ̋  !,`!L!l!""̌1"[" ","L"l""#̍!## #,*$L$l$$h%̎%"& #',)P2p,4o55ԏ6788=\=|> @@ܐCE bF@G`M&PSUgUU U@V`VWXYYZ]^ `@g`h lLnnWoq u@v`mww8xyUz{  |@`)g~ @`/F]t @چ`)@g~ @`') :@K`br Š@Ҋ`"2 B@R`iˋۋ @` +<M^ x@`݌:ĝR$TH͓hEIȞƗf ^0Pp"Пל50\PNpW Р;'06Pp:IXС?0Pp&5ТD0Pp;ԻУaq0-P¾pPФ-0PPsp Х~ ?4Tt.EQئ*8YXxx7ا#98XxItبE8Xx5Vة&8Xsx@ت~8CX|x6ث8XUxج/^8X0xvحHy8XxUخ S8XxKد.g8XxEذ]8Xx fر8~8X xD~زR8X$xjسQ8Xx;rشI8|XxTص8- Xk x   ضT   8 X; xk   ط + [ 8 X x M  ظ  68Xx;kع8ZXx8غ38hXx<ػq8X%xJoؼ 8XX x2ؽr 8!X#x$%b&ؾ&(082X2x334ؿ4I5585X/6x6;77781989Xl:x ;W;<>@A<C\C|:DJE,FFGG<H\H|HI JJBK`M< N\SN|N+OOTPPP<Q\Q|RRSVSSxT<$U\kU|URV3YZ\ b@6d`eJfffgg h@|i`jk-lllm m@mn`oonpGqqar s@s`sxttmuvww yx@&y`yz{K{|5} z}@}`~ |Ȁ @`2ՄQ̅Z @}`vl @v`v# @` ݑ5Γg @`kGQ :@"`]ßD @g`"K i@Ф`1N> @~`ժ8$ @*`.$f @`[) @`mUɺ= g@`սCh @`v; @p`)Vp @`St_ @ `G\,K H0Pp\)T0Pp 8Q4Ttto)4Tt&U<\}|uB m@`|A N,$Lbl5H  p!, "L0"lf"#$$$ %,%L&lL&&'>'' (,-L93l3I7r=@>_AD0EPWGtJQJRiUV V@W`XZ[^bc$+dDidkBoUpwppp$?rDsdwVz<|=4ŒTWt |2ʓ{4T.xۜoа$,Hh)d7g20CPipb}  <Q\|aW  @ `#|*M-/~//$(0D]0dS4453666(d8H8h99-9[999(y:L:l:;<[<= @0FTLxOQQQRR<R\S|SSTUUVKY<]\S]|]``~ci(FlHlhr st>uuz4zTztl,Ll.[Ȏmј@d>1sزf4ϿXx iDd< ,4=T\tB4Tt2SJ4zTtx2*8YXh x     W 8xXox#q8Xxx~K8X?x| <!\'#|E%6'()G,$.D /d014g5<6{;(;H?hr@@@AAK L,LLNpO7Q]`d e4 fT ht i i Lw zw w w4 wT xt )| ]~  ހ Y …< \ ӆ|  + , V ( H Ih j + " ϫ Ԭ h4 %X <|    Ҵ$HDFhb #,Lgle$ ,,L#lzSQ ,KLl"t$l ,Ll~lL ,LlWK 50PtfDI   Dh&W(@Hmh%R(3H h$'[,-)0489X?|E5S@`9go4Xxwg0^(ϜHh1pj  ,tL˨lp 50Pt\c><`Ie$HRh{\ P, LClM 4 X | t     !@!`!/ !<"!#!r$!$" &,"P(P")p"*"+"b."j/#/ #20@#;`#/H#J#wK#P#V$XW0$NXP$[p$x$P}$U$B$ۄ%!4%T%x%Ў%%E%%^&m8&-X&====I>8>1X>` x>| >/>>k>"?%* Lw*,L,LL;/lL/0L01LM4L5L36 MX8,M8LMApMwCMEMoEMEM'GN#P8NRXN{]xN`N-aN^aNaN bO=b8Og\O'i|OQiO{iOiOiOiPi?Ԩ@BD4DTJtLdkİо2(Ll6VбN0PApв0Ppz гE0Pp'nд801PpV%е=4xTt<Զp4T   @`Hĸz$D3d!Ĺ_8$3DdXĺNm $* D d!b!"Ļ"#%(x%H%lo&&'̼I). .,/L2lo6]7;̽i<q= =,=L>lh??9@̾AGB I,iJLKlLMN̿OGP Q,;SLcTlW"XY9ZZ ,[,j[L\l]6]]^^ )_,_Lb`l`!aabf Tk,skL+lll~mm2no Ro,oLnplpq_qqr us,sLytluu vvv v,wL3wlww*xxx y,2yLVylyyyyzQz z,p{L{l{'|~~~ ,vLǀlȃX@ ,Lp^-3=ؒg0PRpؠW!-0ΫPpzRx $pFJ w?9*3$"D\`tEC  EC   vEC m aEC x ½WEC N ,EC c 4EC  TEC G tJEC A 9EC p ٿEC  ,EC # +EC b @EC 7 4EC  TaEC X t?EC v  (EC E jEC a /^EC U  mEC E FOEC F <uEC  \nIEC @ |EC   ?EC v )0EC ' 9EC z 8EC / 'EC  <EC   \2EC E EC  EC  EC   EC  u EC   bEC  @BEC  `@EC   EC E oEC  EC  'EC  EC  $bEC   DWEC  dEC  EC  t,EC c EC   EC  EC  $ EC  DEC  dEC   cQEC J> EC   i EC H EC   rXEC O $,EC I T6EC  tvEC m EC  EC   #EC  $$XEC KD  ?+EC  < +EC  \ ,[EC R | ,kEC b  .JEC A  5/EC   #0qEC h  t0CEC z  0EC L < 0uEC l \ 1EC  | e2 EC   Q3{EC r  30EC E"  4EC E  5<EC s $ 5fEC ] D 5fEC ] d ?6eEC \  6eEC \  6eEC \  7AC Z  7EC   7!EC X $ 71EC h D 7[EC R d 8EC G  7MEC D  8NEC E  N8<EC s  j8EC   9EC  $ 9lEC c D :EC  d :^EC U  :EC   K;EC    ?<EC    3=EC ~ =GEC ~ $=EC  D\>EC  d@)EC ` @#EC Z @hEC _ 'A EC  BEC   |BKEC E= (C/EC f HCEC M hC.EC e CEC  DEC  kEEC   _FoEC f FEC  (0G-EC d  H=GEC H{  lIEC E  @NEC E $OEC L jEC  Im3EC j \m3EC j <omEC   \,n EC G (rEC  tEC  vqEC h vmEC d EwhEC _  wEC  @EC 5  EC  ,AC Z LEC F  l EC E !EC X EC  EC V EC  nEC e 0EC  PEC  pAC Z LEC C >EC 5  =hEC EZ  WEC EI SEC J  8EC E \!EC X  |EC E EC V EC  BEC 9 =nEC e   EC E D!EC X dkEC b $\ EC Nk EC  AC Z iEC `  hEC _ (,.EC Yu X EC  xG!EC  #EC  %EC  ,(HEC ? T)EC   ,EC  8 ^-bEC Y X -EC  x J. EC   50EC E  1EC   P3 EC   $?EC  !?EC  w,QEC H  >,EC  @>/~EC u `>/yEC p >V0EC  >0EC  >1EC  >64EC + ?8HEC ?  ?:EC  @?;EC  `?~EC u ?7A>EC 5  ?UC/EC _ ?`J(EC _ @hJ(EC _ $@pJEC  D@J~EC u d@BQvEC m @QEC  @oTkEC b @TxEC o @XEC  AYEC  $AYEC  DAl\EC  dA9^EC  A`EC  AamEC d AbEC G  AaEC E BdwEC n  (BfEC E LBgEC K lBgWEC N BiEC  Bj(EC _ BjaEC X BjEC   CYlEC J 0C3t3EC j PCFt3EC j pCYtEC  CtEC  CWu=EC t Ctu?EC v CuEC  DvEC L 0DvGEC ~ PD6vqEC h pDvEC  Dw~EC u DxEC  Dx|wEC n DEC  EHEC  0EEC  PEgEC  pEߋxEC o E7EC  EAC Z EEC H EEC } F EC  0FEC  PFMOEC F pF|aEC X F/EC f F̓aEC X  F :EC S F#EC  G@EC 7 4Gޗ@EC 7 TG@EC 7  tGEC Q GAEC 8 GEC  GY+EC " GdEC  HuEC l 8HEEC  XH EC   xH EC bn HaKEC B HEC   HWEC N HWEC N IkEC b EC E OEC  O#EC Z O#EC Z OAC I PEC   EC G c:^EC U 8cxEC  Xc%AC Z xc$xEC o c|PEC G cEC z  cEC G c^EC U dEC   0h7EC  Ph8EC  phc:EC    hV;6EC E( hhEC 5 ԇCEC : ZEC Q N>EC 5  4lEC G XEC L xEC L EC  @EC 7 ؈EC Q ]EC T EC  8SXEC O XPEC G xEC  0sEC j EC  ؉~EC G n:EC q EC  800EC g X@cEC Z x0EC g mEC d WEC N ؊ EC   qEC h  [EC R 8 EC  XEC Q xEC  EC  EC N ؋`EC W "EC Y EC  8g$EC [ Xk5EC l xEC N wEC N ndEC [ ،EC G EC T -EC d 81EC h X=EC t x#EC Z #EC Z EC N ؍EC N EC N EC  (8 EC \ d$EC  L%VEC M  &\EC AR Ȏ&MEC D &EC Q &EC N (&EC N H&)EC ` h&)EC ` &EC  S'EC  ȏ'GEC ~ 'zEC q X(EC  ( )EC  H)EC  h*EC z +EC x Z,YEC P  Ȑ,EC G  V1EC G  4EC E  44EC E  X6/EC G |7xEC o  T;rEC Ed ?EC  8GEC  GbEC Y  IEC   @JEC  `oPXEC O  R5 EC H$  \EC Gr Ȓ`EC  bEC  bEC  (McQEC H H~eEC  hfEC  fEC  ?hEC  ȓnEC  EvIEC @ nvpEC g (w.EC % HyEC  h|EC  <}EC   }AEC H0 ̔ЁEC   …vEC m  EC  ,ьEC  L{EC  ll}EC t ɥ(EC  ѦEC  ̕iEC  ACEC :  dlEC c ,!AC \ L;EC r l̫EC  6EC m EC v ̖ 6EC m #EC v  6EC m ,EC v LREC I l)EC  REC I ɳEC  ̗78EC o O4EC k  cEC  ,״<EC 3 LEC  lqEC h EC  ޹EC  ̘]EC T /EC f  /EC f  ,EC G PyEC p p<EC  EC   _EC V ЙEC  leEC \ .EC e 0.EC e P-EC d pEC  EC  MEC D КEC  TvEC m eEC \ 0.EC e P.EC e p EC  eEC \ .EC e Л.EC e EC ~ YeEC \ 0.EC e P.EC e ppEC g  eEC \ O.EC e М].EC e kEC } yEC p 0*yEC p PEC  peEC \ 3.EC e A.EC e НO=EC 4 l.EC e z.EC e 0EC  PEC   pEC E  EC E  EC E ܞBEC y )4EC k =EC P <6EC   \,EC w |)EC   EC v  EC E bEC Y EC   nEC  @@kEC b `eEC \ IEC @ :EC 1 gEC ^ ZOEC F QEC H  EC  @)1EC h `:EC ~ !AC \ EC { MEC D 3EC   `EC W  KEC  @ EC  `EC   EC  `EC  OEC  +EC  CEC z  EC   @^EC GN  dYEC GI $ EC I{ r_EC V УEC  EC  $R"EC I 8LtEC k X!ZEC Q  x!fEC EX $"EC I Ĥ)/EC f )/EC f )8EC /  $-EC E  H-EC Gz l0EC  0EC  z1EC  ̥%3EC  3tEC k  3EC  ,V4EC   LM5 EC E p?/EC f ?>EC 5 @AEC 8 ЦBEC  BQEC H C}EC t 0GEC  PGEC  pDH EC  0IEC  IEC  Ч]KEC  MEC   MTEC GD 4REC  TVYEC P tV9EC p  WEC G ]GEC ~ ب]EC  9^QEC H j^TEC K 8^AEC x  X^EC E |Wb[EC R $baEC IO ĩdIEC @ eIEC @ gKEC B $HhEC  D-iEC  djEC  IkEC  mEC  ĪHnMEC D unEC   nEC E (pEC  Hr EC  h.~EC   #{EC r ~EC  ȫ[EC  -EC $ *EC a (EC | HMEC D (h@EC M* ŘEC  pKEC B ԬEC  wtEC k ˥EC  4ʫEC  TȬ EC  t7EC . վEC   ӿ EC E ح<EC s ~EC u 5"EC  873EC j XJKEC B xu;EC 2 3EC j  EC G ܮEC   GEC T*  fEC ]  @EC Ez d}/EC &  BEC E4  EC E $̯YOEC I= EC  *EC  $4EC L  \pEC E $EC K  EC E ̰EC   EmEC TP LEC C 0EC  PZEC  p"EC   xEC o o!EC   б "EC H &EC  $'MEC I; <*EC  \+EC   |+EC H  a/$EC H  IJaBTEC EF  CEC H  hL&EC E 0jO#EC Z PmO#EC Z  ppOEC E aQEC  REC  ԳWEC  HYEC   ZEC Et 8E`NEC E $XshtEC Ib $kEC K mEC  ȴp8EC / $'s$EC U #{EC  0pEC g PEC  pEC  EC  EC  е݄EC  (lc7EC PJ7  ~EC Ep @uEC l `R"EC  TtEC k  EC G  ĶJEC G  dEC GT  PEC G  0%EC E  TjEC E\  x\ EC GL  /0EC E!0 tEC k (p%HEC M2  +'EC   ,,EC E PG.EC } p.EC  2EC   3vEC m и3EC  4EC    ;EC E 4q=3EC j T=$EC  t> EC  t@EC  KA&EC   ԹQBEC E /DEC  EEC z  8rEEC E  \eH$EC [ |iHEC  ZIEC   I[EC EM  KVEC EH =OEC  $P}EC t D*RMEC D dWREC  TEC x }U/EC f ĻUMEC D U`EC W UaEC X $:VEC   D Y]EC GM  hEZ=EC E/ ^]%EC   c`EC E мBbEC   d EC E fEC  4SgEC  ThEC  thEC  [jEC   jEC E ؽoEC  5pMEC D bp[EC R 8pnEC e XpEC  xeqEC  qCEC z  rEC  ؾrEC  :sbEC Y |slEC c 8s;EC r Xs;EC r xsEC   tEC G ^yEC  ܿ~EC  ~JEC A ~ EC  < EC  \EC  |CEC z %sEC j xEC  EC  EC   EC E  @0;EC E- dG}EC t  EC E   "EC Hv" NEC E *EC   +EC G 0EC   PD EC H3 t EC   ^EC EP XEC O &EC  sEC j  IEC @ 86cEC Z XyEC  xODEC ; s-EC d  =EC E/  dEC HS bEC Y  SEC J @N!EC  `ODEC { s,EC c WEC N EC   EC   EC   1EC h @EC  `VEC  EEC  EC  _EC  EC   wEC n  ,EC  @EC   `WEC EI EC  EC  KEC   =EC  EC ~ $EEC | DEC O  d(EC E gEC ^  EC G| OoEC f  EC E <EC  0EEC | PEC |  p.EEC E7 OYEC P EC   EC  $ EC L hEC  <EC  \UEC  |REC I ~EC u ]<EC 3 y>EC 5  EC E  aEC E DNDEC ; drEC  "EC  #EC   $tEC k ]&{EC r 'EC  $S(EC  D)EC  d*EC  C+ EC   5 EC J  BEC E  CEC N  CcEC Z  ,6EEC H  P+HzEC Gj tJ1EC ( KEC  oL<EC s LOEC F M,EC #  NEC E 8OEC  XRHEC  xREC   TEC  JV@EC 7 jXEC x []EC T \/EC &  8^EC E \bEC  |e:EC 1 geEC \ :iEC  jEC  k{EC r kEC  <lEC  \ymDEC ; |n5EC ,  q'EC E sEC  NvQEC H  wEC E  $A)EC G HFcEC Z $hxEC If مEC { =_EC V |EC   EC   $-EC I 8*EC !  XEC J |LEC C PEC G H<EC s dAEC x 7EC n AEC x <AEC x \ޞEC M |ԞFEC } EC M 3EC j &EC ]  EC P \EC S <>QEC H \oEC x |ПEC P ɟEC O EC P EC P EC P EC O <EC O \LEC C |ȟBEC y EC ~ Q"EC Y SEC V R EC W REC  < $EC  \UEC L |ElEC c tEC k LEC C JEC A ;FEC =  aEC E @EC  `pEC  }EC t ^}EC t  ZEC EL EC  EC  $EC  DAEC  d״EC  mEC d ߵ)EC   'EC  EC   wGEC E9 ("EC   HEC E l9:EC q SEC  ׿EC  (EC M  5EC E'  EC Ez  @EC E  dEC E{ FEC  @EC w EC  sEC j 'EC  (@EC 7 H%EC  hEC  ~>EC u QEC H  EC E =EC   EC   ,cEC G PEC  pSEC J SEC J $'7EC I% 6qEC h EC  _EC V 8[ EC  XGHEC  xoFEC } gEC ^ \EC S EC  cEC Z   EC E <REC I \ EC  |EC U EC  EC   JEC H  EC E $k#EC Z DnfEC ] dgEC ^  EC E   EC E 5EC , EC   EC E 0 EC  P EC  p EC   EC   ~EC u y EC  9 ,EC # E)EC ` 0NEC L PCMEC E pp{EC r EC   MEC E %EC  XEC O EC  4#EC Z T#EC Z tEC  _NEC E  AEC G1  !EC H  f)c EC JP ( 3EC M  Ll6EC E p8hEC _ L81EC h ]8|EC s  8EC E f9EC ~ $9 EC K <mCEC   \GEC E  Ia EC HP VEC   XEC G  0[EC E  ^EC E  0seEC E ThGEC ~ tiEC  iEC ~  kEC E  l EC Hr  vEC G  {EC G D9EC 0 d2EC  EC  EC  Z<EC 3  vEC E CvEC m (DEC { HEC  h-EC $  EC E H.EC e VEC  EC    EC G 0EC  P(EC  p'EC  iEC ` EC   KEC E= խEC  |4EC k 4YEC P TɮEC  t.EC e EC  1 EC   EC E $ͱgEC IU  uEC Eg D]0EC g  dm^EC GN  EC G m4EC k $EC  0EC '  EC  , 4EC +  L}EC Eo pxMEC D yEC p EC  $}EC K  h EC G DEC  <,EC   \wEC Jd 9EC p lEC c ^9EC p w9EC p 9EC p  9EC p @LEC C `9EC p 9EC p  9EC p 99EC p REC  9EC p  dEC [ @dEC [ `^dEC [ EC x 9EC p 9EC p 5EC  9EC p  dEC [ @dEC [ `AdEC [ EC x 9EC p UEC L 49EC p M9EC p  fXEC O @9EC p `aEC X 9EC p 9EC p *9EC p CbEC Y bEC Y  _EC V @_EC V `EdEC [ bEC Y bEC Y  bEC Y ObEC Y bEC Y  EC  @>9EC p `WEC  dEC [ dEC [ JdEC [ 9EC p 9EC p  EC Es  DEC Es hz9EC p  EC Es EC {  TtEC Ef  EC G sEC | 4'EC ^ T'EC ^ t#EC Z  + EC G $EC I  EC G  a "EC G (_/EC f  HnHEC E: lEC   BEC J  06EC m 0:EC q  903EC E%  H4>EC E0 8b6eEC \ X71EC ( x8EC  9EC   : EC W  :XEC O C:"EC Y E:EC  8:EC  XL;EC  x;EC   <EC E| =EC  =^EC U >EC P >qEC h <c>EC  \7?EC  |?EC  =@EC  5AEC   BEC E{ GEC   IEC   @&JEC E dLLEC C MEC  NGEC ~ NEC   OEC  WQFEC = $}RQEC H (DR EC M $pWEC I $\(EC I ]EC  ]BEC 9  ^nEC E`  $`;EC E- Hd2EC i h/d)EC ` 8d!EC X 9dEC  dEC  e\EC S eEC   (zf` EC JM LoEC  l^pwEC n pEC  6qsEC j  q8EC E*  s/EC G t)EC ` 4t_EC V TtEC  txutEC k uEC ~ 3v'EC ^ :vAEC x [v{EC r  vEC T| 8+zEC  X| EC   xoEC E gEC  8EC  EC  hEC   [_EC V <EC V \EC  |nEC   EC E pZEC Q 0EC g IEC @  IEC @ @ IEC @ `5-EC d B0EC g REC L GEC M =*EC a G*EC a  QEC Q @KEC Q `EEC Q ?EC Q 9EC Q 3EC Q -cEC Z pcEC Z  CEC Eu @֕bEC Y `EC O &EC ] EC  kEC b ߖOEC F EC   EC E D EC   dhLEC E> CEC : nEC e EC  EC   pEC Eb  ,J!EC E PGIEC @ ppAC Z oEC  FyEC p  iEC E[ EC  yEC p 4nEC e Th EC  tTJEC A ~zEC q wEC n /PEC G _REC I +EC b 4+EC b TEC  tc/EC f rEC  KFEC = qEC  UEC L 5@EC 7 4UEC  T&[EC R ta$EC  e?EC 6 yEC p EC  OsEC j EEC < 4|EC s T#EC  t*EC a EC  pEC  eEC \ MEC  !EC X 4EC  TEC  t$}EC t >EC u EC N EC N UEC L  EC N 4 EC N T EC N t EC N  EC N  EC N  EC N  EC N  zEC N 4 q!EC X T rEC N t iEC N  `!EC X  aEC N  X'EC   _EC N  V{EC r 4 EC N T EC N t {EC r  EC Q  .EC e  EC H  .EC e  EC H 4 EC H T EC N t EC G  EC G  EC G  EC G  EC G  EC G 4 zEC G T jEC G t ZEC G  JEC G  :EC G  *EC G  EC G  EC G 4EC G TEC N tEC N +EC b EC G EC G EC G EC G 4EC G TEC G tEC G sEC G cEC H TEC H EEC H 6EC Q 40EC G T EC N t>EC u  5]EC EO nEC O fDEC { EC L  EC H <yEC p \]xEC o |EC  VCEC z y}EC t  EC E  REC G $&&EC ] D,EC  d EC  tEC k EC  JEC  EC U @EC w $'EC ^ DEC  dJEC A EC  EC  21EC h CEC  EC H $EC F DEC  d{GEC ~ EC F EC F JEC A @EC 7 ]EC T $hEC _ DOEC Q dI*EC ! S ;EC 2 nEC F ]EC F LqEC h EC  $` EC  DLEC  d+EC  EC  EC  EC  iEC G YEC G $IEC  DEC  dJEC  gEC ^ +EC b  EC G EC F ,EC # $#EC Z D#EC Z d#EC Z EEC | #EEC |  H^EC EP EC  !AC Z (!XEC O H;",EC # hG#kEC b  &EC H * EC  q+TEC K /TEC K  /1EC h ,//EC f L/EC  l06EC - 2EC  w8OEC F 95EC , EC u ~HIEC @  H>EC u ,H>EC u LH9EC p lH>EC u I>EC u 8I>EC u VIIEC @ I3EC j  I3EC j ,I7EC n LI9EC p lI9EC p I9EC p J9EC p  J/EC f /J/EC f  >JFEC } , dJFEC } L JFEC } l JFEC }  JFEC }  JFEC }  "KFEC }  HK1EC h  !YK1EC h ,!jK7EC n L!K:EC q l!K:EC q !K@EC w !K9EC p !K?EC v ! LFEC }  "3LFEC } ,"YL>EC u L"wL:EC q l"L:EC q "L:EC q "L7EC n "L9EC p "L9EC p  #M9EC p ,#'M7EC n L#>M7EC n l#UM9EC p #nM7EC n #MFEC } #MFEC } #MFEC }  $MFEC } ,$N7EC n L$4NFEC } l$ZNFEC } $NFEC } $NFEC } $NFEC } $NFEC }  %OFEC } ,%>OFEC } L%dOFEC } l%O:EC q %O:EC q %O>EC u %OKEC B %PKEC B  &2PFEC } ,&XPFEC } L&~PFEC } l&PFEC } &P7EC n &P7EC n &P7EC n &QBEC y  '1Q>EC u ,'OQ>EC u L'mQ7EC n l'Q7EC n 'Q7EC n 'Q7EC n 'Q:EC q 'Q3EC j  (Q3EC j ,( R3EC j L(R3EC j l(/R3EC j (BR9EC p ([R9EC p (tR0EC g (R7EC n  )R9EC p ,)R9EC p L)R>EC u l)R>EC u ) S9EC p )"S;EC r )=S7EC n )TS:EC q  *nSJEC A ,*S3EC j L*S0EC g l*S0EC g *S0EC g *S0EC g *S0EC g *S0EC g  + T0EC g ,+T7EC n L+2T:EC q l+LT>EC u +jTCEC z +T:EC q +T2EC i +T3EC j  ,TJEC A ,,TJEC A L, UJEC A l,JU3EC j ,]U>EC u ,{U0EC g ,U>EC u ,U0EC g  -U7EC n ,-UJEC A L-UJEC A l-$VJEC A -NVJEC A -xVJEC A -VJEC A -V0EC g  .V7EC n ,.V5EC l L.W5EC l l.W5EC l .2W5EC l .GW5EC l .\W5EC l .qW5EC l  /W5EC l ,/W%EC \ L/W%EC \ l/W%EC \ /W%EC \ /W%EC \ /W%EC \ /WPEC G  0WEC  ,0pXEC  L0XEC  l0YEC  0[EC w 0r]EC  0_EC  0`EC   1RaEC  ,1aEC z L1BcEC  l1@eEC  1fEC  1fEC  1gfEC ] 1gEC   2iEC   ,2q>EC 5 L2rEC  l2sEC  2t1EC h 2t6EC m 2/tEC } 2tEC   3)utEC k ,3}u9EC p L3u9EC p l3uEC  3vEC z 3{vsEC j 3vGEC ~ 3vEC   4swEC  ,4wEC  L4oxEC  l4xEC  4iyNEC E 4yEC  4?zEC   4|EC E 5l~&EC  05riEC ` P5EC  p5&EC  5EC  5EC  5HsEC j 5aEC X 6܃EC  06DEC  P6wEC n p6wEC n 6ZEC  6˅EC  6<EC  6EC  7EC  07EC  P7GEC ~ p7ωGEC ~ 7EC  7g}EC t 7ĊEC  7PGEC ~ 8wGEC ~ 08EC  P8*GEC ~ p8QGEC ~ 8xEC  8GEC ~ 8+GEC ~ 8REC  9ÍEC  094EC  P9GEC ~ p9GEC ~ 9EC   9EC E 9KuEC l 9uEC l :EC  4:yuEC l T:ΜuEC l t:#EC  :GEC ~ :ɞGEC ~ :EC  :|GEC ~ ;GEC ~ 4;ʟjEC a T;nEC e t;b EC  ;L9EC p ;eiEC ` ;9EC p ;ǣEC  <YxEC o 4<tEC k T<EC  t<EC  <EC  <EC  <_EC  <ݧ|EC s =9EC  4=Ԩ|EC s T=0EEC | t=UEC  =ЩEEC | =EC  = EC  =n9EC p >EC  4>1EC  T>uEC l t>"EC  >GEC ~ >cnEC e >|EC s ? EEC | 4?2|EC s T?EC  t?~EC u ?aEC  ?EC  ?LEC C ?(EC  @ȴEC  4@L|EC s T@EC  t@.|EC s @EC  @ |EC s @i{EC r @ķEC  A2aEC X 4AsEC  TA~EC u tAs{EC r Aι{EC r A){EC r A{EC r AߺEC  B`sEC j 4B{EC r TBEC w tBnEC w BμEC  B[|EC s B|EC s B{EC r CnEC x 4CϾ{EC r TC*xEC o tCEC  C5EC  CEC  CMEC  CEC  D?EC  4DEC  TD EC  tDEC  DEC  DxEC o DEC  DI.EC % EWEC  4EEC  TEEC  tE|EC  EdEC [ E1dEC [ EufEC ] EEC x FhEC _ 4FdEC  TFEC  tF_EC V FeEC \ FeEC \ FcfEC ] FaEC X GWEC N 4G!gEC ^ TGhaEC X tGEC  GjEC  G+EC  GEC  GFEC  HYEC P 4HOEC  THWEC N tHMcEC Z HcEC Z HEC  H<EC { HtEC k IEC { 4IXEC  TIEC  tI+{EC r I{EC r I{EC r I<EC x IEC  J>,EC # 4JJEC  TJ-hEC _ tJu^EC U JZEC Q JtEC k JAtEC k JtEC k KtEC k 4K=tEC k TKtEC k tKtEC k K9tEC k KtEC k KtEC k K5sEC j LEC  4LEC  TLEC  tLMEC  LEC  L{EC  LEC  LEC  M@EC  4MEC  TMEC  tMuEC  MDEC  MEC  MEC  M3EC  NEC  4NpEC  TNEC  tN-EC d NEC Q NEC M NEC M NEC M OEC M 4OEC M TOvEC I tOhEC I OZQEC H OeEC \ OEC  OlEC  P7)EC ` 4P@EC y TP=EC 4 tPEC L (PEC M PXAC Z PWHEC   QEC E $QEC  DQ0EC g dQEC  Q EC  QPEC G QREC I Q+EC b R+EC b $RnEC e DRj/EC f dRyEC  RRAC Z RQ/EC f R`EC  RyEC p  S9wEC Ei (SEC  HSzEC  hSEC  S0EC g SEC  SMEC  SEC V TEC  (Tg 2EC i HTy 2EC i hT AC Z T EC   T EC E  T ZEC EL T!EC X UMEC D 0UnEC e PU_EC   pUoEC H^ UD#EC  U$PEC G U$REC I U%+EC b V%+EC b 4V%%tEC k  TVy%EC E xV+|EC s  VL."EC E  VJ2'EC G VM4EC  W 8/EC f  W8EC  @W9>EC u `W9TEC K W":EC v W:EC ~ W:EC  WT;EC  X;rEC i  X<<EC  @X<#EC Z `X<6EC m X.EC e X>.EC e Y>EC   Y{?AC Z @Yz?EEC | `Y?9EC p Y?eEC \ Y?nEC e YK@EC V YJ@EC  Z@EC   ZA`EC W @ZEEC  `ZKWEC N ZKEC   ZO)EC H ZUEC  ZHVEC  [GYcEC Z $[\EC   D[_]EC G $h[^EC Nx  [BbEC H [hEC  [biEC  [al&EC  \gmQEC H 4\mEC  T\YnEC  t\%oEC  \qEC  \rEC   \tEC J \wx*EC ! ]y~EC u 8]yEC  X]EC  x]EC  ]EC   ]"EC Y ]EC G ]{EC G ^kEC  8^EC   X^EC H |^EC  ^EC   ^lSEC HB  ^EC H  _mEC J (_EC | H_fEC  h_ۣEC  _OEC U _MsEC j _EC  _6EC  `EC  (`? EC   H`?EC J l`EC  $`;EC N} `(EC   `}EC Hl `EC   a\EC HK 2EC  d8EC  d;EC   d-=iEC E[ dr=]EC T e=MEC D 8e=5EC l  Xe=EC E |eAEC  eNBEC  eBwEC n eCCsEC j eCPEC G fCnEC e tEC  ,-vEC  LwEC  lyEC  CzEC  #|.EC e ̙1|AC Z 0|rEC i  |rEC i ,|rEC i L&}rEC i lx}rEC i }8AC s }EEC | ̚~>EC u %~.EC e  3~EC  ,EC v LEC  ltEC   .EC e /EC f ̛'GEC ~ NVEC M  UEC L ,REC I L|EC s lGEC  SEC J VEC M ̜!VEC M WSEC J  SEC J ,8EC o LՇEC  lYEC  &EC  EC  ̝fEC  EC   f6EC m ,|`EC W LEC   lEC E }EC t [0EC g ОkEC  ԗ0EC g }EC t 0A}EC t PsEC j pKEC B gEC ^ cEC  П"EC  EC y K)EC ` 0TvEC m PvEC m pEC N ZEC Q 1EC  РPEC G FEC } EC  0EC  P%EC  pEC  \EC S XEC  СàEC  =EC N 4^EC U 0r^EC U PEC  pjbEC Y |EC s EC  Т¤EC  EC  EC  0hEC _ PgNEC E pEEC | EC  f0EC g Уv0EC g [EC R TEC K  0EC E  TpEC E  xEC E rEC  EC   ܤNEC J; DEC {  EC  @kEC b `EC  EC  pEC g ,EC  EC  bEC Y  /EC &  @EC A dQEC H |EC s -EC   Ħ)7 EC E) <EC  EC  (EC  H8EC  hEC  4EC + EC  ȧPEC  EC S oEC f ($+EC b H/EC  hEC  ~EC  ZtEC k ȨEC  jEC  EC  (EC  HEC  hV)EC ` _kEC b GEC ~ ȩEC   Q#EC H $ 1(PEC N9 4YBEC   TCEC E  xCEC G CEC  DEC  ܪ@HEC  "JEC  KEC  <L.EC e \LEC  $|EMSEC K? pPEC  īaVEC  @^gEC ^ _mEC d ($aNEC M8 PcEC   pmdEC G fEC  hEC w Ԭ7iEC   iEC G}  pEC  8qEC   XVrEC H |uEC  jv\EC S  yEC G }{EC  }EC   u~EC  @$EC   `'EC   !k EC HZ $hXEC KD ̮AC Z EC   aoEC f ,EC  LFEC = lEC  tEC k mEC  ̯ٙEC  EC   mEC  ,1EC  LН EC  ļEC  EC  EC  ̰6EC - ˯~EC u  )hEC _ ,q EC w L/EC & lEC  EC  oEC  ̱u EC l krEC i  :EC H) 0/EC & PEC  poEC   ,EC H z EC q ԲZEC  EC  p #EC  4s 2EC ) TPEC G tEC  AhEC _ jEC a Գ6EC - *EC } O-EC  4.^EC U  T18EC E* x%3EC  5EC  c6EC N شZ6sEC j  7EC E  9EC  <= EC  \>EC  |?EC   8@ EC J KiEC ` LEC   LEC E $MEC   DTEC E hUEC  VWEC  XEC  ȶt]>EC 5 ^EC  _hEC _ (_!EC  HacEC Z hdMEC D  pBEC y `phEC _ pEC  BqEC  qnEC e $!rEC  DsEC  dt&EC ] tEC Q tEC U tXEC O tEC  xoEC f $xYEC P Dy&EC ] d y&EC ] &y'EC  -zEC U +z-EC d 8z!EC X 9zEC T $6zcEC Z DyzEC  d}EC | x}#EC Z {}EC  ~EC U ~EC U ~!EC X $~!EC X D~!EC X d~!EC X ~!EC X ~!EC X ~ EC W ~EC v e~*EC a $o~EC  D _EC V dJEC  BEC y & EC   ?EC E1 EC  *EC a (IEC @ HQEC H hYEC P (EC P !EC   EC G ŠHEC   [EC R ,(;EC 2  LCEC H p EC  ( EC P 'EC G EC O  EC G  {nEC e @ɵ9EC p `EC  vAC Z uEC  oEC f eEC  ,EC   1EC ( @7EC . `MEC D H<EC s dMEC D EC N EC  +0EC g  ;REC I @mEC  `ٽEC G ɽEC R ĽEC G EC y  EC T ]EC T $EC ~ DMEC  d(EC  6EC - 1EC  iEC ` EC Q EC  $EC  DQEC  dEC  EC S EC  WEC  [EC R @EC  $+EC b D& EC W d&:EC q @ EC W @ EC W @ EC W @!EC X AEC   $EC E HS/EC f  hbEC E  *EC E  EC B 5EC l  EC T EC   4cEC `:  XR&EC Q   |TEC E  EC E ^#EC  aEC    iEC E[ (O]EC T HMEC D hEC   EC E  JEC G  AcEC Z XEC O YEC P 0iEC ` P>EC G p.*EC ! 84EC k LEC H =REC I oEC H `EC  0EC H PEC S pEC  4EC +  EC i  EC E  *5EC E'  ;EC T  @EC E dEC   DyEC T\  ,EC T aEC X EC    EC  ,mEC  L(HEC  lPEC  ;EC 2 xEC o @ EC W @LEC C  lEC | ,EC G  LEC E  p-wEC Ei   EC E  *"EC E  "/EC E! &bEC Y  &'EC  (@(EC P l|,EC   T-EC E /WEC N 0EC z |0wEC n 0EC  01EC V P1EC M py1#EC Z |18EC o 1"EC Y 1wEC n 1REC I 33EC j 0233EC j PE3EC  p3eEC \ 24eEC \ w6EC   m7EC   ;EC  C"EC  0D;EC r PD;EC r pD>EC u E>EC u :EEC   -FEC  FEC  YGEC  0#IEC  PNEC  pQ*EC ! W>EC u WtEC k <[IEC @ e\#EC Z h\#EC Z 0k\EC  P\5EC l p]kEC b R]gEC ^ ]-EC $ ^;EC r ^;EC r ^EC  0g_EC  P_uEC l pS`EC  aEC  a)EC ` a6EC m a5EC l a<EC s 0b3EC j P*b]EC T pgb)EC ` pb;EC r b;EC r b6EC m b5EC l b<EC s 0b3EC j PczEC q pZc|EC s czEC q dgEC ^ WdcEC Z d2EC i d.EC e 0d;EC r Pd/EC f pdgEC ^ +eeEC \ pfEC  lh3EC j hEC  Bi"EC Y 0Di%EC \ PIi#EC Z pLiEC M Bi$EC  FjEC  kEC  hlEC y l~AC y 0(mEC  PnKEC B po"EC Y oEC R o EC W o EC W o EC W oVEC M 09oEC  Po}EC t ppVEC M >p^EC U |p,EC c p-EC d p,EC c p-EC d 0pEC   P)qEC E ts{EC r .t"EC Y 0t?EC 6 OwEC  $wEC I Vx/EC f <ex"EC Y \gx*EC a |qx*EC a {xEC M qxEC M gxEC O _xEC ~ xEC  <yEC  \{BEC y |9{EEC | ^{EC  {EC  KEC  EC   EC   < EC  \ EC | | EC   UEC L  ގ~EC u  yEC p >yEC p  ?EC  r@*EC ! |AEC  BEC  (EEC   HF5EC l  hF/EC E!  H8EC H'  IEC E LEC   IMMEC E? rN_EC V  8N+EC H  \SzEC El UAC Z  UEC J U#EC Z UEEC | (UwEC n  UEC  @UEC  `W?EC v  WEC E  ^<EC s ^<EC s ^_EC V ,`\EC S $ha_EC V DbbEC Y dcEC  TdEC  dEC   RekEC G[ iEC  UjYEC P (k0EC ' HlEC  hymEC  m0EC ' nEC  oEC  .pEC  qUEC L (rEC  HtHEC ? hv6EC - wFEC = #yEC  y^EC U yEC  zIEC @ (|EC  H5wEC n hJEC A EC } EC  _EC V ȁ<EC s KEC B (KEC B H:ZEC Q htZEC Q ZEC Q EC  ͈EC  ~iEC ` ǎEC  (`EC  HJEC A h;jEC a GEC > TEC K ZEC Q EC  EC  (QcEC Z HEC  hEC  }#EC Z EC  )EC  tEC k R0EC g (b4EC k HvPEC G hEC  E6EC m [5EC l pQEC H EC   EC  (gEC ^ H_EC  hC-EC d PEC  EC  ŬEC  HGEC ~ oEC  (߮|EC s H;GEC ~ hbEC  &EC  EC  fEC ] EC   ӽEC x ( 4EC  H wEC n  h EC E  >EC 5  EC    .EC %  EC   !?EC   ,!0EC H P!EC   p!,EC E !EC  ! nEC e !n-EC $ !{/EC &  "EC E 8">EC  X"ZEC Q x",EC # "EC   "JEC A "$2EC i "6 EC  # OEC F 8#OEC  X#-EC $ x#@EC w #@EC w #EC  # bEC Y  #&EC E  $EC G @$i*EC a `$sOEC F $^EC U  $EC G $~}EC t ${EC r %6wEC n $%EC V D%]EC T d%EC  %JEC  %pEC g %"EC  %$EC J &$EC J $&$LEC C D&%EC  d&'rEC i &(QEC H &)BEC y &5)8EC o &M)EC  ')EC  $'N*_EC V D'+EC  d's,<EC s ',fEC ] '-EC  '.xEC o '.REC I ( /pEC g $(p/EC  D(/EC  d(0EC  (17EC n (1EC   (M3EC E  (A4lEC c )4)EC ` ()4EC  H)5`EC W h)\5<EC s )x5(EC  )EC u -cEC  -bdEC V -adEC  .dEC M 8.dcEC Z X.!eEC  x.eMEC D .e EC  .fEC L .f$EC   .gaEC ES /h\EC S   33EC   3FEC = @3(EC  `3REC I 3!mEC d 3nEC  3)<EC s 3ErEC i 4EC x  4>EC u @4-EC $ `4#EC w 4AC Z 4\EC S 4EC } 4$EC  5|EC s  5EC  @5jEC  `5SEC J 5!lEC c 5mEC  5%EC  5ڟQEC H 6 5EC ,  6 AC Z @6EC  `6WEC N 6EC  6ʩyEC p 6#;EC r 6>EC  7?EC v  7QEC H @7OEC  `7wEC n 7Q8EC o 7iBEC y 79EC p 7EC  8tEC   8AoEC f @8EC  `8EC  8EC K 8wEC n 87|EC s 8EC Q 9EC Q  9UEC L @9#EC Z `9LEC C 9*EC a 9EC x 9VEC v 94EC k :ɱ6EC m  :߱EC V @:ޱ$EC [ `:#EC Z :0EC g :1EC h :<EC s :";EC r ;=>EC u  ;[EC  @;AC Z `;\EC S ;W<AC w ;s]EC T ;8EC o ;ȵEC K <EC   <~EC  @<"QEC H `<S EC W <SEC  <EC  <EC  <LEC  =EC   =5EC ,  @= EC E d=`EC W =EC  =uEC  =[ EC  =EEC  >EC  $>/UEC L D>dEC  d>EC } >@EC v >EC  >EC  >EC  ? EC  $?EC  D?vOEC F d?3EC j -ip- metadata2 policy_smqcache-smq smq_exit%policy_smqcache-smq smq_exitpolicy_mqcache-mq mq_init]%%%%%(%A%\%%mtysd&ide@&md&loop&ramdisk&device-mapper&mdp&dasdhR!dac960"&nbd)&ida>&ccissL&ubdR!ataraid_&drbdR!rbdR!emcpowerh&power2h&i2o_blockv&iseries/vd&gnbd&aoe&xvd&vdiskS!ps3disk&virtblk&mmc&blkext &fio'&mtip32xx1&vtmsA&skdO&scm(S!bcacheT&nvme@n&zvolz&VxDMP&8&W4&`4& k4&r4&w4& }4&4&4&4& 4&W4&4&4&@r4&w4& }4&4&@4& k4&@4&4&4&85& 4&4&5&+5&@5&L5&4&\5&l5&|5&5&@5&@ @ @ @@k&k&k&k&k&k&k&k&l& l&l&'l&3l&;l&Cl&Ll&[l&ml&yl&l&l&l&l&l&l&l&l&l&m&m&"m&/m&&ccissL&ubdR!ataraid_&drbdR!rbdR!emcpowerh&power2h&i2o_blockv&iseries/vd&gnbd&aoe&xvd&vdiskS!ps3disk&virtblk&mmc&blkext &fio'&mtip32xx1&vtmsA&skdO&scm(S!bcacheT&nvme@n&zvolz&VxDMP&8& z&'z&'z&' z&''z&'+z&'2z&'6z&'>z&'Bz&'Lz&'Pz&'Yz&']z&'dz&'hz&'qz&'uz&D'zz&P'z&t'z&t'i%t'z&'%'%'z&'z&'&'z&'z&'`z&'z&'z&'z&'z&'z&4 'z&4 'z&@ 'z&@ 'z&L 'z&L 'z&X 'z&X 'z&d 'z&p 'z&p 'z&| 'z&| 'z& '{& '{& '{& '{& '{& '{& ''{& '+{& '4{& ''t't'u'u'v'v'~'~'''''''''''''a{&BX& ''' ' ' ' ' ' ' ' '''''''''Z'Z'['['D'D'E'E'F'F'G'G'''''Y'Y'''''''''Ca{&CBX&C|&'Si&|&8&:?;?8&8&W8&X8&8& '`,"*,8&*,8&*,8& *,8&0*,8&@*0,8&P*`,8&`*,8&p*,8&*,8&*,8&* ,8&* ,8&*@ ,8&*` ,8&* ,8&* ,8&* ,8&* ,8& *!,8&0* !,8&@*@!,8&P*`!,8&`*!,8&p*!,8&*!,8&*!,8&*",8&* ",8&*@",8&*`",8&*",8&*",8&*",8&*",8& *#,8&0*@#,8&@*#,8&P*#,8&`*$,8&p*@$,8&*$,8&*$,8&*$,8&*$,8&*%,8&* %,8&*@%,8&*%,8&*%,8&*&,8& *0&,8&0*P&,8&@*&,8&P*&,8&`*&,8&p*&,8&*',8&* ',8&*@',8&*`',8&*',8&*',8&*',8&*',8&*(,8&* (,8& *@(,8&0*`(,8&@*(,8&P*(,8&`*(,8&p*(,8&*),8&*08&*08&* ),8&*@),8&*`),8&*),8&*),8&}&]&08&8&8&}&i}&}&}&}&}&}& ("}&@}&}&Ƴ}&}&ܳ~&C~&)~&A~&8&8&H~&U~&8&8&&lv_uuidLV UUIDo^~&lv_nameLV4X"lv_full_nameLV7"lv_pathPath<"lv_dm_pathDMPath'="lv_parentParentk8@" lv_layoutLayoutqq~& lv_roleRoleR|~& lv_initial_image_syncInitImgSync3" lv_image_syncedImgSynced͐" lv_mergingMerging" lv_convertingConverting~~& lv_allocation_policyAllocPol~& lv_allocation_lockedAllocLock " lv_fixed_minorFixMinxP" lv_skip_activationSkipAct՞" lv_autoactivationAutoAct="lv_when_fullWhenFullV"lv_activeActive۔~& lv_active_locallyActLocald" lv_active_remotelyActRemote " lv_active_exclusivelyActExcl\H" tlv_majorMajUp" xlv_minorMinU"@lv_read_aheadRaheadV"@lv_sizeLSize*T~&@lv_metadata_sizeMSize" seg_count#Segw~&originOrigind>P"&origin_uuidOrigin UUID>"@origin_sizeOSize0k" lv_ancestorsAncestorssB" lv_full_ancestorsFAncestorsCH" lv_descendantsDescendantsL" lv_full_descendantsFDescendantsvM" raid_mismatch_countMismatches{" raid_sync_actionSyncAction{H" raid_write_behindWBehindu|" raid_min_recovery_rateMinSync}" raid_max_recovery_rateMaxSync}" raidintegritymodeIntegMode@~& raidintegrityblocksizeIntegBlkSize& integritymismatchesIntegMismatchesX"move_pvMoveO"&move_pv_uuidMove UUIDO"convert_lvConvertP"&convert_lv_uuidConvert UUID QH"mirror_logLogL7"&mirror_log_uuidLog UUID7"data_lvData9"&data_lv_uuidData UUID9H"metadata_lvMeta:"&metadata_lv_uuidMeta UUID;"pool_lvPool<(#&pool_lv_uuidPool UUIDO<p#lv_tagsLV TagsI$4&lv_profileLProfilel/# lv_lockargsLLockArgs/#lv_timeCTimez #lv_time_removedRTimebH# lv_hostHostDp#lv_modulesModules.# lv_historicalHistoricalB& writecache_block_sizeWCacheBlkSizeɁ_& lv_kernel_majorKMajP1# lv_kernel_minorKMin1#@lv_kernel_read_aheadKRahead9WP#lv_permissionsLPermsגy& lv_suspendedSuspended& lv_live_tableLiveTablen# lv_inactive_tableInactiveTable# lv_device_openDevOpend&data_percentData%#snap_percentSnap%x0#metadata_percentMeta%h#copy_percentCpy%SyncJy#sync_percentCpy%SyncJy# cache_total_blocksCacheTotalBlocks& cache_used_blocksCacheUsedBlocksi& cache_dirty_blocksCacheDirtyBlocksݠ& cache_read_hitsCacheReadHitsQ& cache_read_missesCacheReadMissesš& cache_write_hitsCacheWriteHits9& cache_write_missesCacheWriteMisses,&kernel_cache_settingsKCacheSettings*#kernel_cache_policyKCachePolicy_,@& kernel_metadata_formatKMFmt,`#lv_health_statusHealth]& kernel_discardsKDiscardsi# lv_check_neededCheckNeededҝ# lv_merge_failedMergeFailedo& lv_snapshot_invalidSnapInvalidj#vdo_operating_modeVDOOperatingModeW(#vdo_compression_stateVDOCompressionStateXXX# vdo_index_stateVDOIndexStateY# vdo_used_sizeVDOUsedSizeY# vdo_saving_percentVDOSaving%Z# writecache_total_blocksWCacheTotalBlocks!& writecache_free_blocksWCacheFreeBlocks& writecache_writeback_blocksWCacheWritebackBlocks # writecache_errorWCacheErrors}Ā& lv_attrAttr>2@#pv_fmtFmt0݀&&pv_uuidPV UUIDp^~&@dev_sizeDevSizermh# pv_namePV &pv_majorMaj{ &pv_minorMin &@ pv_mda_freePMdaFreet#@ pv_mda_sizePMdaSize6u# pv_ext_vsnPExtVsnu&@ pe_start1st PER#@@pv_sizePSizel<&@@pv_freePFreePlP#@@pv_usedUsedk#@pv_attrAttr2@#@ pv_allocatableAllocatableՇ#@ pv_exportedExported9#@ pv_missingMissing#@ pv_pe_countPE4U@#@ pv_pe_alloc_countAlloc4Uh#@pv_tagsPV TagsI$4&@ pv_mda_count#PMda;q#@ pv_mda_used_count#PMdaUseq#@@pv_ba_startBA StartR#@@pv_ba_sizeBA SizeRP #@ pv_in_usePInUseY&@ pv_duplicateDuplicate #@pv_device_idDeviceIDl&@ pv_device_id_typeDeviceIDType #vg_fmtFmt@0݀&h&vg_uuidVG UUIDo^~&vg_nameVG&vg_attrAttr`3@# vg_permissionsVPermsb& vg_extendableExtendable& vg_exportedExported&& vg_autoactivationAutoAct # vg_partialPartialȁ& vg_allocation_policyAllocPolRށ& vg_clusteredClustered& vg_sharedShared &@vg_sizeVSize%[ #@vg_freeVFreen #vg_sysidSYS IDnH # vg_systemidSystem IDnH #vg_lock_typeLockType o # vg_lock_argsVLockArgso #@vg_extent_sizeExtRQ # vg_extent_count#Ext4U@# vg_free_countFree4U # max_lvMaxLV4U0 # max_pvMaxPV4Uh # pv_count#PV4U!& vg_missing_pv_count#PV Missing;t # lv_count#LV[w6& snap_count#SNWxE& (vg_seqnoSeq4U #vg_tagsVG TagsI$4&vg_profileVProfiles # vg_mda_count#VMda1r@ # vg_mda_used_count#VMdaUserh #@ vg_mda_freeVMdaFreev #@ vg_mda_sizeVMdaSizecv # vg_mda_copies#VMdaCps's #segtypeType3Z& stripes#Str]H # data_stripes#DStr]p #@reshape_lenRSize` # reshape_len_leRSizea # data_copies#Cpyfbn& data_offsetDOffc# new_data_offsetNOffDd8# parity_chunks#Pardp#@8stripe_sizeStripeRQ#@region_sizeRegionRQ#@chunk_sizeChunkf0# thin_count#Thinsp#discardsDiscardsIh# cache_metadata_formatCMFmtj# cache_modeCacheModei# zeroZero0# transaction_idTransId6gh# thin_idThIdg#@seg_startStart\\# seg_start_peStart\(#@seg_sizeSSizeep#@seg_size_peSSizeuf#seg_tagsSeg TagsI$4& seg_pe_rangesPE Rangesq"# seg_le_rangesLE Ranges#@#seg_metadata_le_rangesMetadata LE Ranges##devicesDevices5!# metadata_devicesMetadata Devs!#seg_monitorMonitor[X# cache_policyCachePolicyz-# cache_settingsCacheSettings_%# vdo_compressionVDOCompression,# vdo_deduplicationVDODeduplication# vdo_use_metadata_hintsVDOMetadataHints@# vdo_minimum_io_sizeVDOMinimumIOSize@h#@vdo_block_map_cache_sizeVDOBlockMapCacheSize_# vdo_block_map_era_lengthVDOBlockMapEraLength# vdo_use_sparse_indexVDOSparseIndex{&@vdo_index_memory_sizeVDOIndexMemorySizeN#@ vdo_slab_sizeVDOSlabSize=# vdo_ack_threadsVDOAckThreads0# vdo_bio_threadsVDOBioThreads^X# vdo_bio_rotationVDOBioRotation& vdo_cpu_threadsVDOCPUThreadş# vdo_hash_zone_threadsVDOHashZoneThreads# vdo_logical_threadsVDOLogicalThreads:# vdo_physical_threadsVDOPhysicalThreads# vdo_max_discardVDOMaxDiscard@#vdo_write_policyVDOWritePolicyx#@ vdo_header_sizeVDOHeaderSize# pvseg_startStart4U# pvseg_sizeSSize4U&devtype_nameDevType6# devtype_max_partitionsMaxPartsmU8# devtype_descriptionDescriptionԂ& log_seq_numSeq4U&log_typeLogType&log_contextContext&log_object_typeObjType & log_object_nameObjName5&(log_object_idObjIDJ&0log_object_groupObjGrp]&8log_object_group_idObjGrpIDs&@log_messageMsg& Hlog_errnoErrnoU& Llog_ret_codeRetCodeU&T&%&%҅& & ' @&`.,thin-pool@/,thin ?&L` 2  c ۰ٷ ٷ8z%xyHʏYMM'u$u&"#!E+, '(9%9Ƽ?)*5 2m-m3.mlҢL͠  fƣҥ 7E`!l& ' '8&8& helpHelp ' ?Help ' selectedSelected7% helpHelp ' ?Help '    - = J T ^  **o8 | @X+p,X o8*ooop*oo<(o U+0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p`+D       rmnone  report/dev/mapper/sys/LVM- ' '4& ' 'y& ' 'Z5& '& 'z5&* '4 '4&8 'B 'z&F 'g&3&P 'Z '[ '] 'g ' 'l 'v '&{ ' '& ' '& ' '% ' ''P 'Z '& ' 'y& ' 'Z5& '& 'z5&* '4 '4&8 'B 'z&F ' '3&P ' '[ ' ' ' ' ' '& + +0+0+@+@+P+P+BNNBV/UhVUD[hgS[o?n1o n#srs}O#sɘ4O8%?%M%A&W% &d%t%%%&cD@% %S&MDpS& & % 3B& k|& 6' &  &$8 $y& % &uD`@%cD%cD% ڕcDHI& % b=&"% %"H$F%UD0% ٗ&tD1& Ѭ&F9%"B$PI% Fx& Y% Fph% '& F@&"|% %"|%bD8h& L R$% $7F% 8&$F % F!&*D "% X#%D $%YD %% % F &%  '3% '&F (G%pD )c%0D@ *v%KD +%3DX ,~%-D( -H 2Dh .%$x /%hD0 0%KDF1%IDX 2 %UD 3%UDh 4 D 5%%FP 6=%"@MD 7L%UD 8[%iDl% 9 iD :X$ UD$ ;%D$ <% jD & =% 'qDD`& %>%D& ?x% 'DP' @t& pD( At&D@) BA%D) C%^pjD* D%pD@, E, YD - F% F`- G%cD(. H*% 'cD. I=% Y%eD/ Ja% F(1 Ko%ՖpcDh1 L%pD2 M%F3 N%F3 O%F4 P%Fx5 Q%F6 R %?F7 S%F@8 T9%Fx8 UN%F8 Vg%F 9 Wx%F9 X%F: Y%@F; Z%F@< [%F< \%F> ]%F? ^% '&F@ _ %FC `U& FE a%DPF b,% =%DI cI% @J DJ dZ% hK DK eJ& xN fp%bDN gw% xP hA& @ P i&" FP j~% Q k% Q l% xR m% R n% ' R ok|& S p% H q%"HT cDT r4%"U FU sF%"U FPV t& V u% :  W vk& xW w%  ŕW x% 0X y% XX z%d X {%? X |#& 0Y }&& z& Y ~%6DY & Z k|& [ % FS& {% F%%"@ F6%"@ F& H% N%m% l%uDq%\ {% F%2D\ %*DF%*DF% % %\ %4D] & @ X_ & /& FE&9D_ P` `DD^&KDx` q& п&WD&a &Fe & &cD&f & *&pD &i Xl YDl $&Fm 5&]DFA&DFZ&Dn b&|Do o&}Do &|DPp & 8& Fq & &^D&s & &dD&`u $& ;&dDQ&v c&"v `Dw v&"&dD8x &"BcDpx &"BDy & &lD&z & &lD&&X| 7& O&lDf&} y&"v lD} &"&lD~ & &F&~ &"&F8 &"B Fx & &D&&P 3& ٗ&uD D& @uDX @%VD S&xD`&ȅ w&D & FH &3D؊ &9D &VD &YD & Si& h &YD &@ ؑ & ` & 9&"B h )&"BaDh E&"BYDH [& cD n&cD ˴&sD f& '& & &YDH & 9D & &$ & fM& $9D خ &dKD  &KD h dYD &&YDp C&dFص a&F }&"D>D &>D  &?D@ &?Dؼ &cD` & &lD &"B|D &"B|Dx &D &D &D & H &ED 3&@ ( B&ED@ `&@ S&"D F X& Fc& Fm& FP& F U& H F z& &D &sD & 8&D0 D& & ~&  t& 4& @ & &lDp b&$D =&'D &  &lDh & &{D@ & &eD && p eD 4& p eD J& S& c&  l& }& & 8 & & P & & ( & & 0 p & &  & p   & p  & &"  & "   & "@  - & ; &D  B & P &DP  W & e &D  l & } &D@  n & &D  & &DH  & &D  & S&DH  & &D  & &D`   &D   &D  4 & $  C & WD P &  $0  a & @ YD`  u& n &D`  & &F  & n &F! & &ID &! & ! & @!%"B ! & uD! &"BuD8! &|D!&ٗ&3%R{&& &V&&:&M_c-&4&&4&04&:4&D4&N4&)u ) ,{Sʕeؖ!EY8E$~CNO2TUZfc`qq[r=&=&=&8&8&RD&Si&&XD&%&8&%_D&8&jD&38&N&nD&.&o&&ٗ&^G&[V&n&o&&&&*&h&d&M&jG&eG&zG&uG&#H&G&G&ױ&G&G&&W&S&6'M&&e&&&G&G&п&&G&G&G&G&G&G&G&G&H& H&H&i&D&&&H&Pb&/H&%%GGHH%rH%%%%GV WHW^XWV%%%HIVII%I%%JvLMJJKKLJK%%LYO0MiMMNN-N%%OQPhPPPkQ%2Q%%R]T>RwRR;SSS%%%%U%T!U%U%%%%XoZX4YY6Z%%%%%%%%%%%%%%%%S',-J))f91/<O?+@W>>$?j&j&j&ױn9wcyj &[&p&*p&pp&p&p&֬p&֬p&֬p&֬p&֬q&֬q&֬*q&֬?q&֬Nq&֬aq&֬sq&֬q&q&֬q&֬q&֬q& q& q&q&q&q&M&Mr&r& r&֬-r&֬?r&֬Nr&֬br&vr&r&r&5r&n &ܤ&r&Nr&r&r&r&W& s&s&+s&s&2's&x8s&@s&Ms&Us&`s&dls&ts&Gs&s&`s&֬%֬s& !s& [s&s&֬s&֬s&֬t&֬t&֬6t& J%t& 2t& Ct& QPt& u&֬]t&֬ot&֬t&֬t&֬t&֬t&֬t&֬t&֬t&֬ u&֬u&v*u&֬:u&֬Ju&֬^u&֬qu&֬u&֬u&֬u&֬u&֬u&֬u&֬v&֬ v&Bv&&79&&#v&֬,v&֬5v&Av&EMv&֬@7&@Xv&@`v&@hv&8@pv&v@xv&֬@v&֬@v&֬@v&@v&@v&%@v&\@v&@v&@v&@v&֬@w&֬@w&@@w&o0w&7w&&?w&OGw&֬Vw&֬dw&֬pw&֬w&֬w&֬w&֬w&֬w&w&w& w&Dw&{w&w&x&#x&VZ:&a:&0x&%x&9x&"Bx&[Mx&Vx&^x&]ix&vx&4x&mx&x&".N&`&;x&kx&Kx&{l:&x&x&x& o&P&0V& x&JT&,% x%`&@V&x& &=y&{z&y& y&)y&P7y&Ey&%.\y&xmy&t&֬t&֬yy&֬y&֬%֬%֬y&֬y&֬9%֬y&֬y&֬x%֬%֬%֬%֬%֬%֬%֬ %֬%֬y&֬ & z&<8&֬{3&&M%[{&&'&'}X&'}X&'&'&'h&''h&''%'%'Yw&'Yw&'}X&'}X&'&'&'L&'L&'&'&'a{& <&k{&BX&z&'v{&{&{&'{&{&'{&{&'{&{&'&'&'&'&'{& &'{& &'{&{&'{&{&'{&%{&'{&%{&'{&%{&'{&%{&'{&%{&'{&%{&'{&j&'{&j&'|&&'|&&'.%'.%'|&'|&2|&'|&'|&2|&'7|&N|&]|&'7|&N|&]|&'J&'J&'f|&&'f|&&'`&'`&'v|&i}&'v|&i}&'&'&'&'&'&'&'&'&'a{& <&k{&BX&z&'|&|&|&s&'&Si&|&|&|&|&|&8&M%8&M%8&M%8&M%8&M%8&M%),),),),),8&8&*,*,+,+,+,+,(+,(+,),j&8&h,,h,,,,,,,,,,,,,,Ӽ*Z>iIxifH',_W!8Z_S_M&[&&[&[&&%e&%E&0,0,r* jrjr?M&3&V&Z&g&V&s&&V&&u&&&B˔&&&&&gʔ&Ҕ&ܔ&&˔&&IJl&& IJ&& IJV&& IJ-&& ۲&& %&,&IJ?&N&h&w&~&&&&&ȕ&b#ҕ&ߕ&&&&&&&&2&>&%&_1&9&&&&K&W&_&q&H}&&&ŭ&&&ɵ&&&-+& &ɖ&֖&ߖ&&ر& &&N*&3&F&5U&`&e& ơv&{%&!IJ&c#&"l&Hc#&#ֳ&c#&$&ė&͗&ޗ&%&&&&w&-&B&'W&h& &(\n&n&u&)&c#&*&&&+Ƙ&ј&ޘ&,&&&-T&"&9&..H&d#S&/b&`d#m&0 z&d#&1&-"&&&d#&&e#Ι&ٙ& h#&& h#&&h# &&`i# &,&i#6&B&i#L& V&#j#^& i&m#r& &n#& &o#& &p#ǚ&Қ&r#ۚ&&s#&&Xv#&6&v#L&Z&0w#f&t& &&& &Л&& y#&&&#&-&y#5&H&Pz#Y&i&z#P&w&H{#&&-&&Ȝ&.0|#՜&&ȃ#&&#%&7&8#G& R& #[&!m&H#}&"&#&#& X#&$&@#ŝ&%ҝ&H#ݝ&&&#&'&0X# &(&#/&)J&#>&*J&Џ#T&+i&P#|&,&#&-&#&.מ&#&/& #&0/&F&W&1m&#&2&#&3&8#&4ɟ&@#ן&5&0#&6&`#&7&##&8/&#9&9G&#S&:`&#k&;x&$`#&<&X#&=&&&>ʠ&#ܠ&?&p#&@&Л#&A &0#0&B>&p#J&C[& #j&D}&#&E&X#&F&Т#á&G͡&0#&Hա&#&I&x#&J&#&K+&#5&LA&p#K&M\&P#k&Nz&#&O&#&P&P#&QŢ&#Ѣ&R&8#&S&# &T&(#&U.&h#;&VJ&#W&Wf& #s&X&#ݨ&Y&@#_&Z&в#&[ɣ&)#٣&\&&] & ȴ#&^.&#A&_W&#&`k&#u&a&'#&b&#&cڤ&ظ#&d &#&e*&#5&fA&#K&g]&@#|&hm& #w&i&#&j&/#&k& #&lΥ&,#Ӣ&mݥ&x#&n&(#&o&##&p,&3&L&qY&H#d&rr&8#~&s&#&t&#&u&#Φ&vߦ&h#&w&#&x#&#4&yH&@#Z&zh&#t&{`&#&|&8#&}&+#&~&X#ȧ&է&h#&& &&&&(#5&D&F&1&Q&"0#X&g&@#t&&#&&#&&h#&ʨ&#ب&&#& &#&$&!#,&9&H#D&T&#b&o&#z&&@#&& #&&#&&Ʃ&&&&h# &&(#$&4&#B&S&#b&z&h#&&#&ɪ&#֪&&#@&&#&&*8#&&(&6&B&Q&^&l&x&& &&+&Ϋ&*&&&&&<&P&b&x&&&&&(&a&#Ǭ&aϬ&`#լ&A&@#&A&#&b,&@$9&nH&$U&be&F&s&c&H$&c&p$&c&$&Cŭ&x$ϭ&Cޭ&$&d&$&e &$&E(&ڢ&f9&$@&fJ&8 $&fJ&&hQ&X&&H& $&Hl&8 $v&?"&&i& $&i&P $&i&ʮ&i`&x $֮&I`&x$&l&$&l&$1&l=&$s&lG& $N&l_&n&&L&p$&M&$&j&$&k˯&$߯&K&$&m&P$&m&P$)&M:& $$?&nI&h%$P&n[&h&$d&nv&&$&n&&o&'$&O&*$°&pٰ&x+$&p&H,$ &P&,$ &P3&D&qN&x-$V&rd&%-$p&r}&.$&R&&Ra&.$&s&/$&sձ&3$&s&h9$&s&&S&9$&t!&<$5&T(&H=$/&B&>$S&u\&H@$c&u\&@$o&U|&&vJ&B$f&V&&V& C$&WҲ&E$&x&H$&x&I$&yJ&xI$%&Z.&J$5&-"&?&8&H&V&c&r&&&&&&г&&&&&5&K&`& r&& && Ŵ&۴& && &&&&8&M&a&z&&&&׵&&&&)&:&L&]&r&&&&&ȶ&޶&&&&-&A&U&h&{&&&·&ѷ&߷& &&!&5&"P&j&#8&t&8&}&o&&&&ױ&&*&&&^&h&&v&Ÿ&&͸& &ٸ& && && & & G&&п&&G&'&G&1&G&;&&F&Si&P&`&Y&&h&Pb&v&8&&ٗ&&&&ù&ӹ&&&&&/&?&U&g&|&&&& ˺&ٺ& && &+& @&Q& e&u&&M$&M$&N$(N$ٻ&&&&PN$)&G&d&}&&&&ϼ&&&&#&<&xN$N$N$N$O$Q&8O$n&&&`O$ &O$!O$O$"P$(P$#PP$׽&$&pP$%P$P$&P$ &'#&Q$(@Q$9&)R&hQ$*g&&+&Q$,Q$Q$-R$8R$.pR$R$/&R$0R$S$1@S$hS$2S$S$3S$Ծ&4&&5& T$6PT$.&7E&X&8l&|&9&&:&T$;T$ֿ&<&&=&$&>?&U$?8U$V&@l&`U$AU$U$BU$~&C&&D&&E&&F &&G3&F&HY&h&I}&V$J@V$&K&&L&&M&&N&(&O<&L&Pb&t&Q&&R&&S&&T&&U&.&VC&T&Wg&v&X&&Y&&Z&`V$[V$&\&&]&$&^@&X&_u&&`&&a&&b&&c&&d&,&e?&N&fd&v&g&&h&&i&&j&&k&&l#&0&mC&R&ng&x&o&&p&&q&&r& &s%&:&tQ&d&u&&v&&w&&x&"&y8&J&z`&r&{&&|&&}&&~& & &2&C&P&i&~&&&&&&&&&$&2&G&X&i&v&&&&&&& & &4&D&Z&l&}&&&&&&&& &&3&D&T&`&s&&&&&&ZR&&V$B`&V$BLK&V$BR&W$B`&&&KS&&B1 !&0W$B