ELF>@@@8 @99@@@YSYSIIPPP  $$Std PtdȃȃȃQtdRtdPPPGNUGNUWݧ[tz0 @J\Bbz}~ pvXS5 mK=$SmC^? [摪`V.~Pi"߾KICVFxM %}=< gvSj`aW4,5\@ v#|cflYgT1 NI{ 7gp2, oiMF"!+x0^ o@) 9+]*P+ .*Q*)zP*sW@,P)))0*B0+)UPfH`+zp)__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizefinfo_objects_new_emalloc__memset_chkzend_object_std_initobject_properties_initmagic_close_efreezend_object_std_dtormagic_versionap_php_snprintfphp_info_print_table_startphp_info_print_table_rowphp_info_print_table_end__stack_chk_failzend_parse_parameters_emalloc_16magic_openmagic_loadzend_restore_error_handlingphp_check_open_basedirexecutor_globalszend_replace_error_handlingexpand_filepath_with_modephp_error_docrefzend_throw_exceptionzend_parse_method_parametersmagic_setflagsmagic_errormagic_errnozend_throw_errormagic_bufferstrlenmemcpyphp_file_le_pstreamphp_file_le_streamzend_fetch_resource2_ex_php_stream_tell_php_stream_seekmagic_streamphp_stream_locate_url_wrapperphp_le_stream_contextzend_fetch_resource_ex_php_stream_open_wrapper_ex_php_stream_stat_php_stream_freefile_globalsphp_stream_context_alloczend_zval_value_namezend_argument_type_errorzend_argument_must_not_be_empty_errorzend_string_init_internedstd_object_handlerszend_register_internal_class_with_flagszend_register_long_constantget_modulestrrchrzend_spprintfaccessstrstrstrcmp__ctype_b_loc__isoc23_strtoul__ctype_tolower_loc_php_stream_write__errno_location_ereallocstrchr_ecalloc_emalloc_160stderr__fprintf_chkzend_error_noreturn__printf_chkfputc_php_stream_get_line__isoc23_strtolstrncmpmemcmp_emalloc_large__isoc23_strtoullstrtodpcre_get_compiled_regex_cachefwriteqsort_php_stream_opendir_php_stream_readdir_estrndup_php_stream_read_emalloc_40_estrdupgetenvfstatlseekmktimememsetstrlcpystrerrorzend_vspprintf_php_stream_castpcre_get_compiled_regex_cache_exphp_pcre_replace_impl_emalloc_24__isoc23_sscanffcntlmemchrmagic_compilemagic_checkmagic_listmagic_descriptormagic_filemagic_getflagsmagic_setparammagic_getparam__vasprintf_chkgmtime_rasctime_rstrcspnlocaltime_rstrftimefputszend_str_tolower_dup__ctype_toupper_locphp_pcre_pce_rephp_pcre_create_match_dataphp_pcre_mctxpcre2_match_8php_pcre_free_match_dataphp_pcre_match_implzval_ptr_dtorzend_hash_index_findzend_memnstr_exlibc.so.6fileinfo.soGLIBC_2.3.4GLIBC_2.8GLIBC_2.14GLIBC_2.33GLIBC_2.4GLIBC_2.38GLIBC_2.2.5GLIBC_2.3   |ti ii ii ui ii PPXPP`hPQpۡZZˡ0T`hPQp]@š0TաZ@ (Z0PXZ``ϡ @ϡX`xϡ ϡ8@Xϡ 8`hϡ ϡ`hϡ?lPl l(8 chx˧ѧ٧ ,9(J8_HoXhxĨJ#-4=BGMV^ c(g0k8s@{HPX`hpxũΩ֩۩ߩ0ɰ8԰@߰ %, 9(N0Cp`xz ,C9  ϱ ( 0  8 @ ,H %P CX N` h    %    N      "  0  I  N @H`Pp[p@Nx ?GZhjqy( 0 8 @ H P X ` h  p  x                      ! "( #0 $8 %@ &H 'P (X )` *h +p ,x - . / 0 1 2 3 4 5 6 7 8 9 : ; < =>@AB C(D0E8F@HHIPJXK`LhMpNxOPQRSTUVWXY[\]^_`abcd e(f0g8i@kHlPmXn`ohpprxstuvwxHHσHtH5˃%˃@hfhfhfhfhfhfhfhrfhbfh Rfh Bfh 2fh "fh fhfhfhfhfhfhfhfhfhfhrfhbfhRfhBfh2fh"fhfhfhfh fh!fh"fh#fh$fh%fh&fh'rfh(bfh)Rfh*Bfh+2fh,"fh-fh.fh/fh0fh1fh2fh3fh4fh5fh6fh7rfh8bfh9Rfh:Bfh;2fh<"fh=fh>fh?fh@fhAfhBfhCfhDfhEfhFfhGrfhHbfhIRfhJBfhK2fhL"fhMfhNfhOfhPfhQfhRfhSfhTfhUfhVfhWrfhXbfhYRfhZBfh[2fh\"fh]fh^fh_fh`fhafhbfhcfhdfhefhffhgrfhhbfhiRfhjBfhk2fhl"fhmfhnfhof%ȃfD%ăfD%ăfD%ăfD%ăfD%ăfD%ăfD%ăfD%ăfD%ăfD%ăfD%ăfD%ăfD%~ăfD%văfD%năfD%făfD%^ăfD%VăfD%NăfD%FăfD%>ăfD%6ăfD%.ăfD%&ăfD%ăfD%ăfD%ăfD%ăfD%ÃfD%ÃfD%ÃfD%ÃfD%ÃfD%ÃfD%ÃfD%ÃfD%ÃfD%ÃfD%ÃfD%ÃfD%ÃfD%ÃfD%ÃfD%ÃfD%~ÃfD%vÃfD%nÃfD%fÃfD%^ÃfD%VÃfD%NÃfD%FÃfD%>ÃfD%6ÃfD%.ÃfD%&ÃfD%ÃfD%ÃfD%ÃfD%ÃfD%ƒfD%ƒfD%ƒfD%ƒfD%ƒfD%ƒfD%ƒfD%ƒfD%ƒfD%ƒfD%ƒfD%ƒfD%ƒfD%ƒfD%ƒfD%ƒfD%~ƒfD%vƒfD%nƒfD%fƒfD%^ƒfD%VƒfD%NƒfD%FƒfD%>ƒfD%6ƒfD%.ƒfD%&ƒfD%ƒfD%ƒfD%ƒfD%ƒfD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%fD%~fD%vfD%nfD%ffDUHSH]HdH%(HE1H]H߉1E1HlQH5mQ1HڿH5hQzUHEdH+%(t!H[]H11HeH{UH MHHHu1H5P1g~yH5Q11=aH Q11sE1 0-H5e1H5P11)1H_1H(H=HH9tHHt H=H5H)HH?HHHtHHtfD=u+UH=zHt H=d}]wUHATISG_ )HcHH@H.Hٺ1H,LHXH}LHH[A\]f.UHSHHHGHtHxH{HH]UHAUATSHH $HHdH%(HE1HI,HDž{(HDžHDž HH1E1LH5QNtrHHDžgHHH85HCHHHIMHIEHXHEdH+%(uHH[A\A]]fHHt?kMt!HiH"HmAD$fHHLH56MLk OH[ H1HCHHx%H{HCH&H=ɽDHXI$AD$fDHE111HHHt HNM HUHHTH.H11HFLMHHHUHAUATSHHw H(LѼdH%(HE1(t1,1HMLMHKt5HEHL`MI|$ut.HEI$CHEdH+%(u H([A\A]]I|$I|$IHMM1AH`1CfUHAWAVAUATISHdH%(HE1HdirectorHDžHEyfEƋG,HDžHDž1(LA_HH1RHHRHLRHJ%H HHLpMIFHHHAgA"HHHHHHH}Hx IHHLIHqiIGIIMoCD/M<$AD$HtA6H]SHEdH+%(He[A\A]A^A_]fHw HH5FI1tHG<9< 3A߿1HH HE1HAAHDH5_XIH`H\11LIMHLN1LLH*HIfDHLLLHHIA ALA)DMLMLXI91HLHtuHfHH5GIH1ɺH5GIHH HLLLLIM1HVG1AD$TfHIHAHHHH@HL= MG8MIG8I 9@t/LHMmfAD$fHL!LHHLLLHIIAHZ11yAD$gvH5ZH1BfD1ɺp11cMff.fUAHSHHHdH%(HE1HHH=E 1HHHHHHHEHUdH+%(uH]UHSH\HAH Hh H=EH1HcHooHoP oX0o`@ohP)Xop`oxp) Woo)P)YooH)%K)-THH)5O)=X)a) j)s)|´HôHȴ;AعH= DAع H=DAعH=DAعH=CAعH=CAع H=CAعH=CiAع H=CKAعH=C-AعH=CH]1UHSHH5CHUH,H +dH%(HE1tCHEdH+%(uH]H屃@UHAVAAUATSH HL,7HE1!fDLE1~AHMd I9tuHII9uI|$$IHOH@a=VaH@5CaHL`@~~usftHJHHQL9t uHJH|HQL9uHD~At DiHJAt DmHDHH[A\A]A^]DLH H`fo`@~H@@/:@$~$%@ wH`@HcH>fDf.@^t1@|D1Dff.f.f.f.Ht[UHnHSHHH?H9t HtHH]fH{HtrH{ Htdfff.@UHAVAUIATISHdH%(HE1tL/kHPHLEA}LL HeHr8uHAHL9rH9r+H8tHHH9r8tHH8uHLuD)AD$DteL1ML eH@:H}оt'Ad$DHEHUdH+%(uuH[A\A]A^]ÐH}7L1ML dHA@H5<@LHuHȀxHHuL9HH)@H6H?AUHATISHSHHQtC<wt3s1Dqu<4t:X<1tD<2t01[A\]HI$[A\]@HDf<8uDfUHAWAVAUIATSH(L6dH%(HE1AF CA~-pD"HEHIfDDcHEIDB uA+A)EHxIHCHxDB u1HHkH=HtIDQ AF1҄u A~ /HEdH+%(H([A\A]A^A_]D<-t&AH5=L1f.Ef H%ANH5P1mHH5=L1WAF AFHIN A谯H5PLH1vHH5_=L11ɺ/H5PL@UHAVAUATISHD3L(CDut;HBut3bwCH<HI$[A\A]A^]LAuu'Ls[HAD]t/HLLff.UHAWAVIAUATIԺSHLHdH%(HE1IHLE11ɺH5I<bIHHP1/xHHHYLHPHC(HXH=xu|D{(HsLMixLL9u]D{,Hs LMixLL9u>L1L/HEdH+%(uWHĈ[A\A]A^A_]@LH;L01}qLHM;L01[@x]UHSHHHcHDBu4CvC7BH]DCH]CH]øf@tzA<9wAHI( qHLuIPHcLu Ht HfDHGD@tU1H5:HH]DHHUHHAWAVAUIATSHHx-HHL#D{ Mt8CD9t0PfHSAoMA AEH[A\A]A^A_]ELHMIIL#HMHIt9{L HI9HB1AH)HL#CD{ nHLH[A\A]A^A_]EDHtcUHAUIATSHH_H9t%fIH[I|$HtLI9uI}HtHL[A\A]]mDUHHAWAVAUATMSHH}HMȅt HixHJ;LmEuEzHf.EuIExIDP uEuEHL;eLGeE1Mt=EHIH6FtzIFt;Gt=Et M9uL;}twvAHAH A uEfDE(tB;M1H[A\A]A^A_]fH} AHpL;}uU(t HEDHE@D@tHMHUM1H}H57H} HnHMHUEH5SKH}E(SILm u 1E1HUH}H5071iM(t HHELMȋMI1HUH}H5IJ,HUH}H5sJ1fUIH 6FH6AHjQH 4QHщjPkfUIH 6FH6A0HjQH 4QHщj+fUIH g6FH6A8HjQH 4QHщj@fHtWUHSHHH?SH{JH{0Ht H{ HtH{HtHH]ff.@U0HATASHDHH輽HC0HC HC(HC HCHtpfH\5CHHCPH@Rfo]RHHC@HCXHǃ(ǃ [A\]H1H[A\]UHSHHO v'A<-A<*weHnRHcH>Hu9 W TH]HAHWHHSHHDS>wE J߀H5uRHc H>@CSD>v@^xw1f.fHS +t`-/KHHHHN€H]HDCD%S H +uSHHHN€H]HH cK HC 1\G$7w>HHu47u+]t.fDPHt]utHHHuHHD1Ҹ HHHDHH+S DƒtD^t{t vHt}uaY*SHºHHN€H]Hf.xu2H SH)кHHN€H]H@HHHH1HH81wH5P11@fD1H5D11MHB1H1H0ff.UHATSHwH?sH;I1I9tL9҃[A\]UHAWAVAUAATSH(LH}L9CIwE11H fDHixIHWD2A\$EHH9rmJAutAAMixIEMixIAutAAMixIZH9HixEMixHIf;uMixAN DZL)DwLELMLMLEDHH5/1IIcIwH9ML9}H([A\A]A^A_]fHixf<tA\$IH9rML9}DAAOEAMixIM7ff.fFuvMDH@UHAWAVL5aMAUIATLfSHHAL4IHHCHE|$HAG<^vL\AG<LIcL>f@v@nuft]bMav=rf-E|$EAH[A\A]A^A_]AH-L14tLH1u'fNHHtIAL xHt H)HH2ftVHNHtxHt HH)HHH9r H1HH HH9u1HtHHff.fNtSw9t?t2U1H-@1H軋H]fu@fUHAWAVAUATSHH $HH $HH@HӉ4H5I)HP1LHE1dH%(HE1HWPHHxH* HHfHDžXHpL@Hh)@ID$XHp HhHxTIHHHID8 u HXA\LfIHx>tLD49[`sL詘0`H-H DEAF`Hix )ȃ~LH5>1DHD9RDAFHix1L4I~LIIdžpHH)xH`fAȋXA~A}&LA9(fu AF/LA?-uIANLH1LHaLAF M9AFLpI]xIH8H1@I]ILDZ uH8tHL=Kf.HLLBuLHDP jI_ IHuAG`AF HIT$J =tHB D;EH 1H0D{HEHIDF uH tHAuHLLkH(II_0I HtHLL5uLHAGAF„ `AN-!H5;L1GHPID$XHA~:>HE1L-#&LL`HXIFL(MIMLIHSL9sLLL{HIMuL`L(HA)L11LHPID$XHM1L胔 HHHHLLAHHtHHH@H1HxtHEdH+%(aH [A\A]A^A_]AFfA~E}D@,A,AVAuIUHV1 H=@DHcH>AD$D@H5%L(H HHNIH(IIf.Mo0I MtLLHuuLHAGAF„`<-!ȄIHAF ;~7En1AFA AF;AA;XH bLDAD$D@HH5l9L1fANIQHʉ΃DAVAy&LIANL7fMMANLAFIEE}HIA~uIEAN@E}HIAtAFIEE}HIA(uIEANE}HI HAH6DFuZA-tTIEHA)u!A~xIIEA})HtAD$D@H57L1賬n1HLAFHL9LD8I@IHSHxHHHHHǀpH)1xHH Dž`H1kHLML(ML` H=KHHHLHPH)ITPHPv@DH HixHrHHy AV HDof0HPmH8LhLAEAr ANH1D{HADF tHmHL0AF„H`-!5E~Lk{=LAD$D@t9AH5kL1蛥VfDE~Lk{=LyLkLiAD$D@@LH5%01FAD$D@LH5L1!@IAD$D@AH5qL1Et AD@h 1HHH`H`AFQ HAHZ@D{I$A/APAu1M]I^ 4L@0#0MN!MLH`IMH(1LHHLDL=[HHH]HEMLIEfE'IAH`AIVHDx H(I92\uAwMoA@xwH 9:@HcD0EADP@H=-H M_LM@AvHL+DkEHIHDB u EgLkAFxL&& %AG0M_0- IW AG0M_I LA A~ AFHS% AFyA~ AFHS%AFUANHSGANHS9AN HS(A~ AFHS%AFA~ ANHSANHSAN HSANHSAF 6AFHS%AFA~ AFHS%AFqAN@HS`ANHSRAN@HSD;D(:0'& fD{Dx I@_ gHAD$D@QAFAN< <   <U <, H5,L1fHHHZAANIUA]HAƆAD$D@ IH5!L1諟AIH`uPH%uAN;H3H(<XLh q L-uPHH0Hٿ0HHHDptqHHDpu.#stfA]I%uH(H|H`H56,HL1`HAD$D@HH5X)L1.LH?(LR`HLbxLHLAFH)AV< QL<M3f.+H1LHQIAFuAvHLIF HL9^ AFHHƒ9<H56HP1輯M,$XZAE IŠH5g(LHHtmI9t!HH)HtJHH]ÐtHu fuHH]H11RHˉff.UHAWAVAUATSH(HGHuHUL`HEL9tUI\$M,$HtDž1H5LDJ HDH 1H5LxJDI1H5-LDHJHDG1H5KLJDvL!LS脍@UHAVAUATASHHooNoV o^0dH%(HE1of@onP)ov`) )0)@HDžHDžHDžHDžHDž)P)`)po~pooooH)}H)E)MH)U)]|HPu HHwt HHHHEHLPHLHHLL6Y^AŅu.H"HEdH+%(uGHeD[A\A]A^]HLHATHLLHAXZ觋UHAVAUIATMSH7HoGoJOoR W(oZ0_8ob@gHojPoXor`whozpxoLLHǃHǃHǃ[A\A]A^]Lst L襏uH{1HCHǃHI)AHwff.UHSHHH蔍HǃHǃH]HHUHSHHG %=HHC8H9HGHHto HHHs8H+1H;_HtYHH;H9u;1H]HH褌HǃH脌HǃHǃUIHSHHH?HHdH%(HE1HBzՔHHH 2HHH)HiрH)HHHHCHHH HH?HH)IHL)HH)LHLȉMH?J4 HH)LHHH)HH)ЉEH*HHH?HHH)HIHH)H'h0?rIuH/H)DAAA1Afmu3Di)\¾nEAA(\wA1A ף@ƁmA9uHcH)E¿1L NA9|LH)H t@AAF[x1II~HWL9uH~1H([A\A]A^A_]HM1f1IVAF xfUHHAWMAVAUATMSH(HUH AIAHH}HHuMcHc(MgIGMwHHLWwIHE1E1yp@I7LEALH}LL9uOHEHcہ=!@HuÉ  IxUMI'tM;grrfI?IGAGvIH([A\A]A^A_]@H(1[A\A]A^A_]1f1IGAGvff.@UHIHL‹v8IDHLELMI9sH:tL]GHLH]qUHAWIAVIAUATASHHN^0H}HuLAMcLmHMHǾHEIII~uIHdLvIHH}>VMIULEILeIMHEE1ME1MMMHEf.HEHcHHcHHLHsHUH}LMHHML]L]LMH9EMt5LHEHLHDI>HHHHWI9uI=uÉ  IL9]tHMH}''LEI>LEgtH}^toHH[A\A]A^A_]ÐLEtL,tHH1[A\A]A^A_]I~t1MHIHHHHswf.UAHAWAVIAUATSH(N^rH([A\A]A^A_]H(1[A\A]A^A_]HgUIHSLHIHqHteH I1HQBHHˆH9t@:uH9t6HHHHIHxxD@|IH]LLHf1HCCqH1H]ff.UHAUIHATASHHNnIIEHtHHIMD L:HHLxIHtAPB1D9t3IHul1H[A\A]]fHQI9tHAHD, fAADEE9tAD9uUHAWAVMAUIպATMSHHHuL}H}LHM~kHMHHHI$HxD@|HxC8I9s$I>tHuHLH[A\A]A^A_]AH}HLH[A\A]A^A_]cfAAGH[A\A]A^A_]fUHaHuPfDUH]HuPfDUHAWAVAUATSLHhHMLM?AHHwIJ "HAH9HwH)IH9=D8u%DAAAA EAE D=HHEH9|H)I9pAuЉ  HuL]H>H=*?AHEMLUL(I*KtmHlLUL]HHuHHuL.HH RLHHI3HEHENl&I9HEIKH9ISH)HH9MYH]E1f.JO$IDH9^IKH)H9M6AD]ȁ Ã0H}HHL)H9LMHEATIH)߁}J4IgHAFA.I}Su AA ED AIVHu%%GwH=ՂHcH>EifFIM9I3IKEuHEHH)HvÁ}HHVIfEuHEHH)Hv}QFI|IM9uHI95HuL]LmJtAE1EHډHVƒIIHM96M9HHI9r<Au$AAAED D HI9sfH]HEH8kHEHHEHHfHh[A\A]A^A_]EcVfDA‰  I` AA ED ʉVȉ @ fDH]fHEH8DHEHH)H}fFffFoHELxLUH8HELEHUH)HMHEHELMI*`K4ILMHgLMHMHHULELULx4HuHHuLHuHHugHEHfDHiHE1HHEHIHHIHIH EHIH@H I(L I0HEH HH AHL HH H8xЉ  vԈӈfv~fDHh1[A\A]A^A_]LmL]H]HEH]H8UHATSHLdH%(HE1HGHGH\H/RAIHIс=1IfACHzfBACfBAoCBACHEAAII$AS,LMLHLHUdH+%(H[A\]fDIyшfAASfAAASfAAAoKAItASHE  AAII$AC,Љ  @{b!cfDUHAWE1AVIAUIATSHHH^H^H5/HH߉@HH9rIu ̈ˈfuHMIGIHEIIII,gIHlLp1LHELcH}IuHM?HFH9*.HME1E1LmI؉EL3@1Hf8M9LHVHLHLI9LH~HLfHL}fI9VH~PQI9iHVHHXHQf eDRfA9DGAfDLOM9'E1ftfDB_fB\XIL9uE1MIfBLPHM9HM@ADfAI9~xH~QI9H^IHII(H0LUII IHULUDHULLUL]HIL IDUEHL HL DUHL DUHL DUHL HHME1fDL91HH[A\A]A^A_]LE1E1߸ff.fUB HPBPB PB PB PB PB PBPDJ1DBH_@HI1HfHHHt"9uHLHLH1_@HL1o_ff.@HBzՔUHAWAVIHHAUATSL$2H?II)HH}HLHLH?J"HH)HHHH?H<HH)H*HHH?HH)HRHH)IHH}LE1L ޽MIH؉IHH?HHH)HHH)LH)1b^AIcL9rHD[A\A]A^A_]DLH}LILH)H?HDLHH)HHH)HDH)1]AfDH}HL1H]HcIL9rHELH)HL D1LLM]AIcL9>HELLMH)Hff.@H1Hu(DHH9tDJfEuHÐH 0HIHHL9HLBDL0AI0AL9saAEyR1EtFLJ1LLDHDDHHL H9uAEML)H9rMM9rDfHt[H<uBHtD"HHDDBDH9s<x@f.UHAUIATISHHuHIUpHhdH%(HE1HEHIDGtRƒtF C AE8HEftHI9r)HIMQHUdH+%(uH[A\A]]f[@UHAWAVAUATSHHLohHWpH(H8LdH%(HE1HDž8$AAƃA$HDL@H4L$^H(H H(CDL[H(LHH YL H(LIʅA =(L _H(HDAtHL E1fDKHILDBAHDAuCD_DL9t1 @HUdH+%(xHe[A\A]A^A_]fL8IBH MAIwHLEE1EufDIM9C|-H}wC (H1H)LL(;YL(fHMMH HaH LǂH8(1]XZ=DL@Dᾀ1HLXDH&L1XCDL LLZtA>xA~HL[q@A AP HALA@EHRAP RAP RAPRAPRAPRAPRAPRAPA1RHWHP5@HAML H ƂHCH81\DH EH łHL H81L(C\L L(YWf.UIIHAWAVAUATSHHtHMEE11L=ƂLgL5ǂA xBA<EEMtHHrH3I HL9rЋE1҃E[EA\A]A^A_]Ð@A@@t| AHL9sA:rr9A8Trr21*f@u'H?HHD9t5L9RxԸ[A\A]A^A_]@ADMtHHrH3I EAbfuAMDA:UHHAWAVIAUATSHHxHuLELMLH}LHEHudH%(HU1HEMHEHLMH55HDHEH=H0HEH5<HH8HEH0HEH I9IFIH@L$HxLXLMHIH HMPLMO,LL%&ł@H HHyHH;I9 A< HtII!A9HAy=Ay2IyIwHLpLp HEH52H0HEH5H0H}I9HUdH+%(9Hx[A\A]A^A_]DIIv_A9+uYAy/uRAyvuKAQ9wAHHs1HtHHEH5HH0HEHc@HEH=HH5H8HEH0>IH}EVE%ILHLLpLp~!HEHH={HHEH8MAL<eAyuAyLHLH HHqH3HI9. HA vIHUHH3HH~H;HI92HA44vHxLMVHHCLM1HA  HI9u1MHM ?H HH3HLFLI I92A<4Ht1I6HH HLALHI9HA vHEHH1yfAyAyc1E1H1AT9A9E Ѝ0ti$H 0 HJH I1HL9rE6HEHgH5zHHEH0 uƒwA<*HHHH IH HqH3Iȍ((vLHLLpLp-MLImA<`<VAyKHI#AAy'HAILhMY1L)HpVHHH HH HH L HH;IDH=Hw A<wHpILL9s7LOA ACIHEH]HHEHHAy1E1H;IHEHHHEH`HAy1E1H3IJHEH HHEH4Hb-=I>HEH=FHHH8HEH)HEH=H5H8HEH0HuH]H5үHHEH0EXQELhMHxH} H}L MHf.UHATISuu81[A\]1H5y" t<t1H5jL t!L1H5Q [A\]øf.H;UHAWAVAUIATISHHHDwDH:OtLK8AD$EQHH5خLH1e H[A\A]A^A_]EAEA uPHo1H5LM [AEMDDAvr6 bEHHHEH5e1LtH[A\A]A^A_]d AD$Du4]HtHMHEH5AD$DEu't#1H5LxfH1[A\A]A^A_]HH[L1H[A\A]A^A_]fD1DHYf1HH5̬LHtAEHh4HE1H5LMQAEMAD$DEHHHEH5c%H1L1fDAD$E HHH4L01@H{1H"LE1EfI}0 upEu$HHH!HEH5٫^@1EqH[LlH H]LOnHzL2Q@UHAWAVAUATSHL!HuA$tIIIME1HfCIDDCA$t DBuMeA~3MtHuLH1LHH1[A\A]A^A_]DH[A\A]A^A_]ff.Ht/UHSHHVHH9HHCHEJH]H@UHAWAVHMAUIATISHvH(dH%(HE1HUHM<%DzLrLuA%tzLrLuE>IAHGHuA*HMHLLKLuE>A.tePLHAH DAAFIVHUV1HUdH+%(H([A\A]A^A_]fLuf.IvHMHLHuLt$LuE>lMtH5LLF|MtAH8L1LE\Fff.UHAUIATASHHHHLPLXt&)`)p)U)])e)m)u)}dH%(H(1HEDžHH0Dž0H CHu-HC Ht8uaHLHoE*KHDc@H(dH+%(uCH[A\A]]fDIH57HH1fH5ΩH1(EUHAVAUATSH dH%(HE1GHt%1HUdH+%(?H [A\A]A^]LHIILHLLH1$CLk(IH=wcLIDLH=wSHK Ht6H1H1.EHI_GH{ VGLLC Lc(-HHt1GH{ (GML1HC HyH1HC(H{ FML1HC HH1HC(SCff.UHHH`HhLpLxt )E)M)U)])e)m)u)}dH%(HH1HEH0Dž0H8HPDž40H@HHdH+%(uBff.fUHAUATISHHH@HHLPLXt&)`)p)U)])e)m)u)}dH%(H(1HEDžHH0Dž0H CHu8LkXMuRHC Ht 8HLHKHC@H(dH+%(ugH[A\A]]H{ DLH1HC H5HC(HC HuH5H1juADUHATISH @LH[0A\HI1]UHSHH?HH]H801UHSHH?HH]H01H5 1>ff.UGDHtVt(HHۣHHEH5֣1t]1H5ƣu]fDu%t1H5uUHAWAVMAUMAATISHHdH%(HE1HHDžHHDžHt,H1HDQ>DRLMLLDL C`MIDžCD sE1E1 @v @ELk Mt+L>HvMlH5 Lm@uAECDt)$H1H5)H 51ALEEEHEdH+%(HeD[A\A]A^A_]D@D11LA H4AċCDvEHsHLHA#AƅH1HE1H5G-AAfDHH1H5RHHH5H11Aq@L蹲@LHEAċCDE1E A1H5=HE1kCDAAfHH11PLLHLE1E1CDZY YXLHuAċCDE5 n1H5HCDAfD 81H5^HDDCFfLHoACDHDHH81"@DHLH AċCDbE[ 1H5HCD6A+fLHAċCD7E .1H5THCDAfDLH5AċCDE 1H5H-CDAfDHHDHyDHH81>CD9HQDHםH81>CDH!DHH81p>CDvHDHH81@>CDHDHsH81>CDHDHQH81=CDbs9UHSHHtH?tBH{ mL$I}0L9HHMe IE0E4$Etr=H@D3E4$HEtSH AIDA@u\AD$H0CAD$0CAD$0CE4$EuIE0[A\A]A^]@6HHL011|6LHÚL01f1f1ff.fUHAUATASHHHL;cr%DnLkIHtNLv8HH{HtGLHDHCDHCD 1H[A\A]]fDL(;H5LHHߋ01HG(UHAWAVAUIHATISHHdH%(HE1HE6HߺHK1HH:HSI@u"+uH.4fL86Hx IHH:LLHH0HCH{HLs@8Me BD3L5HLIHHEI1PL 6IXZC@u +uH8MtFIT$I} It$7IU ID$AD$@uA,$uL8EfS@t(HUdH+%(uKHe[A\A]A^A_]D+uӁHt 3fK8fD;85@1GHuLUHSHH9Ht,HS HC HHS(HC(HPS8C8PH]@UHHATSHGHu)Lg HG HFHG(FG8H7L[A\]HE17H}7L[A\]DUHAWAVAULlATSJH(HuLuH}L9IH9IEHEk9HAH?DG@uaHEI9shA\AII0AFAG0AFAG0AFM9s(I9s#E'EtHE@EtE&IIM9rAHEH([A\A]A^A_]fUHFHHNLNLFHHPHFPHF PHF PHF PHF PHF H5̧P12H@Ƀ UB HPBPB PB PB PB PB PBPDJ1DBHF2@1Ҿ1>2ff.UHSHH7HDQ t^fDSHHDQ utRHHH8u@DA tBHDA uBHH]@HЄufHSHUHS1HtD_DIDہt 1ۉH]ÐHIHHH9sE111;fD uSHH  MHtIH1H9sDHB"t,uHHfHH9s1Ҁ8"t|uHH9uM1H!Å=AA)EuXH {Mt}1LH5L=f.L9H1-1H5LM1L9!VL"LtDHH9 HB"\t1HH9tDBHBAuwA[vnAHAIAADu@AuuHH)HzHHAȃ0 v AFw>A@vH9uHSHDA"tA/YfDAaACH1H)UHAWIAVIAUIATSHH(L'dH%(HE1I9sLH&A$< w9Hs3IL9uMe1HEdH+%(H([A\A]A^A_]LeL9tIwA $ID$HE"Q wH5ȠHcH>-LI9X10 wHH9rH9:..H9:0 &HH9rH9#H}HHUtIHH9s(H&< wHsHH9uHUIUMH9A8$H}LHoI~(a1I~P@IL$HH9HMH >LI"fDL9t#8qHH9GH9rIL$HH97HMH LI"fDL9t8qHH9H9rDML$L9LLHMH 'I9o8qHH9H9rNfDH9 I& wIsHH9uH1T@HEH98]tqLIOH}HHUI&tH9t<,)<]tE1fDHH!DHHDHHNHf.IF(HLyf.HH9s< H&HHH9u .]1HH9H9t[H 1fDH(ff ff ffH{UHu]HHщHHcH>@H H1H(H@H@ H@H@ H@H@H@HH{UH]DUHHH`HhLpLxt )E)M)U)])e)m)u)}dH%(HH1HEHH0H8HPH(HDž(Dž0Dž40H@xH(H!HHdH+%(uff.@UHATISHH1GLHHH1<H[A\]@UHAUIATASHHXdH%(HE1HUHχ:H9KAHuH}uuHHt0HIHt H5HAAf.LH5 HIHEdH+%(u=HXL[A\A]]fDHfDHH}|HUHUEf.UfHATISHMHH@dH%(HE1)E)EEf fPHE)EЃUHR~EHuLH5H~HHEdH+%(u H@H[A\]fUfHATISHMHH@dH%(HE1ẼEE؉Ef f҃?UH}E HuLH5}HUHEdH+%(u H@H[A\]UDUHAWAAVIAUIATSHHdH%(HE1DHuLIHU:uA$t:LH50}HHEdH+%(u6HH[A\A]A^A_]HH}1LH1yfDUL |HAUATSHH S OdH%(HE1L%IނI<$RH|D@1HeCL*ZYtdSH s|L9I<$H|1UC@iI<$DCH HW|1 CKL|L9sHH ߂LѨI<$H{|H OHEH|1C @ CI4$<;H bHC KI<$KI<$1H{p{xtlK;A<$HrHcH>DS HI<$H1H/{I<$1HHL{HEdH+%(SHe[A\A]]fHHނH ADHz1/&C s@K#1I4$xJiC H<HKHQI<$Hz15I4$~RD K I<$Hv1fcI4$WCf.I4$HCf.I4$BCf.I4$bCf.I4$trCwf.I4$sRCOf.I4$C2C'f.I4$cCf.I4$wCf.I4$lC f.I4$LCf.I4$hCf.I4$~rCfH AS f.H੐ @mI<$Hw1RODHK I<$1H~w-*S HfDC I<$H7w@HS HfI<$HK 1H:kHS HfDfZC of.HS H1뉐H{ L1=LHuH1RI4$Lv S H1,@LHS LxI4$L,HHS I4$HDSI<$Hs ;|DUHAVIAUATSHHH_IIHuJfI^IHt;HHH0LHHHIMtI^@1LH[A\A]A^]fUfHAWAVIAUATSHDGDdH%(HU1)pAtbHt]HyP MuLAfHUdH+%(HĨ[A\A]A^A_]fDMHDžPHE1IHHhL=>fDAUHh@SAEGIcL>f.CDu'AMHhH5$t1HtKDIIM9rHCDHPHP1H5PqsfAM~IUE1AɃAIIL91LHIH8HL0AL`LXL@T@IAMAD@@t DHH`IHXI9HAr E,$EuHLHL@H8L0Ƅ5CD*HHh1H5rH>IIM9 |CD[fAZE@CD;AMHhH5Cr@IUHHƤ~H9H@HH`UCDH`+IIM9XCDAMHhH5q@CDAEHhH5qH߸IIM9PHFH9QXDM%H&qHPHpHH`H`HHHt# HH`+ H`HtCD IIM96fHPA}wHH59˂HPXHLHL@H8L0HUK1H1A:1/A$HoHP  ff.UHAWAVAUATSHHEH`HPL}HHXHH] HHLLm(HpL@L8HhdH%(HE1HxIH0"ML`AFDLH`HxHHpHpAX AEE1E1HAD,L HhL;hHhE1L MC<|莃B;II uH`H5ȂH@DHȂHEIIƈ}HtH`D,HH5nL IDwH`1AHUdH+%( HeD[A\A]A^A_]1H5?}LwfHmLHmH5mHD1CffOH5mH`1tPHH{P  HFH9CXH`1HmH5mAHmIEH`D,L PDt tHlHH50juEHpmAWPH@HHLhL8HXHPZYt7H`@Dtt9H`1H5,mAH`AH5l1H5WlyH`1H5lktH0HXL0yHxHHH(ALL%@kL-FjHxIHHI9smHsHLL9H kIEHh}HhH`LH1uHxQA@3ff.UHAWAVAUATSHH=nHHdH%(HE1HH HDž`HhHpCDt01HEdH+%(7He؉[A\A]A^A_]f.LL`LLLJtL0LLL-L@LLLLl;HPLLLHHԐHLLLHL(IHnHLLLHLPHjPLL迕AXAYtLHHHv+HHHWP DocuHment FilH3H3QH HZHLLLLLL1^_68tH#jH HLLLLLLŕZYE8tHiH L%kE1MIwE1Hu@IKtHCT8H轓~ًCDHIH=HPH@H0@fDH0HhH CDt$u`fDH[hH 1H5vH߽t"H :t1H5gH载u1H5hH蟽uH@HhH &H0GDHgH HPH@H0 fH LMLPLH(LkHH 襃 f.D+f,f.%f.&f."f.#f.f. f.f.f.f.f.f.f. f.f.f. f. f.HVF HHt0H5AuAHcH>fffA D@tf1fDf}1fAfA Df A f1A fA f)A ft!1fAfA vf!A j@HVF HHt0H5tAHcH>fA @t1tg1AA D A 1A A )A t1AA !A 노ff.@HHvHt4Q LsHIcL>f1HHA @tH1@H H7H1H7HH7H)HHH71HHH!H7ff.HUIHHH9r3IH9r'Fƃ@MuIH@HHE1A ]DGDtHHldH81M]fDHrHcH>@HHI@HHHD땐L@tHL)H@HHEȸH9fGDtHmHcH81mf.If.HHI@HHHE fDL {L1kL!cUHAWEAVIAUATISHHFDN EH1LDML nDMAD$<EL$8AD$Du1He[A\A]A^A_]fDHiIHoH8AWAQAD$8PM1MH0@GfD2DH9sjH)غI4H9HFЉу>A:tfAt 1D˃IHH9IzI1HIBxI)AHH(1[A\A]A^A_]HI H|I| IzLHH)H)HHwH)L҃s'tt1fLfHzHHD HH) 1HSDH9HGM$H)LghHGpHSx*fDH]SJ~vDH9H)I4H9HFЉу ADfAD MDH}H9HuVFH}HH @H)HIHHMH9I<HGH}HM$L9@ID$L}HE7fHuH9s C RLxIM9M LM)LHuL LHuHǃHEI)HChHELcpHCx@HCpHChIzDIBHIBx)1HDIFfLLMBH9r3@HzH9szt  fDHHH9scL9s^:@9@uuƀzufD>A:tAt Dx HH9HABfDHuH)Hty1E1H9LLMIHIzHIHLILLH)H)HiDHuH9I<0HFH}HLIH_ADAD ff.UHAWIAVL4AUIATISH(DEAuu1҅O4/MM9Eȉǃ}̉ǃE}JHHDBtBAHIO)HHumIIM9MA$IuUątRHHDBt=fDAA H)HHuI9u1H([A\A]A^A_]UȃUtu0HDA tcA7IGDq A<$UIDy >L90Dq tHL9@ǁ@ƃ@uIEtHDB u'AIW)HH@If.M9s`ADB IM9uI1E@A1HXf MMUHAWIAVAUIATISHH}fH5XZLHHIM)M9LLLMKM){?SH{H:PHtt:uPHpIty}ttAWItg}ufxu@HMLH)A`It H)HHL9s"LHII) I:tH[A\A]A^A_]}tfLHL9sLLHADH1[A\A]A^A_]ff.UHAUATISHHdH%(HE؋GDtU0tL1H0H5XL|teHUdH+%(H[A\A]]ÐtA8t8u LtH81H54ULut1tu L蜭tHLLHLvIEHf.[+ff.UAHW1HATISHH;QH;L満qH3 H3 [A\]Hu 1@wQ@t+@uHfH*1\@HfH*X@@uHfH*ff.z^\Hx;fH*Y:DHЃfHH H*XOfHЃfHH H*XDHЃfHH H*XZfHЃfHH H*Xff.Hu 1@wQ@t+@uHfH*1\@HfH*X@@uHfH*f.z^]Hx;fH*Y:DHЃfHH H*XOfHЃfHH H*XDHЃfHH H*XZfHЃfHH H*Xff.U%HS? ÉH u H]fHپHaTH81H]fUIHAWAVAUATSHDfA;IIIA vvAD$<0HcHcH>D_8HcI9r)AH[A\A]A^A_]A^8HcI9sH[A\A]A^A_]DAv*DHPuu9AtS1Au_8uEtAuDA^8R@A^8EAEAV8<=w+Hk`HcH>fH@M HLWLIw"AD$ALHKL1-HHLH1ӡHUdH+%(}H [A\A]A^]DHHLLIAD$LLH=JL1eDLXLDLfAnLfHuJLZDH@HHHLL)GLfInľHILLAD$<=DHPAfHfHLLR AUHƀ>1 vB<wH=YHc H>H5AUL1ϛA$@AFN <=1<>) AAH Au LIM^1HECLHLIff.UHAWIAVIAUATSHHXHE DLmPLMHHHHE(HHHE0LHHE8HHE@HdH%(HE1DžGDDž% MɉHLDMHLD1L蝛MLLE11IHixI7C<;\H BH2<-@HE1HLLHHHCHHLIFXAUEPEPPjLLEHMHH`D{!HHLtAEYINHUHLF:LHAD$H9LAALLixO4fA>AFHCXAA9DGLHLHHE8ZAFtEAEHHCC8AF <wDHHCxHLHEPEPPAULLEHMHH``8A~!HCDHDAFfDEM9LL)HzI_HDHL`HLLJ@DAD$t?AED}}DWHIUD2DAT$AT1EAWHLLY^dEu8AEDtHDLrfAL$;we#v A<wYH^EHcH>D 'fHPsu(U$PgH3EHcH>H9AL$EH>H8HPHP1AWSED$cHDH LXu(HDI4IH;L DIcfDHHHM I91;LHqEHcH>I9rI)IfDI9rI)IpfDAD$tىxAΉM9fL谑HHHM)HEHEfHoo`op o)oP0oH`oXpo)})o`@) opP)0oH)@L)UHEL})P)`)p)m)IELpL9[LLHpLLxML MM9}tFHIWI7E1jA LjSAVATjE PHHHPtLLL:AED> HLVHI  LfDDDM9_A|$ ^M|$ uU(1M|$!E(HLL+* IEI}H`HHHIrIEHH HLsHD8AD$tLHMfnHLDžfA$fAnMC2I9H`LHH)HyHc_HDH`EM9TLAD$L)H9?H1~HEM9LL)HAA A A Ѐ_HcЉHDH`EM9LL)HAf_HHDHEM9sLL)HcIc_HDHEM9;I_HDHEM9LL)HIHEM9LL)HIiLLHHLLLL#HH)H9HGHt%I1 AHH9uHHUC2I9>H`LHH)H$_HH`AEDnHQH`HN'H81 C2I9H`HL9H_HDH`AEDuLfC2I9H`LHH)HgH_HDH`AEDEC2I91H`LHH)HF V V Ѐ_HcЉHDH`AED@C2I9H`LHH)HHHH`AEDp@C2I9yH`LHH)H_HH`AEDLVC2I91H`LHH)Hf_HHDH`AED)fC2I9H`LHH)H_HcH`AEDfI9LAT$H)H9pH1HP訸LPH`lIT$Ht;AD$ H 9HcH>IAADAD$ @AAA͉AAA0AA(AfDH1H=#HVH1H=#HqfAE8-DHU#11rHYDH#H81証AEHxAED u1I$Lt1LH5LdtMH~AؾH9#H81Hi"11OqH`H`{L4A ]LH"1L1pH`IEHIE׵H"L01pOMFL9fUHAWAVIHAUATSHXdH%(HE1EEEHHILxL9LmLeEHUH]LHMILIDEDMH}LMIHHSH3E1jLjAWAVAUuujEPDMHMHPt&t AD$D tEH[I9$uEf.HUdH+%(u5He[A\A]A^A_]f1HUfE"1fMHM 1觵HHenabledfileinfo supportlibmagic|lp!Constructor failedInvalid mode '%ld'.OlInvalid finfo objectzFailed to load magic databaseOs|lr!Stream-ContextrbFailed identify data %d:%sfinfoFILEINFO_NONEFILEINFO_SYMLINKFILEINFO_MIMEFILEINFO_MIME_TYPEFILEINFO_MIME_ENCODINGFILEINFO_DEVICESFILEINFO_CONTINUEFILEINFO_PRESERVE_ATIMEFILEINFO_RAWFILEINFO_APPLEFILEINFO_EXTENSIONOfileinfo8.4.7API20240924,NTS__constructfinfo_openfinfo_closefinfo_set_flagsfinfo_filefinfo_buffermime_content_typestringcontextnullfilenamemagic_database%.*s.mime%s%.*s%s.mimeUnknown factor op `%c'Too large factor `%lu'Bad factor `%s'wb+cannot open `%s'error writing `%s'cannot happen: m->type=%d %s type `%s' truncated %zuBad magic entry '%s'+-/.$?:{}!+-./?,!+-/@?_$&~unknownBad size for type %d fatal libmagic errorBad type %d Bad relation %c Bad factor_op %u Strength = %3zu@%u: %s [%s] %.3onot validtoo longmissing format speccannot read magic file `%s'relative offset at level 0in_offset `%s' invalidsyntax error: `if'syntax error: `elif'syntax error: `else'type `%s' invalid'~' invalid for string typesmultiple rangeszero rangestring modifier `%c' invalid'/%c' not allowed on regex coding error: m->type=%d %c= not supportedstring too long: `%s'incomplete escape<>&^=![]().*?^$|{}no need to escape `%c'cannot get string from `%s'Unparsable number `%s'Bad width %zudescription `%s' truncatedBad number format %d-.#Bad file format %dUnknown !: entry `%s'(no description); %s/%s%s%s%s: %s cannot stat `%s'smallfile `%s' is too %sbad magic in `%s'using regular magic file `%s'Set %zu: Binary patterns: Text patterns:MAGICInvalid action %dapplestrengthbinarytext/plain text$ text executable$ executable, with very long lines (%zu), with no line terminators CRLF CR LF NEL, with escape sequences, with overstriking*Bad* %#16.16llx DocumentSummaryInformationSummaryInformation%#x%dd+%.2d:%.2dCode pageTitleSubjectAuthorKeywordsCommentsTemplateLast Saved ByRevision NumberTotal Editing TimeLast PrintedCreate Time/DateLast Saved Time/DateNumber of PagesNumber of WordsNumber of CharactersThumbnailName of Creating ApplicationSecurityLocale ID%s: tag %p got=%s exp=%s %.*s%.2x%s: len %zu %u %s: data %s %s eocboolbit_stroctet_strobj_idobj_descrealenumembedutf8_strrel_oidres2seqsetnum_strprt_strt61_strvid_stria5_strutc_timegen_timegr_strvis_strgen_struniv_strchar_strbmp_strdatetoddatetimedurationrel-oid-iriInternational EBCDICUnicode text, UTF-7utf-7us-asciiutf-8Unicode text, UTF-8utf-32leutf-32beutf-16leutf-16beebcdicNon-ISO extended-ASCIIunknown-8bitISO-8859iso-8859-1inode/%s; charset=cannot open `%s' (%s)%ssetuid%ssetgid%sstickychardevice%scharacter specialfifo%sfifo (named pipe)unreadable symlink `%s'%ssocketx-empty%semptyinvalid mode 0%ofield %s too large: %d#0.'+- * not allowed in formatwidthprecisionbad format char: %cBad magic format `%s' (%s)line %zu:cannot allocate %zu byteserror seekingerror reading - octet-streamapplication/%sUNKNUNKN???very short file (no magic)[try tar %d] [try json %d] [try csv %d] [try simh %d] [try cdf %d] [try softmagic %d] [try ascmagic %d] no magic files loadedtext/csvCSV %s%stexttruefalsex-ndjsonNew Line Delimited %sJSON text dataapplication/SIMH-tape-dataSIMH tape dataapplication/x-tarustar ustarwritable, executable, regular file, no read permissioncannot read `%s'Magic database is not open%jd*Invalid datetime*%a, %b %d %Y*Invalid date*%T*Invalid time**Invalid number*%llu*bad in_type**bad type>>>>>>>>%u: %.*s %d(%s,%c%d), %s%s/%u%.8llx,%c%lld%G*bad type %d*,"%s"] x-msi, %s: %hd, %s: %d, %s: %u, %s: %g, %s: %sLittleBigvnd.ms-office], %s Endian, Os: Windows, Version %d.%d, Os: MacOS, Version %d.%d, Os %d, Version: %d.%dMSI Installer, %sCan't expand summary_infoCatalogMicrosoft Thumbs.db [application/CDFV2Can't read SATCan't read SSATCan't read directoryCannot read short streamFileHeaderHWP Document Fileapplication/x-hwpCannot read summary infoCDFV2 %sCannot read section infoapplication/x-ole-storageEncryptedencryptedEncryptedPackageEncryptedSummaryQuickBooksquickbooksmfbu_headerMicrosoft Excelvnd.ms-excelBookWorkbookMicrosoft WordmswordWordDocumentMicrosoft PowerPointvnd.ms-powerpointMicrosoft Outlook Messagevnd.ms-outlook__properties_version1.0__recip_version1.0_#00000000DigitalSignatureMicrosoft Installervnd.ms-msiPowerpointCrystal Reportsx-rptAdvanced InstallerInstallShieldMicrosoft Patch CompilerNAntWindows Installerlhs/off overflow %jd %jd offset overflow %jd ${%.8smget/%zu @%d: id3 offs=%u Bad DER offset %d nbytes=%zuEOF comparing DER entries %llu == *any* = 1%llu != %llu = %d%llu == %llu = %d%llu > %llu = %d%lld > %lld = %d%llu < %llu = %d%lld < %lld = %d((%llx & %llx) == %llx) = %d((%llx & %llx) != %llx) = %d strength=%zu indirect count (%hu) exceededname use count (%hu) exceededbad op=%d indirect offs=%jd bad in_type=%d indirect *zero* cont_level indirect *zero* offset indirect +offs=%u indirect @offs=%u[%d] cannot find entry `%s'can't allocate continuationinvalid type %d in mconvert()zerodivide in mconvert()Failed to load magic database at "%s"Failed to set option '%ld' %d:%smust be of type resource|string, %s givenmust not contain any null bytesCurrent entry already has a strength type: %c %d%s: Strength setting is not supported in "name" magic entriesCannot have factor op `%c' and factor %uCurrent entry already has a %s type `%.*s', new type `%s'Current entry does not yet have a description for adding a %s type%s type `%s' has bad char '%c'Usupported factor_op in default %dcorrupt magic file (bad pascal string length %d)No current entry for :!%s typeNo current entry for continuationContinuations present with 0 countNew continuation level %u is more than one larger than current level %uindirect offset type `%c' invalidmissing ')' in indirect offset`name%s' entries can only be declared at top levelinvalid string/indirect op: `%c'indirect modifier `%c' invalid'/BHhLl' modifiers are only allowed for pascal strings no modifiers allowed for 16-bit strings '/%c' only allowed on regex and search missing range; defaulting to %d escaped dot ('.') found, use \\. insteadescaped tab found, use \\t insteadunknown escape sequence: \%03oExpected numeric type got `%s'Overflow for numeric type `%s' value %#lxInternal error inconsistency between m->type and format stringsNo format string for `%s' with description `%s'Printf format is %s for type `%s' in description `%s'Too many format strings (should have at most one) for `%s' with description `%s'*** Possible binary test for text type level 0 "default" did not sort lastFile %d supports only version %d magic files. `%s' is version %dSize of `%s' %llu is not a multiple of %zuInconsistent entries in `%s' %u != %ucould not find any valid magic files!%.8x-%.4x-%.4x-%.2x%.2x-%.2x%.2x%.2x%.2x%.2x%.2x20%c%c-%c%c-%c%c %c%c:%c%c:%c%c GMTUnicode text, UTF-8 (with BOM)Unicode text, UTF-32, little-endianUnicode text, UTF-32, big-endianUnicode text, UTF-16, little-endianUnicode text, UTF-16, big-endianOutput buffer space exceeded %zu+%zu%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%.8X-%.4hX-%.4hX-%.2hhX%.2hhX-%.2hhX%.2hhX%.2hhX%.2hhX%.2hhX%.2hhXComposite Document File V2 DocumentHancom HWP (Hangul Word Processor) file, version 5.0non zero offset %zu at level %ubb=[%p,%zu,%zu], %d [b=%p,%zu,%zu], [o=%#x, c=%d] invalid m->type (%d) in mprint()cannot happen with float: invalid relation `%c'cannot happen with double: invalid relation `%c'invalid type %d in magiccheck()cannot happen: invalid relation `%c'mget(type=%d, flag=%#x, offset=%u, o=%zu, nbytes=%zu, il=%hu, nc=%hu) 22\~\x00p pppppПd,,,,,T,,T,,,,x,1 Hƭ====|=====================D|l\D4$zzmmmJT@zzccc6h^,uYYYYYYYYYY00000000 S0000/000000000o00a0000000000VH007000000000000jU@+kVtextbinaryifelifelse.mgcder0name-use.octal;invalidbyteshortdefaultlongstringdatebeshortbelongbedate leshort lelong ledate pstring ldatebeldateleldateregexbestring16 lestring16 searchmedatemeldatemelongquadlequadbequadqdateleqdatebeqdateqldateleqldatebeqldate float!befloat"lefloat#double$bedouble%ledouble&leid3(beid3'indirect)qwdate*leqwdate+beqwdate,name-use.clear/der0guid1offset2bevarint3levarint4msdosdate 5lemsdosdate 6bemsdosdate 7msdostime 8lemsdostime 9bemsdostime :octal;m? =//Brain Vision Data Exchange Marker File, VersionBiosig/Brainvision Marker filebiosig/brainvision =.zFileId=TMSi PortiLab sample log file Version=Biosig/TMSiLOGbiosig/tmsilog =+}Synergy89(&88)&888&8888=?~CRawDataElement=UCRawDataBufferBiosig/SYNERGYbiosig/synergy =+.Brain Vision V-Amp Data Header File VersionBiosig/Brainvision V-Amp file =&-Brain Vision Data Exchange Header FileBiosig/Brainvision data file =&MetaView Service Assurance Export FileMetaView SAS export='Version x/, version %c =% -----BEGIN ENCRYPTED PRIVATE KEY-----OpenSSH private key (with password) =$DFS File http://www.difstream.com SmartVersion binary patch file =#-----BEGIN OPENSSH PRIVATE KEY-----OpenSSH private key ="-----BEGIN PGP SIGNED MESSAGE-----=" =AUX=.gentoo-manifest=DATA=.gentoo-manifest=DIST=.gentoo-manifest=EBUILD=.gentoo-manifest=MANIFEST=. gentoo-manifest ="1-----BEGIN AGE ENCRYPTED FILE-----age encrypted file, ASCII armored ="Novell Message Librarian Data FileNovell message librarian datamsg =!jX5O!P%@AP[4\PZX54(P^)7CC)7}$EICAR=#!k-STANDARD-ANTIVIRUS-TEST-FILE!$H+H*EICAR virus test files =!ATES MEDICA SOFT. EEG for WindowsBiosig/ATES MEDICA SOFT. EEG for Windowsbiosig/ates = iSketchUp ModelSketchUp Modelapplication/vnd.sketchup.skpskp = NetImmerse File Format, Version=!n NetImmerse game engine file= "[0-9a-z.]+, version %s =SC68 Music-file / (c) (BeN)jamisc68 Atari ST music =C64 tape image fileT64 tape Imagex Version:%#x! $Entries:%ix(Name:%.24s =C64S tape image fileT64 tape Imagex Version:%#x! $Entries:%ix(Name:%.24s =1.0 Fri Feb 3 09:55:56 MET 1995Erlang JAM file - version 4.3 =>(*This is a Mathematica binary Mathematica binary file>XAfrom %s =---BEGIN PGP PRIVATE KEY BLOCK-PGP private key blockapplication/pgp-keysasc =B# Bazaar merge directive formatBazaar merge directive =_** This file contains an SQLiteSQLite 2.x databaseapplication/x-sqlite2sqlite/sqlite2/db =Cobalt Networks Inc. Firmware vPaged COBALT boot romx&V%.4s =8 USE LYNX TO DISSOLVE THIS FILELyNX archiveapplication/x-commodore-lnxlnx=V 10 ,=  [0-9]{1,5}%s directory blocks=  [^ ]{1,24}, signature "%s"=  [0-9]{1,3}, %s files ==.e, song "%.32s">Nf, game "%.32s" =# ipl generated from max fileGTA Item Placement data (IPL), used in GTA III/VC =x@PJL ENTER LANGUAGE=FWUPDATE2HP Printer firmware updateful2 =%old timezone data =&old timezone data ='old timezone data =(old timezone data =)old timezone data =*old timezone data =Tue Jan 22 14:32:44 MET 1991Erlang JAM file - version 4.2 =OTue Jan 22 14:32:44 MET 1991Erlang JAM file - version 4.2 =:%!PS-Adobe-3.0 Resource-FontPostScript Type 1 font text =wStart/Stop parameter header:Caris ASCII project summary =1002003old ACE/gr binary file>'- version %c =4 @CorelBMF Corel CorporationCorel GALLERY Clipartimage/x-corel-bmfbmf =,
Stata Data File=-[0-9]+(Release %s) =Inno Setup Uninstall Log (b)InnoSetup Logapplication/x-innosetupdat>%.7sx%s=@{x@%-.38sx @, version %#xx H , %u bytes< @x , %sx \%sx , "%s"> @x, %-.9s=+x\%-.9s=+x, %-.42s =;Gamebryo KFM File Version Gamebryo game engine animation File= [0-9a-z.]+, version %s =;SVN-fs-dump-format-version:Subversion dumpfile><(version: %s) =-----BEGIN PRIVATE KEY-----OpenSSH private key (no password) = -----BEGIN CERTIFICATE-----PEM certificate =(*^ ::[ frontEndVersion ==.wolfram@="@#! /usr/bin/env runhaskellHaskell script executable =Warcraft III recorded game%s =Identification_InformationFGDC ASCII metadata =A# Bazaar revision bundle vBazaar Bundle = -----BEGIN CERTIFICATE REQPEM certificate request =?nut/multimedia containerNUT multimedia container = !# This is a shell archiveshell archive textapplication/octet-stream = #! /usr/local/bin/clojureClojure script text executabletext/x-clojure@={"@#! /usr/bin/env execlinebexecline script text executabletext/x-execline =hAVG7_ANTIVIRUS_VAULT_FILEAVG 7 Antivirus vault file data =# ACE/gr fit description ACE/gr fit description file =Paint Shop Pro Image FilePaint Shop Pro Image File =,-----BEGIN PGP SIGNATURE-PGP signatureapplication/pgp-signatureasc= 0d =.1pgp =Windows Registry Editor =Version 5.00 Windows Registry text (Win2K or above)text/x-ms-regeditreg =wPOLY SAMPLE FILEversion Biosig/TMS32biosig/tms32 =5 ACTApricotdiskimagefloppy image data (ApriDisk) =5 East_Side_InvertationaQuake I save: ddm4 East side invertationa =`Ph`P@@@@@@@@Linux S390=@ =hZ10 64bit kernel=Z9-109 64bit kernel= Z990 64bit kernel=Z900 64bit kernel=ȀZ10 32bit kernel=ȀZ9-109 32bit kernel= Z990 32bit kernel=Z900 32bit kernel =O(***********************Mathematica 3.0 notebook =# abook addressbook fileabook address bookapplication/x-abook-addressbook =@ࡱAAFB OM+4AAF legacy file using MS Structured Storage= (512B sectors)= (4kB sectors) =@ࡱ +4AAF file using MS Structured Storage= (512B sectors)= (4kB sectors) =DOS Client Message File:Novell DOS client messagemsg> ! %c! %c! %c! %c! %c! %c! %c !  %c !!  %c !"  %c !#  %c !$  %c=, Tranx, tran version %s! , terminated by %#2.2xx%2.2x!e, at 0x65 %#x!f, at 0x66 %#x =bsjb pdb v1.0Microsoft Roslyn C# debugging symbols version 1.0 = BDNetscape Address book =-----BEGIN ECDSA PRIVATEPEM ECDSA private key =; -: 0:Source:=< -: 0:Graph:== -: 0:Data:GCOV coverage report =FICHIER GUITAR PRO v3.Guitar Pro Ver. 3 Tablature =Junglevision Patch FileJunglevision instrument data =#! /usr/bin/env clojureClojure script text executabletext/x-clojure =j// WebVTT subtitlestext/vttvtt =MythTVMythTV NuppelVideox v%sx (%dx x%d),=$Pprogressive,=$Iinterlaced,x&(aspect:%.2f,x&0fps:%.2f = NuFileNuFile archive (apple ][) data = NFlNuFile archive (apple ][) data =*BEGINApplixware=WORDSWords Document= GRAPHICSGraphic= RASTERBitmap=  SPREADSHEETSSpreadsheet= MACROMacro= BUILDERBuilder Object =070707ASCII cpio archive (pre-SVR4 or odc)application/x-cpiocpio/cpi/008/012 =070701ASCII cpio archive (SVR4 with no CRC)application/x-cpiocpio =070702ASCII cpio archive (SVR4 with CRC)application/x-cpio/cpio =SBBSArc/BS2 archive data =LEOLZWPAKLeo archive data =&¨MP¨KBoom archive data =FOXSQZFoxSQZ archive data =@FTCOMPFTCOMP compressed archiveapplication/x-compress-ftcomp??_/??@/dll/drv/pk2/!, at beginning %#xx)"%s" =OctSquSquash archive data =nrvNRV archive data =KTPACTPac archive data =VCLMTFStarView MetaFilex, version %dx, size %d =LM8953Yamaha TX Wave=Ilooped=non-looped=33kHz=50kHz=16kHz =]ofTAZ!eXtra Simple Music =[licq]LICQ configuration file =ADLIB-AdLib instrument datax, version %ux.%u =ABF2Biosig/Axon Binary formatbiosig/abf2 =`@ MFR Biosig/MFERbiosig/mfer =dN.EV.Biosig/NEVbiosig/nev = kPLEXONBiosig/Plexon v2.0biosig/plexon =tIAvSFoBiosig/SIGIFbiosig/sigif =fcscopecscope reference dataxgversion %.2s>l14= md -q with inverted index= nd -c text (non-compressed) =CBMdPower 64 C64 Emulator Snapshot =AC1.40DWG AutoDesk AutoCAD Release 1.40image/vnd.dwg =AC1.50DWG AutoDesk AutoCAD Release 2.05image/vnd.dwg =AC2.10DWG AutoDesk AutoCAD Release 2.10image/vnd.dwg =AC2.21DWG AutoDesk AutoCAD Release 2.21image/vnd.dwg =AC2.22DWG AutoDesk AutoCAD Release 2.22image/vnd.dwg =AC1001DWG AutoDesk AutoCAD Release 2.22image/vnd.dwg =AC1002DWG AutoDesk AutoCAD Release 2.50image/vnd.dwg =AC1003DWG AutoDesk AutoCAD Release 2.60image/vnd.dwg =AC1004DWG AutoDesk AutoCAD Release 9image/vnd.dwg =AC1006DWG AutoDesk AutoCAD Release 10image/vnd.dwg =AC1009DWG AutoDesk AutoCAD Release 11/12image/vnd.dwg =AC1012DWG AutoDesk AutoCAD Release 13image/vnd.dwg =AC1013DWG AutoDesk AutoCAD Release 13c3image/vnd.dwg =AC1014DWG AutoDesk AutoCAD Release 14image/vnd.dwg =AC1015DWG AutoDesk AutoCAD 2000image/vnd.dwg =AC1018DWG AutoDesk AutoCAD 2004/2005/2006image/vnd.dwg =AC1021DWG AutoDesk AutoCAD 2007/2008/2009image/vnd.dwg =AC1024DWG AutoDesk AutoCAD 2010/2011/2012image/vnd.dwg =AC1027DWG AutoDesk AutoCAD 2013-2017image/vnd.dwg =AC1032DWG AutoDesk AutoCAD 2018/2019/2020image/vnd.dwg =AC1035DWG AutoDesk AutoCAD 2021image/vnd.dwg = {titleChord text file =ptabPower-Tab v3 Tablature File =ptabPower-Tab v4 Tablature File =RuneCTCitrus locale declaration for LC_CTYPE =CtrsMECitrus locale declaration for LC_MESSAGES = CtrsMOCitrus locale declaration for LC_MONETARY = CtrsNUCitrus locale declaration for LC_NUMERIC = CtrsTICitrus locale declaration for LC_TIME =Claris Works palette files .plt = $SuiteTTCN Abstract Test Suite= $SuiteId> %s= $SuiteId> %s=$SuiteId> %s =submscMessage Sequence Chart (subchart) =7z'7-zip archive data,xversion %dx.%dapplication/x-7z-compressed7z/cb7 =TMBSTV MUIbase DBxUversion %s =YNBCDB NetBSD Constant DatabasexZ, version %dx[, for '%s'x \, datasize %dx ], entries %dx ^, index %dx $_, seed %#x = b0VIM Vim swap file>!, version %s= ."vimnanoswap ='b0nanoNano swap file= .(vimnanoswap =FCS1.0Flow Cytometry Standard (FCS) data, version 1.0 =FCS2.0Flow Cytometry Standard (FCS) data, version 2.0 =FCS3.0Flow Cytometry Standard (FCS) data, version 3.0 =CROMFSCROMFS> version %2.2s,> block data at %lld,> fblock table at %lld,> inode table at %lld,>  root at %lld,> ( fblock size = %d,> , block size = %d,>0 bytes = %lld =IbGTA1 in-game text (FXT), =v9.6GTA2 replay file (REP),= [a-z0-9: ]+created on %s =bSB2100SeaBeam 2100 multibeam sonar =# .PCDPoint Cloud Data =GIF94zZIF image (GIF+deflate alpha)image/x-unknown =FGF95aFGF image (GIF+deflate beta)image/x-unknown =NJPL1IPDS (JPL) image data =CCSD3ZPDS (CCSD) image data =0SOAtari GED bitmap, 160x200image/x-atari-gedged =B&W256ImageLab bitmapimage/x-ilabb_w/b&wx, %uxx %u =P7 332XV thumbnail image dataimage/x-xv-thumbnailp7/gif/tif/xpm/jpg =- XARAXara graphics file@= # xmcdxmcd database file for kscdtext/x-xmcd =BrJLinux/i386 PC Screen Font v2 data,x C%d characters,= Dno directory,! EUnicode directory,x F%dx Gx%d = LUKSLUKS encrypted file,application/x-raw-disk-image/luks/img/luksVolumeHeaderBackUpxver %d==.luks-v1>=.luks-v2 =MVR5 Maple Vr5 libraryapplication/x-maple-liblib =M7R0 IMaple Vr7 libraryapplication/x-maple-liblibx %sx %, %u string> 'sx(1st '%s'!T- , at 0x454 0x%x =M# daubMaple help file, old style =Q$Maple worksheet =.MCAD Mathcad document =ZMATLABMatlab vapplication/x-matlab-datamat=b55 mat-file!c5xd%.3s mat-file=~eMI(big endian)x|fversion %#04x=~gIM(little endian)x |iversion %#04xx~k= nPlatform: , platformxo%-0.2s!p,%c!q,%c!r,%c!s,%c!t,%c!u,%c !v,%cxxx y"%s"= "{ created on: , createdx|%-.24s =@ۥ-Microsoft Word 2.0 Documentapplication/msworddoc =GERBILFirst Choice device file =MIOPENMallard BASIC Jetsam data =NUMPYNumPy array,xversion %dx.%d,x  header length %d =/HSPOS/2 INFapplication/x-os2-infinf>k20(%s) =3HSPOS/2 HLPapplication/x-os2-hlphlp>k60(%s) = @MAKI01Maki-chan v1.x %c image> @@@@, system ID:x %cx %cx %cx %cx,, %dxx.%d=&, 16 paletted RGB colors=&, 8 fixed RGB colors=&, 2:1 dot aspect ratio =@EJLEpson ESC/Page language printer data =,NUMPYNumPy data fileapplication/x-numpy-datax., version %dx/.%dx 1, description %s = qresQt Binary Resource file =J{\urtfRich Text Format unicoded datatext/rtfrtf=.Nrtf-info =dpmviewPCP pmview config=eVersion>f(V%-3.3s) ='X imprSoftQuad troff Context intermediate for IMAGEN imPRESS =PiRivDBiRiver Database file> QVersion %s='RiHP-100[H Series] =0SymExeSymbOS executablex6 v%cx7 .%cx , name: %s =INFOqSymbOS DOX document =!SymVidSymbOS videox"v%cx#.%c =%TGIF Tgif file versionx%s =#usda USD ASCIIx, version %stext/plainusd =avaobjAVR assembler object code>version '%s' =IIXPR3Intel Quark Express Document (English) =IIXPRaIntel Quark Express Document (Korean) =MMXPR3Motorola Quark Express Document (English)application/x-quark-xpress-3 =MMXPRaMotorola Quark Express Document (Korean) = ZyXELZyXEL voice data= - CELP encoding= - ADPCM2 encoding=  - ADPCM3 encoding=  - ADPCM4 encoding=  - New ADPCM3 encoding= with resync (=>+m@P[0-9][0-9]\.[0-9][0-9][0-9][0-9]\.[0-9][0-9][0-9][0-9]\.[0-9]NAXOS CAD System file from version %s =KPACK< M> QADFS PackDir archive (RISC OS)x U , LZW %u-bits compressionapplication/x-acorn-68Epkd/binx [, root "%s"x ], load address %#xx _, exec address %#xx a, attributes %#x xe, 1st object "%s" =TVS =Version TeamViewer Session Filex, version %s =-lh0-= .lharc-file =-lh1-= .lharc-file =-lz2-= .lharc-file =-lz3-= .lharc-file =-lz4-= .lharc-file =-lz5-= .lharc-file =-lz7-= .lharc-file =-lz8-= .lharc-file =-lzs-= .lharc-file =-lhd-= .lharc-file =-lh2-= .lharc-file =-lh3-= .lharc-file =-lh4-= .lharc-file =-lh5-= .lharc-file =-lh6-= .lharc-file =-lh7-= . lharc-file = -lh8-= . lharc-file = -lh9-= .lharc-file =-lha-= .lharc-file =-lhb-= .lharc-file =-lhc-= .lharc-file =-lhe-= .lharc-file =-lhx-= .lharc-file =/-pm0-= .0lharc-file =2-pm1-= .3lharc-file =5-pm2-= .6lharc-file == Claris clip art == Claris clip art =:from '%s' =;- received SIGQUIT =<- received SIGILL ==- received SIGTRAP =>- received SIGABRT =?- received SIGEMT =@- received SIGFPE =A - received SIGBUS =B - received SIGSEGV =C - received SIGSYS =D!- received SIGXCPU =E"- received SIGXFSZ=LG=XH=\I=`J=lKD=Lcore file >Mfrom '%s' =N- received SIGQUIT =O- received SIGILL =P- received SIGTRAP =Q- received SIGABRT =R- received SIGEMT =S- received SIGFPE =T - received SIGBUS =U - received SIGSEGV =V - received SIGSYS =W!- received SIGXCPU =X"- received SIGXFSZ =$ZHP-UX=[= \=]=^= _<=``=laD=bcore file >cfrom '%s' =d- received SIGQUIT =e- received SIGILL =f- received SIGTRAP =g- received SIGABRT =h- received SIGEMT =i- received SIGFPE =j - received SIGBUS =k - received SIGSEGV =l - received SIGSYS =m!- received SIGXCPU =n"- received SIGXFSZ =dpHP-UX=q= rD=Ts=`t<=u=v=w=xcore file >Dyfrom '%s' =z- received SIGQUIT ={- received SIGILL =|- received SIGTRAP =}- received SIGABRT =~- received SIGEMT =- received SIGFPE = - received SIGBUS = - received SIGSEGV = - received SIGSYS =!- received SIGXCPU ="- received SIGXFSZ =xHP-UX== === D=h=t<=core file >Xfrom '%s' =- received SIGQUIT =- received SIGILL =- received SIGTRAP =- received SIGABRT =- received SIGEMT =- received SIGFPE = - received SIGBUS = - received SIGSEGV = - received SIGSYS =!- received SIGXCPU ="- received SIGXFSZ== D=T=`=d=h=t,=core file >Dfrom '%s' =- received SIGQUIT =- received SIGILL =- received SIGTRAP =- received SIGABRT =- received SIGEMT =- received SIGFPE = - received SIGBUS = - received SIGSEGV = - received SIGSYS =!- received SIGXCPU ="- received SIGXFSZ =begmf!!clear text Computer Graphics Metafileimage/cgmcgmx%s= mfversion>1, version %c =XIMG=.gem_info =TIMG=.gem_info = = =. ulead-imaginfo = = =. ulead-imaginfo@= msooxmlx?=@pPK=.AmsooxmlxBMicrosoft OOXMLxCMicrosoft OOXMLxDMicrosoft OOXML =8linux=.ktrace =8sunos=.ktrace = {\rtf! !\Rich Text Format datatext/rtf????RTFrtf=.rtf-info =FONTRISC OS outline font data,xversion %d =FONTRISC OS 1bpp font data,xversion %d =FONTRISC OS 4bpp font dataxversion %d =#BeEpJamCracker Module sound file =$COSOHippel-COSO Module sound file =fEMODAmiga E module =gECXMECX module =0gawaABC 3d model =HVQM4%s>v%sxGameCube movie,x4%d xx6%d,x&%dus,=Bno audio>B%dHz audio =?8LApple ProDOS Image=A&BxC, Volume /%sx )D, %u Blocks= F& Gx H, Volume /%sx ) I, %u Blocks =CRUSHCrush archive data =HLSQZSqueeze It archive data =SQWEZSQWEZ archive data =$J Freeze archive data =ZPKZPack archive data =ULEB RAX archive data =ULEBXtreme archive data =@âPack Magic archive data =0ChfLZChiefLZA archive data =2BlinkBlink archive data =8AKT32AKT32 archive data =;MSTSMNPack archive data =OAiAi archive dataapplication/x-compress-aiai =SAiAi archive dataapplication/x-compress-aiai =ZZ ZZip archive data =JarJAR (ARJ Software, Inc.) archive dataapplication/x-compress-jx , CRC32 %#xj/j01/j02 =JARCSJAR (ARJ Software, Inc.) archive dataapplication/x-compress-jarjar =-sw1-Swag archive data =7-pms-PMarc SFX archive (CP/M, DOS)com =:-pc1-PopCom compressed executable (CP/M) =sfArksfArk compressed Soundfont=2>Version %s>*: %s =(3b2 core file>l)of '%s' =MAS_UULT(imate) Module sound data =FNESMNES Sound File>G("%s" by>.H%s, copyright>NI%s),xJversion %d,xK%d tracks,=zLdual PAL/NTSC=zMPAL=zNNTSC =kBONKBONK,xm%d channel(s),=nlossless,=olossy,xpmid-side =#!AMRAdaptive Multi-Rate Codec (GSM telephony)audio/amramr =$SAP Atari 8-bit SAP audio fileaudio/x-sapsap='NAMEx(: %s=)AUTHORx*by %s =YBCFBinary Call Format (BCF) version 2.1> [=]##samtoolsVersion=x^, generated by SAMtools version %s =fBCFBinary Call Format (BCF) version 2.2> h=j##samtoolsVersion=xk, generated by SAMtools version %s =2#!BPYBlender3D BPython script =XIA1 Chiasmus Encrypted dataxia =-LH1-LHA archive (c64) =MC0.0DWG AutoDesk AutoCAD Release 1.0image/vnd.dwg =AC1.2DWG AutoDesk AutoCAD Release 1.2image/vnd.dwg =AC1.3DWG AutoDesk AutoCAD Release 1.3image/vnd.dwg =ZendPHP script Zend Optimizer data =l-afx-AFX compressed file data =@BZ3v1bzip3 compressed datax , blocksize %u = SEGASega Mega Drive / Genesis ROM image=.sega-mega-drive-header =PATCHIPS patch fileips =APS10APS patch fileaps=, simple patch=, N64-specific patch forx:N%cx;%cx<%c! x: "%.50s" =PPF30Playstation Patch File version 3.0=, PPF 1.0 patch=, PPF 2.0 patch=, PPF 3.0 patch=8, Imagetype BIN (any)=8, Imagetype GI (PrimoDVD)=9, Blockcheck disabled=9, Blockcheck enabled=:, Undo data not available=:, Undo data availablex , description: %s = PPF20Playstation Patch File version 2.0= , PPF 1.0 patch= , PPF 2.0 patch> 8, size of file to patch %dx, description: %s =PPF10Playstation Patch File version 1.0=, Simple Encodingx, description: %s =pg GCEVectrex ROM image>q: "%.16s" =MAPZ)Map file for the Blood Frontier/Red Eclipse FPS games =|rootROOT filex}Version %dx!~(Compression: %d) =PGDMPPostgreSQL custom database dumpx- v%dx.%d<-0>x-%d =cREDISRedis RDB file,=d[0-9][0-9][0-9][0-9]version %s ="CoreAlpha COFF format core dump (Digital UNIX)>#, from '%s' =$CoreAlpha COFF format core dump (Digital UNIX)>%, from '%s' =CD001ISO 9660 CD-ROM filesystem data (raw 2352 byte sectors)application/x-iso9660-image = CDROMHigh Sierra CD-ROM filesystem data>0 '%.32s' =0CD001Nero CD image at 0x4B000application/x-nrgnrg=.cdrom =u"AFS Dumpxv(v%d)=wvxxVol %d,=ynxz%s={t=|x }on: %s= ~full dump! incremental since: %s =D1.0 X11 Speedo font data =kGSF-vSAIC generic sensor format (GSF) sonar data,=l[0-9]+\.[0-9]+version %s = pMGD77MGD77 Header, Marine Geophysical Data Exchange Format =%%HP:HP text=T(0)- T(0)=T(1)- T(1)=T(2)- T(2)=T(3)- T(3)= A(D)A(D)= A(R)A(R)= A(G)A(G)=F(.)F(.);=F(,)F(,); =U Wavelet Scalar Quantization image data = IIO1$Ulead Photo Explorer 3image/x-ulead-pe3pe3= :\x "%s"x = \\x "%s" = IIO2HUlead Photo Explorer 4 or 5image/x-ulead-pe4pe4/pe5= JFIFwith JPEG image data=. jpeg = PFS1 PFS HDR image data= [0-9]* , %s=  [0-9]{4}x%s = %.3s = llvc0LLVM byte-codes, null compression = llvc1LLVM byte-codes, gzip compression = llvc2LLVM byte-codes, bzip2 compression =JOYLocoScript 1 document =JOYLocoScript 2 document = JOYLocoScript 3 document = JOYLocoScript 4 document = DOCLocoScript PC document = DOCLocoScript Professional document@= Path:news textmessage/news@= Xref:news textmessage/news@= From:news or mail textmessage/rfc822@= Date:news or mail textmessage/rfc822 =a*mbx*MBX mail folder =IPVF1 portable voice format>J(binary %s) =OPVF2 portable voice format>P(ascii %s) =@PO^Q`Microsoft Word 6.0 Documentapplication/msword =MSVC .sbr>%s =@mgs2 MSX Gigamix MGSDRV2 music file= = .>0, title: %s =Netscape folder cache = 8@MAJYOXLD4(Q4) picture =%!VMFSunClock's Vector Map Format data =%-1BHewlett-Packard Graphics Language 2application/vnd.hp-HPGLpltxwith "%-.10s" =U{\pwdPocket Word document or templateapplication/x-pocket-wordpwd/psw/pwt=.]rtf-info@=++^[[:space:]]*(class|module)[[:space:]][A-Z]= (modul|includ)e [A-Z]|def [a-z]=&!^[[:space:]]*end([[:space:]]+[;#].*)?$Ruby script texttext/x-ruby =mMAP (Old EZD Electron Density Map = @=órlSereal data packet, UTF-8 encodedapplication/sereal=."sereal =zTRdHP/UX nettl capture fileapplication/x-nettltrc0/trc1! /tmp/wireshark.TRC000x "%-.56s"!DUTC, tzxD%-.20s>X, host %-.9s!aB.11.11, osxa%-.9sxj(%#x)!k, xxa=%#16.16llx!s9000/800, modelxs%-.11s!~, at 126 %#4.4x =%X 495SoftQuad troff Context intermediate for AT&T 495 laser printer =PSDBPanasonic channel list DataBasedb/bin=~SQLite format 3x); contains =csnoopSnoop capture file>d- version %d= e(IEEE 802.3)= f(IEEE 802.4)= g(IEEE 802.5)= h(IEEE 802.6)= i(Ethernet)= j(HDLC)= k(Character synchronous)= l(IBM channel-to-channel adapter)= m(FDDI)= n (Other)= o (type %d)= p (type %d)= q (type %d)= r (type %d)= s(type %d)= t(type %d)= u(Fibre Channel)= v(ATM)= w(ATM Classical IP)= x(type %d)= y(type %d)= z(type %d)= {(type %d)= |(type %d)= }(type %d)= ~(type %d)= (IP over Infiniband)> (type %d) =TiEmuTiEmu skin=v- Version> %cx .%cx %c =WARC/WARC Archivexversion %.4sapplication/warc = $HDTHDT file (binary compressed indexed RDF triples) type 1application/vnd.hdthdt =SHCC3MS Windows 3.1 registry file =\1cw ChiWriter file>version %s =o65o65= executable,= object,xversion %d,= 65816,= 6502,=  32 bit,=  16 bit,= @@page reloc,= @byte reloc,= alignment 1= alignment 2= alignment 4= alignment 256 ="sim65sim65 executable,x#version %d,= $6502= %65C02@(=+$ package=W%^package[[:space:]]+[0-9A-Za-z_:]+[[:space:]]*([[:space:]]v?[0-9][0-9.]*)?[[:space:]]*;Perl5 module source text@K!+( p=W)^package[[:space:]]+[0-9A-Za-z_:]+[[:space:]]*([[:space:]]v?[0-9][0-9.]*)?[[:space:]]*;=0*^1[[:space:]]*;|^(use|sub|my)[[:space:]].*[(;{=]Perl5 module source text@=+"^(const|var|let).*=.*require\(JavaScript sourceapplication/javascriptjs $=+=^Missing operating system=HD1/x=vOperating system loadSYSLINUX MBR=$berror= (version 3.35 or older)=. (version 3.52 or newer)x(version 3.36-3.51 )=pjDisk error on boot SYSLINUX GPT-MBR= Boot partition not found = OS not bootable (version 3.86 or older)=  Missing OS = Multiple active partitions (version 4.00 or newer)`= +Fe=1.2)=:karbonKarbon document=:kchartKChart document=:kformulaKFormula document=:kivioKivio document=:kontourKontour document= :kpresenterKPresenter document=:kspreadKSpread document=:kwordKWord document= 2vnd.sun.xml.OpenOffice.org 1.x=>writerWriter!D.documentapplication/vnd.sun.xml.writersxw= D.templatetemplateapplication/vnd.sun.xml.writer.templatestw=D.webWeb templateapplication/vnd.sun.xml.writer.webstw=D.globalglobal documentapplication/vnd.sun.xml.writer.globalsxg=>calcCalc!B.spreadsheetapplication/vnd.sun.xml.calcsxc= B.templatetemplateapplication/vnd.sun.xml.calc.templatestc=>drawDraw!B.documentapplication/vnd.sun.xml.drawsxd= B.templatetemplateapplication/vnd.sun.xml.draw.templatestd=>impressImpress!E.presentationapplication/vnd.sun.xml.impresssxi= E.templatetemplateapplication/vnd.sun.xml.impress.templatesti=>mathMath documentapplication/vnd.sun.xml.mathsxm=>baseDatabase fileapplication/vnd.sun.xml.basesdb=2vnd.openofficeorg.OpenOffice= Dextension/LibreOffice Extensionapplication/vnd.openofficeorg.extensionoxt=2vnd.oasis.opendocument.OpenDocument=Itext!M-Textapplication/vnd.oasis.opendocument.textodt= M-templateText Templateapplication/vnd.oasis.opendocument.text-templateott=M -webHTML Document Templateapplication/vnd.oasis.opendocument.text-weboth=M -master!T-Master Documentapplication/vnd.oasis.opendocument.text-masterodm= T-templateMaster Templateapplication/vnd.oasis.opendocument.text-master-templateotm=Igraphics!Q-Drawingapplication/vnd.oasis.opendocument.graphicsodg= Q-templateDrawing Templateapplication/vnd.oasis.opendocument.graphics-templateotg= Ipresentation!U-Presentationapplication/vnd.oasis.opendocument.presentationodp= U-templatePresentation Templateapplication/vnd.oasis.opendocument.presentation-templateotp= I"spreadsheet!T#-Spreadsheetapplication/vnd.oasis.opendocument.spreadsheetods= T&-templateSpreadsheet Templateapplication/vnd.oasis.opendocument.spreadsheet-templateots=I)chart!N*-Chartapplication/vnd.oasis.opendocument.chartodc= N--templateChart Templateapplication/vnd.oasis.opendocument.chart-templateotc=I0formula!P1-Formulaapplication/vnd.oasis.opendocument.formulaodf= P4-templateFormula Templateapplication/vnd.oasis.opendocument.formula-templateotf=I8databaseDatabaseapplication/vnd.oasis.opendocument.databaseodb=I<baseDatabaseapplication/vnd.oasis.opendocument.baseodb=I@image!NA-Imageapplication/vnd.oasis.opendocument.imageodi= ND-templateImage Templateapplication/vnd.oasis.opendocument.image-templateoti=2Kepub+zipEPUB documentapplication/epub+zip=2Thwp+zipHancom HWP (Hangul Word Processor) file, HWPXapplication/x-hwp+ziphwpx= 2[x-vnd.corel.Corel=>\draw.document+zipDraw drawing, version 14-16application/x-vnd.corel.draw.document+zipcdr=>_draw.template+zipDraw template, version 14-16application/x-vnd.corel.draw.template+zipcdrt=>bzcf.draw.document+zipDraw drawing, version 17-22application/x-vnd.corel.zcf.draw.document+zipcdr=>ezcf.draw.template+zipDraw template, version 17-22application/x-vnd.corel.zcf.draw.template+zipcdt/cdrt=>izcf.pattern+zipDraw pattern, version 22application/x-vnd.corel.zcf.pattern+zippat=>odesigner.document+zipDESIGNER graphics, version 14-16application/x-vnd.corel.designer.document+zipdes=>rzcf.designer.document+zipDESIGNER graphics, version 17-21application/x-vnd.corel.zcf.designer.document+zipdes=>wsymbol.library+zipSymbol Library, version 6-16.3application/x-vnd.corel.symbol.library+zipcsl=>zzcf.symbol.library+zipSymbol Library, version 17-22application/x-vnd.corel.zcf.symbol.library+zipcslx2Zip data= &[!-OQ-~]+(MIME type "%s"?)application/zip= mimetype! &application/= &[!-OQ-~]+Zip data (MIME type "%s"?)application/zip= Java archive data (JAR)application/java-archivejar! ! mimetype=Payload/=&@.app/iOS Appapplication/x-ios-app! !d@application/epub+zip! mimetypeZip archive dataapplication/zipx, at least= .zipversionxto extractx, compression method==.zipcompression=aWINZIP, WinZIP self-extracting@=+@__BUNDLE_START_TIME__=React Native minified JavaScriptapplication/javascriptbundle/jsbundle =s?B<=t‡jAdrift game file version=ua6E3.80=va7E3.90=wa>E4.0=xa>E5.0xyunknownapplication/x-adrift = dex =  dex [0-9]{2}Dalvik dex file> 000version %s =dey = dey [0-9]{2}Dalvik dex file (optimized for host)>000version %s(= fv4=h< jPartition Information Table for Samsung smartphonex k, %d entries> m; #1= .nPIT-entry> o; #2= .pPIT-entry> q; #3= .$rPIT-entry> s; #4= .tPIT-entry> u; #5= .,vPIT-entry> w; #6= .xPIT-entry> y; #7= .4zPIT-entry> {; #8= .|PIT-entry> }; #9= .<~PIT-entry>  ; #10= .PIT-entry>  ; #11= .DPIT-entry>  ; #12= .PIT-entry>  ; #13= .LPIT-entry>  ; #14= .PIT-entry> ; #15= .TPIT-entry> ; #16= .PIT-entry> ; #17= .\PIT-entry> ; #18= .PIT-entry = +Android binary XML =pro=pro0[0-9][0-9]Android ART profileprof=001, version 001 N=005, version 005 O=009, version 009 O MR1=010, version 010 P=015, version 015 S =prm=prm0[0-9][0-9]Android ART profile metadataprofm=001, version 001 N=002, version 002 =;=<JVT NAL sequence, H.264 video==B, baseline=>M, main=?X, extendedx@ @ L %u =A=BMPEG sequencevideo/mpegvob/evo/mpg/mpeg&G@, v2, program multiplex^H@, v1, system multiplex=IMPEG sequence, v1/2, multiplex (missing pack header)=JMPEG sequence, H.264 video=KB, baseline=LM, main=MX, extendedxN @ L %u=PMPEG sequence, v4video/mpeg4-generic=T& U= V, video= W , still texture= X0, mesh= Y@, face= Z, video= [, still texture= \, mesh= ] , face=^, simple @ L1=_, simple @ L2=`, simple @ L3=a, simple @ L0=b, simple scalable @ L1=c, simple scalable @ L2=d!, core @ L1=e", core @ L2=f2, main @ L2=g3, main @ L3=h5, main @ L4=iB, n-bit @ L2=jQ, scalable texture @ L1=ka, simple face animation @ L1=lb, simple face animation @ L2=mc, simple face basic animation @ L1=nd, simple face basic animation @ L2=oq, basic animation text @ L1=pr, basic animation text @ L2=q, hybrid @ L1=r, hybrid @ L2=s, advanced RT simple @ L!=t, advanced RT simple @ L2=u, advanced RT simple @ L3=v, advanced RT simple @ L4=w, core scalable @ L1=x, core scalable @ L2=y, core scalable @ L3=z, advanced coding efficiency @ L1={, advanced coding efficiency @ L2=|, advanced coding efficiency @ L3=}, advanced coding efficiency @ L4=~, advanced core @ L1=, advanced core @ L2=, advanced scalable texture @ L1=, advanced scalable texture @ L2=, advanced scalable texture @ L3=, simple studio @ L1=, simple studio @ L2=, simple studio @ L3=, simple studio @ L4=, core studio @ L1=, core studio @ L2=, core studio @ L3=, core studio @ L4=, advanced simple @ L0=, advanced simple @ L1=, advanced simple @ L2=, advanced simple @ L3=, advanced simple @ L4=, advanced simple @ L5=, advanced simple @ L3b=, FGS @ L0=, FGS @ L1=, FGS @ L2=, FGS @ L3=, FGS @ L4=, FGS @ L5=MPEG sequence, v4video/mpeg4-generic&=, video (missing profile header)= , still texture (missing profile header)=0, mesh (missing profile header)=@, face (missing profile header)=, video (missing profile header)=, still texture (missing profile header)=, mesh (missing profile header)= , face (missing profile header)=MPEG sequencevideo/mpeg= , v1, progressive Y'CbCr 4:2:0 video= , v1, progressive Y'CbCr 4:2:0 video= , v2,= HP= Spt= SNR= MP= SP=@@HL=`@H-14=@ML=@LL& progressive^ interlaced= Y'CbCr 4:2:0 video= Y'CbCr 4:2:2 video= Y'CbCr 4:4:4 video& &K=, v1, progressive Y'CbCr 4:2:0 video=, v1, progressive Y'CbCr 4:2:0 video=, v2,= HP= Spt= SNR= MP= SP=@@HL=`@H-14=@ML=@LL& progressive^ interlaced= Y'CbCr 4:2:0 video= Y'CbCr 4:2:2 video= Y'CbCr 4:4:4 video=L, v1, progressive Y'CbCr 4:2:0 video=L, v1, progressive Y'CbCr 4:2:0 video=L, v2,=P HP=P Spt=P SNR=P MP=P SP=Q@@HL=Q`@H-14=Q@ML=Q@LL&Q progressive^Q interlaced=Q Y'CbCr 4:2:0 video=Q Y'CbCr 4:2:2 video=Q Y'CbCr 4:4:4 video=8x, HD-TV 1920P=, 16:9=-P, SD-TV 1280I=, 16:9=@0, PAL Capture=, 4:3=,, 4CIF= NTSC=@ PAL= , 4:3=0, 16:9=@, 11:5=, PAL 4:3=, NTSC 4:3=(, LD-TV 640P=, 4:3=, 320x240=, 4:3=, 240x160=, 4:3=x , 160x120=, 4:3=, CIF= NTSC=  PAL= , 4:3=0, 16:9=@, 11:5=, PAL 4:3=, NTSC 4:3=@ PAL 625= , 4:3=0, 16:9=@, 11:5=-, CCIR/ITU= NTSC 525=@ PAL 625= , 4:3=0, 16:9=@, 11:5=, SVCD= NTSC 525=@ PAL 625= , 4:3=0, 16:9=@, 11:5=, 23.976 fps= , 24 fps= , 25 fps= , 29.97 fps= , 30 fps= , 50 fps=, 59.94 fps=, 60 fps& , Constrained =+!!MPEG ADTS, layer III, v1audio/mpeg=!, 32 kbps=" , 40 kbps=#0, 48 kbps=$@, 56 kbps=%P, 64 kbps=&`, 80 kbps='p, 96 kbps=(, 112 kbps=), 128 kbps=*, 160 kbps=+, 192 kbps=,, 224 kbps=-, 256 kbps=., 320 kbps=0 , 44.1 kHz=1 , 48 kHz=2 , 32 kHz=4, Stereo=5@, JntStereo=6, 2x Monaural=7, Monaural =_@G=GMPEG transport stream datavideo/MP2Tts =_@G=GBDAV MPEG-2 Transport Stream (M2TS)video/MP2Tm2ts/mts =ANIM=AHDRLucasArts Smush Animation Format (SAN) video =SANM=SHDRLucasArts Smush v2 (SANM) video =CRID= @UTFScaleform video =2MOOF=3 Apple Macintosh MOOF Disk Image= 4INFO=5, SSDD GCR (400K)=6, DSDD GCR (800K)=7, DSHD MFM (1.44M)=8, write protected=9, cross track synchronizedx: , %.32s =k> mApplesoft BASIC program data, first line number %d =LMP= .Oapple-apm =>< = = .apple-rsr!  == .apple-rsr == .apple-rsr =BOBO>= == .appleworks== .appleworks =itch=artw=dataiTunes cover art=PNG(PNG)=(JPEG) =&v<' APT cache data, version %ux(.%u, 32 bit big-endian=.)apt-cache-32bit-be>* APT cache data, version %ux+.%u, big-endian= .,apt-cache-be = .v< / APT cache data, version %ux 0.%u, 32 bit little-endian=.1^apt-cache-32bit-be>2 APT cache data, version %ux3.%u, little-endian= .4^apt-cache-be =+PKZip archive data (empty)application/zipzip/cbz = ܧ> Zoo archive dataapplication/x-zoozoo/bak>0, v%c.>/%c>/%c!  Archive., at 8xtext "%0.10s"> , modify: v%dx!.%d+x , extract: v%ux .%u+> !", header type %u> #, at %dx '%u bytes comment < #  < # x #%s <  < >037%s!), vdata %#xx ; at %u ! type=%u x method== not-compressed= lzd= lzhx , next entry at %ux , CRC %#4.4x>  , at %#x > $%u bytes commentx "%s"x , size %u x (%u compressed)= , deleted! , structuredx &, %0.13s =  > 3 > 8x :"%s" > 9 x 7xin "%s"! 5, time zone %d/4x6 , modified %sx9 %s= STOP= XPAKSTOPGentoo binary package (XPAK)application/vnd.gentoo.xpak = XBTF= XBMC texture packageapplication/x-xbmc-xbtxbt! 2, version %-.1sx  , %u file>  sx , 1st %s(= =  Synology archivespk=+ package=x , package %s=+ arch=x %s=+ version=x %s= + create_time=x , created on %s(= * = , {"files":{"=  - }}}}Electron ASAR archiveasarx / , header length: %d bytes =!ECI=(NDHSNDH Atari ST music=(TITLSNDH Atari ST music =Vgm > VGM Video Game Music dump vaudio/x-vgmvgm> %dx %dx.%d>%dx, soundchip(s)=> SN76489 (PSG),> YM2413 (OPLL),> ,YM2612 (OPN2),> 0YM2151 (OPM),> 8Sega PCM,> 4 > @RF5C68 (PCM),> 4> DYM2203 (OPN),> 4> HYM2608 (OPNA),> 4> LYM2610 (OPNB),< LYM2610B (OPNB+2FM),> 4> PYM3812 (OPL2),> 4 > TYM3526 (OPL),> 4$> XY8950 (MSX-Audio),> 4(> \YMF262 (OPL3),> 4,> `YMF278B (OPL4),> 40> dYMF271 (OPX),> 44> hYMZ280B (PCMD8),> 48> l RF5C164 (PCM),> 4 <> p PWM,> 4 @> t =xAY-3-8910,=xAY-3-8912,=xAY-3-8913,=xAY-3-8930,=xYM2149,=xYM3439,=xYMZ284,=xYMZ294,> 4L> DMG,> 4P> NES APU,< NES APU with FDS,> 4T> MultiPCM,> 4X> uPD7759 (ADPCM Speech),> 4 \> !OKIM6258 (ADPCM Speech),> 4"d> #OKIM6295 (ADPCM),> 4$h> %K051649,> 4&l> 'K054539,> 4(p> )HuC6280,> 4*t> +C140,> 4,x> -K053260,> 4.|> /Pokey,> 40> 1QSound,> 43> 4SCSP,> 45> 6WonderSwan,> 47> 8VSU,> 49> :SAA1099,> 4;> <ES5503 (DOC),> 4=> >ES5505 (OTIS),< ?ES5506 (OTTO),> 4@> AX1-010,> 4B> CC352,> 4D> EGA20, =KSCOW=LGVOX Encore music, version 5.0 or above=MGVOX Encore music, version < 5.0 =OZBOT=PGVOX Encore music, version < 5.0 =FRM8 =HBCF> J> LSAMtools BCF (Binary Call Format)> N=P##samtoolsVersion=xQ, generated by SAMtools version %s =@HD =VN:Sequence Alignment/Map (SAM), with header=[0-9.]+ version %s == BlackBerry RIM ETP filex for %s@=+A using=@B^using[[:space:]]+(namespace )?std(::)?[[:alpha:]]*[[:space:]]*;C++ source texttext/x-c++ = +MM= =   = !==3D Studio modelimage/x-3ds3ds =>compiled Java class data,application/x-java-appletclassxversion %d.x%d=".(Java 1.2)=#/(Java 1.3)=$0(Java 1.4)=%1(Java 1.5)=&2(Java 1.6)='3(Java 1.7)=(4(Java 1.8)=)5(Java SE 9)=*6(Java SE 10)=+7(Java SE 11)=,8(Java SE 12)=-9(Java SE 13)=.:(Java SE 14)=/;(Java SE 15)=0<(Java SE 16)=1=(Java SE 17)=2>(Java SE 18)=3?(Java SE 19)=4@(Java SE 20) =W=XMach-O universal binary with 1 architecture:application/x-mach-binary=.Zmach-o>\<]Mach-O universal binary with %d architectures:application/x-mach-binary=._mach-o>`=.amach-o>b=.0cmach-o>d=.Demach-o>f=.Xgmach-o>h=.limach-o = < ksh byte-code version %d = ]= =.lzma= =.lzma = 4P*Mx) 5 =BUNIF< CNES ROM image (UNIF v%d format)application/x-nes-rom =UFDS=V*NINTENDO-HVC*Famicom Disk System disk image:application/x-fds-disk=.Xnintendo-fds-disk-info-block=Y(%u side)!Z(%u sides) =SEGA=MARS CHECK MODESega 32X ROM imageapplication/x-genesis-32x-rom=.sega-mega-drive-header= PICOSega Pico ROM imageapplication/x-sega-pico-rom=.sega-mega-drive-header= TOYS PICOSega Pico ROM imageapplication/x-sega-pico-rom=.sega-mega-drive-header=  TOYS PICOSega Pico ROM imageapplication/x-sega-pico-rom=.sega-mega-drive-header= IACSega Pico ROM imageapplication/x-sega-pico-rom=.sega-mega-drive-header= TERA68KSega Teradrive (68K) ROM imageapplication/x-sega-teradrive-rom=.sega-mega-drive-header= TERA286Sega Teradrive (286) ROM imageapplication/x-sega-teradrive-rom=.sega-mega-drive-header=BRSega Mega CD Boot ROM imageapplication/x-genesis-rom=.sega-mega-drive-headerxSega Mega Drive / Genesis ROM imageapplication/x-genesis-rom=.sega-mega-drive-header =&EAGN='Sega Mega Drive / Genesis ROM image (SMD format):application/x-genesis-rom=.)sega-genesis-smd-header =,EAMG=-Sega Mega Drive / Genesis ROM image (SMD format):application/x-genesis-rom=./sega-genesis-smd-header =PIRS=Microsoft Xbox 360 package (non-Xbox Live)=.xbox-360-package =LIVE=Microsoft Xbox 360 package (Xbox Live)=.xbox-360-package =CISO<= CSO v1 disk imageapplication/x-compressed-isociso/csox , original size %llu bytesx !, datablock size %u bytes=#= $= %CSO v2 disk imageapplication/x-compressed-isociso/csox(, original size %llu bytesx ), datablock size %u bytes =8= ==3Nintendo GameCube embedded disc image:application/x-gamecube-rom=.nintendo-gcn-disc-common =WBFS=]Nintendo Wii disc image (WBFS format):application/x-wii-rom=.nintendo-gcn-disc-common =CISO=  ===3Nintendo GameCube disc image (CISO format):application/x-wii-rom=.nintendo-gcn-disc-common=]Nintendo Wii disc image (CISO format):application/x-wii-rom=.nintendo-gcn-disc-common =  = Nintendo GameCube disc image (GCZ format)application/x-gamecube-rom= Nintendo Wii disc image (GCZ format)application/x-wii-romxNintendo GameCube/Wii disc image (GCZ format) ====]Nintendo Wii SDK disc image:application/x-wii-rom=.nintendo-gcn-disc-common==3Nintendo GameCube SDK disc image:application/x-gamecube-rom=.nintendo-gcn-disc-common =NCSD=Nintendo 3DS Game Card image>P: "%.16s"x(Rev.%02u)=(New3DS only)=(inner device)=(Card1)=(Card2)=(extended device)=Nintendo 3DS eMMC dump (Old3DS)=Nintendo 3DS eMMC dump (New3DS) =HEAD= Nintendo Switch cartridge image (XCI), 1GB= Nintendo Switch cartridge image (XCI), 2GB= Nintendo Switch cartridge image (XCI), 4GB= Nintendo Switch cartridge image (XCI), 8GB= Nintendo Switch cartridge image (XCI), 16GB= Nintendo Switch cartridge image (XCI), 32GB =PRBS>D Nintendo Badge Arcade< < badge:> Mega Badgex (%uxx %u):> Mega Badgex (%uxx %u):xD"%s"x <, badge ID: %u>t xt, set: "%s"! x , launch title ID: %08Xx -%08X =CABS>, Nintendo Badge Arcade badge set:x,"%.48s"x $, set ID: %u(= 7= .8xbase-index(= := .;xbase-index(= =!?version=A= .Dxbase-index(==Extensible storage engineapplication/x-ms-ese= DataBaseedb/sdb= STreaMingstmx , version %#x> revision %#4.4xx, checksum %#8.8xx, page size %lld= 4, JustCreated= 4, DirtyShutdown= 4, BeingConverted= 4, ForceDetachx , Windows version %dx .%d =sdbf== xWindows application compatibility Shim DataBaseapplication/x-ms-sdbsdb = = Universal EFI binary with 1 architecture= , i386= , x86_64=  Universal EFI binary with 2 architectures= , i386= , x86_64=  , i386= , x86_64> Universal EFI binary with %d architectures = FOR1= BEAMErlang BEAM file(= 뛐= /Boot failed= LDLINUX SYSSyslinux bootloader (version 2.13 or older)=XSyslinux bootloader (version 3.0-3.9)= Boot error =XSyslinux bootloader (version 3.10 or newer) =CISO! !  ! ! @Compressed ISO CD image =p=GFS1 Filesystemx$(blocksize %d,>`lockproto %s)= GFS2 Filesystemx$(blocksize %d,>`lockproto %s) =XFSM=XFSBXFS filesystem metadump image =XFSM= XFSBXFS filesystem metadump image = JFS1<  JFS2 filesystem image=  [ -~]{1,16}(label "%s")x , %lld blocksx  , blocksize %d>  (dirty)> $ (compressed) = 1=  UBIfs imagex , sequence number %llux  , length %ux  , CRC %#08x = UBI#<  = =  x  UBI image, version %u(= =  = = = < F@>  !=  [[:print:]]*NEC PC-88 disk image, name=%s= , media=2D= , media=2DD= , media=2HD= 0, media=1D= @, media=1DD= , write-protected = v=  |Frontier Silicon firmware downloadx  , MeOS version %xx , version %sx( @ , customization %s =u=hwX11 SNF font data, MSB firstapplication/x-font-sfnsnf = }= h~X11 SNF font data, LSB firstapplication/x-font-sfnsnf =FILE=PFF2== NAMEGRUB2 fontapplication/x-font-pf2pf2>>"%-s" =typ1= .sfnt-font= .sfnt-names =true= . sfnt-font= . sfnt-names = = .sfnt-font= .sfnt-names =yttcf={ ! }OTTOTrueTypefont/ttf????tfilttc = OTTOOpenTypefont/otf????OTTOttc/otcxfont collection data=, 1.0=, 2.0>, %d fonts x=GISD, digitally signedx , at %#x= . sfnt-font = = > ARM OpenFirmware FORTH Dictionary,x Text length: %d bytes,x Data length: %d bytes,x Text Relocation Table length: %d bytes,x $Data Relocation Table length: %d bytes,x (Entry Point: %#08X,x ,BSS length: %d bytes =*PACK< - = 71Quake I or II world or extensionapplication/x-dzippakx 6@, %u filesx 8, offset %#x= . :pak-entry =ESVG= = TOCEmpire Deluxe for DOS saved game =CIV5=Sid Meier's Civilization V saved game,=  [0-9a-z.]+saved by game version %s=Sid Meier's Civilization V replay data,=  [0-9a-z.]+saved by game version %s(= < > < ȯGTA audio index data (SDT)(= = $GTA2 binary main script (SCR)(= M0FPR< N RAGE Package Format (RPF), version %d, used in= ORockstar Table Tennis,= P*unknown*= QGTA IV,= RGTA IV Audio & Midnight Club: LA,= SMax Payne 3,= T*unknown*= URDR,= VGTA V,= WRDR 2,x X%d bytes,x Y%d entries =^BB3D> _> `Blitz3D Modelb3dx b, version %d =rVOX > sMagicaVoxel modelvoxx u, version %d =zBKHD< |Wwise SoundBank (little-endian)bnk= .~wwise_bkhd<Wwise SoundBank (big-endian)bnk= .^wwise_bkhd =AKPK< Wwise Audio Package (little-endian)pck<Wwise Audio Package (big-endian)pck = DATA=. gentoo-manifest = DIST=.gentoo-manifest = ==KBXfGPG keybox database=version %dx , created-at %sx , last-maintained %s =$acsp= .color-profile((=-!$>&<("!* =,= .-tga-image=.= ./tga-image=0= .1tga-image=2= .3tga-image=4= .5tga-image=6 = .7tga-image =Hpush=Jgraphic-contextImageMagick Vector Graphicimage/x-mvgmvg =AWBM< Award BIOS Logo, version 2image/x-award-bioslogo2epa/bmp=  x , %dx x %d> ,= x %d+3= x %d+2= x %d+1x x %d(=(=x$X-Window screen dump image data, version X10image/x-xwindowdumpxwdx, %dxx%dx x%u! , x=%d!", y=%d!$, %u border(= ><!PCXimage/x-pcx=ver. 2.5 image data=ver. 2.8 image data, with palette=ver. 2.8 image data, without palette=for Windows image data=ver. 3.0 image datax bounding box [%d,x %d] -x [%d,x %d],>A%d planes each ofx%d-bit=Dcolour,=Dgrayscale,xDimage,> %d xx %d dpi,=uncompressed=RLE compressed = 8BPS>Adobe Photoshopimage/vnd.adobe.photoshop????8BPS=="PHUTImage (PhotoDeluxe)pddx"Imagepsd=Image (PSB)psbx, %d xx%d,= bitmap=!grayscale= #with alpha=$indexed=%RGB= &A='CMYK= (A=)multichannel=*duotone=+ lab> ,x -, %dx= .,x/%d-bit channel> 0s!4, at offset 6x50x%8.8xx6%4.4x =CDF> NetCDF Data Format dataapplication/x-netcdfnc =CDF> NetCDF Data Format data (64-bit offset)application/x-netcdfnc(= =  PresetInfoUlead pattern imageimage/x-ulead-pstpstx  "%s"(= v =  Sony PlayStation PSX image,image/x-sony-timtim=  4-Bit,=  8-Bit,=  15-Bit,=  24-Bit,=  Mixed-Bit,&   x  Pixel at (%d,x  %d) Size==  x  %d=  x  %dx  x%d,=  16 CLUT Entries at=  256 CLUT Entries atx (%d,x  %d)^  x Pixel at (%d,x  %d) Size==  x  %d=  x  %d=  x  %d=  x  2/3*%d=  x  %dx  x%d = PVRT= DDS |Sega PVR (Xbox) image:=.  ms-directdraw-surface! SDDSega PVR image:=. sega-pvr-image-header = GBIX= PVRT= DDS |Sega PVR (Xbox) image:=.  ms-directdraw-surface! SDDSega PVR image:=. sega-pvr-image-headerx  , global index = %u =6 GBIX=7 GVRTSega GVR image:=.8 sega-gvr-image-headerx9 , global index = %u =< GCIX== GVRTSega GVR image:=.> sega-gvr-image-headerx? , global index = %u(=E PFL=F  = G Lytro Light Field PicturexH , version %d =qktn=Apple QuickTake 150 Raw Image>Apple QuickTake 200 Raw Image= .quicktake =DSDT= .acpi-table =APIC= .acpi-table = FACP= . acpi-table =MCFG= .acpi-table =SLIC= .acpi-table =SSDT= .acpi-table@=+.^(import|export).* from JavaScript sourceapplication/javascriptjs =PK= =!doc.kmlCompressed Google KML Document, including resources.application/vnd.google-earth.kmz = x>Device Tree Blob version %dx, size=%d>x, boot CPU=%d>x , string block size=%d>x$, DT structure block size=%d =6;ELC>8Emacs/XEmacs v%d byte-compiled Lisp dataapplication/x-elcEMAxTEXTelc = +'Mach-Oapplication/x-mach-binary= .*^mach-o-be =+,Mach-Oapplication/x-mach-binary= ./mach-o-be =8=:versionMaple help databaseapplication/x-maple-hdbhdbx@=CAMapleMaple help databaseapplication/x-maple-hdbhdb =-(*^ =..wolfram = E= B=webmWebMvideo/webm=matroskaMatroska datavideo/x-matroska =/GRIB=0Gridded binary (GRIB) version 1application/x-gribgrb/grib=3Gridded binary (GRIB) version 2application/x-grib2grb2/grib2 = 0|=$ >Micro Focus File with Header (DAT)application/octet-stream =0~=$>Micro Focus File with Header (DAT)application/octet-stream =1>Microsoft= `Wordapplication/mswordMSWDWDBNdoc/dcx=n1.0-4.0!n5.0-6.0xn(DOS) Document! `Write 3.0 (Windows) Documentapplication/x-mswriteMSWDWDBNwri/doc x = x%sx, author %sx, reviser %sx, keywords %sx, comment %s x, version %s x, %-.8s x created %-.8s>0, formatted by %-.66s> `, %u pages>b0, %-.8s printer> j, %u blocksx,>x%s< >x%s< >x%s< >x%s< >x%s< > x%s ==2Microsoft Word for Macintosh 1.0application/mswordmcw= 4Microsoft Word for Macintosh 3.0application/mswordmcw=7Microsoft Word for Macintosh 4.0application/mswordmcw=#7Microsoft Word for Macintosh 5.0application/mswordmcw =/>3<4 Lotus 1-2-3application/vnd.lotus-1-2-3????L123= 9WorKsheet, version 3wk3= <WorKsheet, version 4wk4/wt4= CWorKsheet, version 97123= GWorKsheet, version 9.8 Millennium123= JFoRMatting datafrm= NForMatting data, version 3fm3xPunknown= RworksheetwXX! Tformatting datafXXx W, revision %#x= X, cell range! [> \%d*x ]%d,x ^%d->`%d*x b%d,xc%d>e, character set %#xxg, flags %#x! h=j>l, 1st font "%s" =@ƚ= Windows metafile! , resource handle %#xx , bounding box (%dx ,%dx / %dx ,%d)x , dpi %u! , reserved %#xx , checksum %#x=.wmf-head =@ > Windows metafile=.wmf-head =6= 7x8= .9cur-ico-dir= :x;= .<cur-ico-dir == = .cur-ico-dir= = .cur-ico-dir = = Windows Recycle Bin INFO2 file (Win98 or below) = =  Windows Recycle Bin INFO2 file (Win2k - WinXP) =TPF0> Delphi compiled form '%s' =NG= Norton Guideapplication/x-norton-guideng/hlp>"%-.40s">0, %-.66s>r%-.66s(= n=(o EMFWindows Enhanced Metafile (EMF) image datax ,pversion %#x =y@$RBU=zDell%s system BIOS={x0|version %d.x1}%d.x2~%d<x0version %.3s(=!  = %=.&omf-lib =-@MBMS=.MSX Moonblaster for MoonSound music =I@SCMD= JMSX SCMD Music file>L, title: %s =@AB= > @MSX-BASIC extension ROM> , stahdl=%#04x> , devhdl=%#04x=OPLL, MSX-Music=PAC2 (external)=APRL (internal) =8hpux=.ktrace =<libr= >Palm OS dynamic library data "%s" =@Type=D2Dan Bricklin's Demo 2 demodbd=T2Turbo Pascal TOUR dataapplication/x-borland-cbtcbtx%Dan Bricklin's Demo demo (generic)dbd = = =  OSMHeaderOpenStreetMap Protocolbuffer Binary Format(= = = = = < F@>  != [[:print:]]*NEC PC-88 disk image, name=%s=, media=2D=, media=2DD= , media=2HD=0, media=1D=@, media=1DD=, write-protected =PCjr=UPCjr Cartridge image=UPCjr Cartridge image =PMEM=POOLSETPersistent Memory Poolset file= REPLICAwith replica=  LOG|BLK|OBJPersistent Memory Pool file, type: %s,>  version: %#x,x compat: %#x,x  incompat: %#x,x  ro_compat: %#x,xxcrtime: %s,xalignment_desc: %#016llx,x/=machine_class: 64-bit,xmachine_class: unknownx(%#d),x/=data: little-endian,=data: big-endian,xdata: unknownx(%#d),!reserved[0]: %d,!reserved[1]: %d,! reserved[2]: %d,!!reserved[3]: %d,x/#= $>machine: x86_64= %machine: aarch64x&machine: unknownx '(%#d)=)BLKx *, blk.bsize: %d=,OBJ>-0, obj.layout: '%s'<.0, obj.layout: NULL =&> *DOS EPS Binary Fileimage/x-eps>.at byte %d>0length %d x) 2> 6at byte %deps>9length %dx) ;>>at byte %deps/ept>Blength %dx) D =JZJZ=ZZZenographics ZjStream printer data (big-endian) =ZJZJ=ZZZenographics ZjStream printer data (little-endian) =INPS=.hpgl = V= ^[0-9]ps database> version %s>from kernel %s =PACK< =  ::x !Git packapplication/x-gitpackx%, version %ux&, %u objects= ,= = = = 283x=  =  = DTOK= ,= $ =(RPTLRaspberry PI kernel image= 8= = = =283x= = =DTOK= = $ =(DDTK8 = 0 =4RPTLRaspberry PI kernel image@=+===^[=]+$=:Author:ReStructuredText file=   Authors:ReStructuredText file=  Author:ReStructuredText filex =  ^\.\.[A-Za-z]ReStructuredText filerst =RSIC= Rust incremental compilation metadatabinx , rustc %s =<<<<QL OS dump data,>type %.3s,>version %.4s(=9 =:M<+pcapng capture filex ;- version %dx<.%d(= = = >M<+pcapng capture filex ?- version %dx @.%d == =.5view-le =< ==MACFMySQL Maria control filex>Version %d(= -=.shm-le(=-=.^shm-le = ID;P>spreadsheet interchange documentapplication/x-sylkslk/sylk>, created by=GnumericGnumeric=pmwPlanMaker= CALCOOO32Libre/OpenOffice Calc=SCALC3StarOffice Calc=XLExcel=WXLExcel=MPMultiplanx!x"%s = &= 'd= ('= )2= *P= +d= ,= -= $. = (/d x 0LG robot VR6[234]xx %dm^2 navigation = h1reuse map data = h2map data > h3spurious map data < h4spurious map data ==VMS Alpha executable=&PK, Info-ZIP SFX archive v5.12 w/decryption =ϭ> |MS Outlook Express DBX fileapplication/x-ms-dbxdbx=!, message database=", folder database=#, account information=$0, offline database!&, versionx (%ux *.%ux |/, ~ %u bytesx \1, highest ID %#xx 3, %u item! 5s> 7, index pointer %#x =lPAGE=nDUMPMS Windows 32bit crash dumpapplication/x-ms-dmpdmpx t, version %ux v.%u! L, MachineImageType %#xx $, %u processors=\, no PAE=\, PAE= , full dump= , kernel dump= , small dump> , dump type (%#x)x h, %d pages=DU64MS Windows 64bit crash dumpapplication/x-ms-dmpdmpx , version %ux .%u! 0d, MachineImageType %#xx 4, %u processorsx ,= full dump= kernel dump= small dumpxDumpTypex (%#x)x, %lld pages =0$SDI=10001System Deployment Imageapplication/x-ms-sdisdi!7, MDBtype %#llx!9, BootCodeOffset %#llx!;, BootCodeSize %#llx! =, VendorID %#llx!(?, DeviceID %#llx!0A, DeviceModel %#llx!8B%llx!@D, DeviceRole %#llx!PH, RuntimeGUID %#llx!XI%llx!`K, RuntimeOEMrev %#llx!pO, PageAlignment %lluxS, checksum %#llx>U, type %-3.8s! W(%#llx)!Y%#llx attributesx[at %#llx>]%llu bytes x) ^>@`, type %-3.8s!(a(%#llx)!Hc%#llx attributesxPeat %#llx>Xf%llu bytes x) Pg>i, type %-3.8s =Version== EventTypeWindows Error Reporttext/plainwer = ?_ =  ;)MS=bmfWindows help annotationapplication/x-winhelpann!bmf= e|PeteWindows help Global Indexapplication/x-winhelpgid! e|Pete=Il= .help-ver-date! = il= . help-ver-date!  = Il = .help-ver-date !  =Il = .help-ver-date !  =Il = .help-ver-date ! =Il= .help-ver-date! =Il= .help-ver-date! Windows y.z helpapplication/winhelphlp=!Ilx#Windows help Bookmarkapplication/x-winhelpbmkx ), %d bytes = a!BDNxdMicrosoft Outlookapplication/vnd.ms-outlook= oBAPersonal Address Bookpab= xSMPersonal Storagepst= }SOOffline Storageostx (< <=2002, ANSI,> >=2003, Unicode,x version %u)>, bPlatformCreate=%u>, bPlatformAccess=%u! , dwReserved1=%#x! , dwReserved2=%#x< ! , dwUnique=%#x! , dwReserved=%#xx , %u bytes!, bSentinel=%#x>, bCryptMethod=%u> !, bidUnused=%#16.16llx! (, dwUnique=%#xx, %llu bytes!, bSentinel=%#x>, bCryptMethod=%ux , CRC32 %#x =TAPE== = $= Windows NTbackup archivebkf=  NetWare=  NetWare SMS=  NT=  3=  OS/2=  95=  Macintosh=  UNIX! , compressed! , End Of Medium hit= ! , with catalog! , with file catalog> <, sequence %u> >, %#x encrypted! @, soft size %u*512> D> F=0> F, name: %s=0x F, name: %s> H> J=0> J, label: %s=0x J, label: %sx V, software (%#x)> P> R=0> R: %s=0x R: %s! T, block size %u(=@=Windows Performance Monitor Alertapplication/x-perfmonpmaxP, "%s" = XBF< < Microsoft XAML Binary Formatxbfx %dx .%dx , metadata size: %d bytesx , node size: %d bytes =PRegx Group Policy Registry Policy, Version=%d ="WPC=$= 'WordPerfect macroapplication/x-wordperfect-wpmwpm= -WordPerfect help fileapplication/x-wordperfect-helpfil! 3, at %#x document area= 4WordPerfect keyboard fileapplication/x-wordperfect-keyboardwpkx 9, %u bytes= :WordPerfect VAX keyboard definitionapplication/x-wordperfect-keyboard= @ WordPerfect documentapplication/vnd.wordperfectwpd/wpt/wkb/icr/tut/sty/tst/crs= F WordPerfect dictionary= G WordPerfect thesaurus= H WordPerfect block= IWordPerfect rectangular block= JWordPerfect column block= KWordPerfect printer dataapplication/x-wordperfect-prsprs> dQA"%s"= TWordPerfect printer dataapplication/x-wordperfect-allall= YWordPerfect driver resource dataapplication/x-wordperfect-drsdrs! _F, at %#x index area= `WordPerfect Overlay fileapplication/x-wordperfect-filfil= jWordPerfect graphic imageimage/x-wordperfect-graphicswpg! u, at %#x document area= vWordPerfect hyphenation code= wWordPerfect hyphenation data= xWordPerfect macro resource dataapplication/x-wordperfect-mrsmrs= }WordPerfect hyphenation lex= ~WordPerfect wordlist= WordPerfect equation resource dataapplication/x-wordperfect-qrsqrs x >A(...%-.19s...)x , at %#x document area= !WordPerfect spell rules= "WordPerfect dictionary rules= $WordPerfect Video Resourceapplication/x-wordperfect-vrsvrs> A"%.23s"= 'WordPerfect spell rules (Microlytics)= )WordPerfect Install optionsapplication/x-wordperfect-insins>A"%.8s"= *WordPerfect Resourceapplication/x-wordperfect-irsirs>(A"%.24s"= +WordPerfect settings file= ,WordPerfect 3.5 documentapplication/vnd.wordperfect????WPD3wpd= -WordPerfect 4.2 document= EWordPerfect dialog file= FWordPerfect Writing Toolsapplication/x-wordperfect-cbtcbd/cbt= LWordPerfect button barx x Corel WordPerfect: Unknown filetype %d== Corel shell macro= Corel shell definitionx x Corel Shell: Unknown filetype %d== Corel Notebook macro= Corel Notebook help file= Corel Notebook keyboard file= Corel Notebook definitionx x Corel Notebook: Unknown filetype %d== Corel Calculator help filex x Corel Calculator: Unknown filetype %d=x x Corel File Manager: Unknown filetype %d== Corel Calendar help file= Corel Calendar data filex x Corel Calendar: Unknown filetype %d== Corel Editor macro= Corel Editor help file= Corel Editor keyboard file= Corel Editor macro resource filex x Corel Program Editor/Ed Editor: Unknown filetype %d== Corel Macro editor macro= Corel Macro editor help file= Corel Macro editor keyboard filex x Corel Macro Editor: Unknown filetype %d= x x Corel Plan Perfect: Unknown filetype %d= = Corel PlanPerfect macro= Corel PlanPerfect help file= Corel PlanPerfect keyboard file= Corel PlanPerfect worksheet= Corel PlanPerfect printer definition= Corel PlanPerfect graphic definition= Corel PlanPerfect data= Corel PlanPerfect temporary printer= Corel PlanPerfect macro resource datax x Corel DataPerfect: Unknown filetype %d= = Corel Mail help file= Corel Mail distribution list=  Corel Mail out box=  Corel Mail in box= Corel Mail users archived mailbox= Corel Mail archived message database= Corel Mail archived attachmentsx x Corel Mail: Unknown filetype %d= =  Corel Printer temporary filex x Corel Printer: Unknown filetype %d= = Corel Scheduler help file=  Corel Scheduler in file=  Corel Scheduler out filex x Corel Scheduler: Unknown filetype %d==  Corel GroupWise settings file= Corel GroupWise directory services= +Corel GroupWise settings filex x !Corel WordPerfect Office: Unknown filetype %d=%= ) WordPerfect Presentationapplication/x-drawperfect-shwshw! 0, at %#x document area! 2, at 0xC %#x= :Corel Presentationapplication/x-drawperfect-shwshw! A, at %#x document area! C, at 0xC %#x! E, at 0x10 %#xx G, %u bytes= MCorel Presentation (embeded)application/x-corelpresentations/! T, at %#x document area! U, at 0xC %#x! W, at 0x10 %#xx Y, %u bytesx ^x _Corel DrawPerfect: Unknown filetype %d=ax bx cCorel LetterPerfect: Unknown filetype %d=e= f Corel Terminal resource data= g Corel Terminal resource data= h+Corel Terminal resource datax ix jCorel Terminal: Unknown filetype %d=l= m Corel loadable file= n Corel GUI loadable text= o Corel graphics resource data= p Corel printer settings file= qCorel port definition file= rCorel print queue parameters= sCorel compressed filex tx uCorel loadable file: Unknown filetype %d=v, optimized for Intel=w, optimized for Non-Intel=y= z Corel Network service msg file= { Corel Network service msg file= | Corel Async gateway login msg= }Corel GroupWise message filex ~x Corel Network service: Unknown filetype %d== GroupWise admin domain database= GroupWise admin host database= GroupWise admin remote host database= GroupWise admin ADS deferment data filex x GroupWise: Unknown filetype %d= =  Corel Writing Tools User Word Listapplication/x-wordperfect-wordlistuwl/hwl/sav x =[Pax(...%-.33s...)! , at %#x document areax , %u bytes=!=  IntelliTAG (SGML) compiled DTDx x IntelliTAG: Unknown filetype %d="=  Corel WordPerfect dictionary adviseapplication/x-wordperfect-advadvx (...%-.33s...)xxUnknown Corel/Wordperfect product %d,x file type %d= , v5.! , v%d.x %d(== .PageMaker(== .^PageMaker ='=(fUXilinx RAW bitstream (.BIN) =YARA>  < YARA 3.x compiled rule setx/ = created with version 3.3.0=created with version 3.4.0= created with version 3.5.0xxdevelopment version %#02x=rPK=. zzipcd> ~0, %s = RISC OS Chunk data= OBJ_, AOF object= LIB_, ALF library = RISC OS AIF executable =DrawRISC OS Draw file data =6GlulGlulx game datax7(Version %dx8.%dx9.%d)=$:InfoCompiled by Informapplication/x-glulx =!hlsAllegro datafile (packed) =.hlsAllegro datafile (not packed/autodetect) = +hlsAllegro datafile (appended exe data) = AmigaOS shared library = AmigaOS loadseg()ble executable/binary = AmigaOS object/library data =FC14Future Composer 1.4 Module sound file =SMODFuture Composer 1.3 Module sound file ="ARP.The Holy Noise Module sound file =dAmigaOS outline tag =RDSKRigid Disk Blockxon %.24s =KICKKickstart disk =.KEYAmigaDOS script =.keyAmigaDOS script =AmSpAMOS Basic sprite bankx, %d sprites =AmIcAMOS Basic icon bankx, %d icons =AmBkAMOS Basic memory bankx, bank number %dx, length %d= .{8}, type %s =AmBsAMOS Basic memory banksx, %d banks = :&Android sparse imagex , version: %dx .%dx , Total of %dx %d-byte output blocks inx  %d input chunks. = ıAndroid cryptfs footerx , version: %dx .%d =vdexAndroid vdex file,>000verifier deps version: %s,>000dex section version: %s,> number of dex files: %d,> verifier deps size: %d =wdexAndroid vdex file, being processed by dex2oat,>000verifier deps version: %s,>000dex section version: %s,> number of dex files: %d,> verifier deps size: %d(=  Android package resource table (ARSC)arsc! , %d packages= ! , %d string(s)! , %d style(s)& , sorted& , utf8 = MOVISilicon Graphics movie filevideo/x-sgi-movie = moovApple QuickTimevideo/quicktime= mvhd movie (fast start)= mdra URL= cmov movie (fast start, compressed header)= rmra multiple URLs =mdatApple QuickTime movie (unoptimized)video/quicktime =wideApple QuickTime movie (unoptimized)video/quicktime =idscApple QuickTime image (fast start)image/x-quicktime =pckgApple QuickTime compressed archiveapplication/x-quicktime-player =%ftypISO Media='XAVC, MPEG v4 system, Sony XAVC Codecvideo/mp4x`), Audio "%.4s"xv*at %dHzx+, Video "%.4s"x,%dx-x%d=.3g2, MPEG v4 system, 3GPP2video/3gpp2= 0 v4 (H.263/AMR GSM 6.10)= 1 v5 (H.263/AMR GSM 6.10)= 2 v6 (ITU H.264/AMR GSM 6.10)= 5a C.S0050-0 V1.0= 6b C.S0050-0-A V1.0.0= 7c C.S0050-0-B V1.0=83ge, MPEG v4 system, 3GPPvideo/3gpp= :, Release %d MBMS Extended Presentations= ;, Release %d MBMS Extended Presentations= < , Release %d MBMS Extended Presentations==3gf, MPEG v4 system, 3GPP= > , Release %d File-delivery profile=?3gg, MPEG v4 system, 3GPPvideo/3gpp= A, Release %d General Profile= B , Release %d General Profile=C3gh, MPEG v4 system, 3GPPvideo/3gpp= E , Release %d Adaptive Streaming Profile=F3gm, MPEG v4 system, 3GPPvideo/3gpp= H , Release %d Media Segment Profile=I3gp, MPEG v4 system, 3GPPvideo/3gpp= K, Release %d (non existent)= L, Release %d (non existent)= M, Release %d (non existent)= N, Release %d= O, Release %d= P, Release %d= Q, Release %d Streaming Servers=R3gr, MPEG v4 system, 3GPPvideo/3gpp= T, Release %d Progressive Download Profile= U , Release %d Progressive Download Profile=V3gs, MPEG v4 system, 3GPPvideo/3gpp= X, Release %d Streaming Servers= Y, Release %d Streaming Servers= Z , Release %d Streaming Servers=[3gt, MPEG v4 system, 3GPPvideo/3gpp= ], Release %d Media Stream Recording Profile= ^ , Release %d Media Stream Recording Profile=_ARRI, MPEG v4 system, ARRI Digital Cameravideo/mp4=aavc1, MPEG v4 system, 3GPP JVT AVC [ISO 14496-12:2005]video/mp4=cbbxm, Blinkbox Master File: H.264 video/16-bit LE LPCM audiovideo/mp4=eqt, Apple QuickTime movievideo/quicktime=gCAEP, Canon Digital Camera=hcaqv, Casio Digital Camera=iCDes, Convergent Design=jcaaa, CMAF Media Profile - AAC Adaptive Audio=kcaac, CMAF Media Profile - AAC Core=lcaqv, Casio Digital Camera Casio=mccea, CMAF Supplemental Data - CEA-608/708=nccff, Common container file format=ocfhd, CMAF Media Profile - AVC HD=pcfsd, CMAF Media Profile - AVC SD=qchd1, CMAF Media Profile - HEVC HDR10=rchdf, CMAF Media Profile - AVC HDHF=schhd, CMAF Media Profile - HEVC HHD8=tchh1, CMAF Media Profile - HEVC HHD10=uclg1, CMAF Media Profile - HEVC HLG10=vcmfc, CMAF Track Format=wcmff, CMAF Fragment Format=xcmfl, CMAF Chunk Format=ycmfs, CMAF Segment Format=zcud1, CMAF Media Profile - HEVC UHD10={cud8, CMAF Media Profile - HEVC UHD8=|cwvt, CMAF Media Profile - WebVTT=}da0a, DMB MAF w/ MPEG Layer II aud, MOT slides, DLS, JPG/PNG/MNG=~da0b, DMB MAF, ext DA0A, with 3GPP timed text, DID, TVA, REL, IPMP=da1a, DMB MAF audio with ER-BSAC audio, JPG/PNG/MNG images=da1b, DMB MAF, ext da1a, with 3GPP timed text, DID, TVA, REL, IPMP=da2a, DMB MAF aud w/ HE-AAC v2 aud, MOT slides, DLS, JPG/PNG/MNG=da2b, DMB MAF, ext da2a, with 3GPP timed text, DID, TVA, REL, IPMP=da3a, DMB MAF aud with HE-AAC aud, JPG/PNG/MNG images=da3b, DMB MAF, ext da3a w/ BIFS, 3GPP, DID, TVA, REL, IPMP=dash, MPEG v4 system, Dynamic Adaptive Streaming over HTTPvideo/mp4=dby1, MP4 files with Dolby content=dsms, Media Segment DASH conformant=dts1, MP4 track file with audio codecs dtsc dtsh or dtse=dts2, MP4 track file with audio codec dtsx=dts3, MP4 track file with audio codec dtsy=dxo$20, DxO ONE camera=dmb1, DMB MAF supporting all the components defined in the spec=dmpf, Digital Media Project=drc1, Dirac (wavelet compression), encap in ISO base media (MP4)=dv1a, DMB MAF vid w/ AVC vid, ER-BSAC aud, BIFS, JPG/PNG/MNG, TS=dv1b, DMB MAF, ext dv1a, with 3GPP timed text, DID, TVA, REL, IPMP=dv2a, DMB MAF vid w/ AVC vid, HE-AAC v2 aud, BIFS, JPG/PNG/MNG, TS=dv2b, DMB MAF, ext dv2a, with 3GPP timed text, DID, TVA, REL, IPMP=dv3a, DMB MAF vid w/ AVC vid, HE-AAC aud, BIFS, JPG/PNG/MNG, TS=dv3b, DMB MAF, ext dv3a, with 3GPP timed text, DID, TVA, REL, IPMP=dvr1, DVB (.DVB) over RTPvideo/vnd.dvb.file=dvt1, DVB (.DVB) over MPEG-2 Transport Stream=emsg, Event message box presentvideo/vnd.dvb.file=F4V, Video for Adobe Flash Player 9+ (.F4V)video/mp4=F4P, Protected Video for Adobe Flash Player 9+ (.F4P)video/mp4=F4A, Audio for Adobe Flash Player 9+ (.F4A)audio/mp4=F4B, Audio Book for Adobe Flash Player 9+ (.F4B)audio/mp4=ifrm, Apple iFrame Specification, Version 8.1 Jan 2013=im1i, CMAF Media Profile - IMSC1 Image=im1t, CMAF Media Profile - IMSC1 Text=isc2, ISMACryp 2.0 Encrypted File=iso, MP4 Base Mediavideo/mp4mp4= mv1 [ISO 14496-12:2003]= 2v2 [ISO 14496-12:2005]= 4v4= 5v5 = 6v6 =isml, MP4 Base Media v2 [ISO 14496-12:2005]video/mp4=J2P0, JPEG2000 Profile 0=J2P1, JPEG2000 Profile 1=jp2, JPEG 2000image/jp2=JP2, JPEG 2000 Image (.JP2) [ISO 15444-1 ?]image/jp2=JP20, Unknown, from GPAC samples (prob non-existent)=jpm, JPEG 2000 Compound Image (.JPM) [ISO 15444-6]image/jpm=jpsi, The JPSearch data interchange format=jpx, JPEG 2000 w/ extensions (.JPX) [ISO 15444-2]image/jpx=KDDI, 3GPP2 EZmovie for KDDI 3G cellphonesvideo/3gpp2=LCAG, Leica digital camera=lmsg, Last Media Segment indicator for ISO base media file format.=M4A, Apple iTunes ALAC/AAC-LC (.M4A) Audioaudio/x-m4a=M4B, Apple iTunes ALAC/AAC-LC (.M4B) Audio Bookaudio/mp4=M4P, Apple iTunes ALAC/AAC-LC (.M4P) AES Protected Audiovideo/mp4=M4V, Apple iTunes Video (.M4V) Videovideo/x-m4v=M4VH, Apple TV (.M4V)video/x-m4v=M4VP, Apple iPhone (.M4V)video/x-m4v=mj2s, Motion JPEG 2000 [ISO 15444-3] Simple Profilevideo/mj2=mjp2, Motion JPEG 2000 [ISO 15444-3] General Profile=MFSM, Media File for Samsung video Metadata=MGSV, Sony Home and Mobile Multimedia Platform (HMMP)video/mj2=mmp4, MPEG-4/3GPP Mobile Profile (.MP4 / .3GP) (for NTT)video/mp4=mobi, MPEG-4, MOBI formatvideo/mp4=mp21, MPEG-21 [ISO/IEC 21000-9]=mp41, MP4 v1 [ISO 14496-1:ch13]video/mp4=mp42, MP4 v2 [ISO 14496-14]video/mp4=mp71, MP4 w/ MPEG-7 Metadata [per ISO 14496-12]=mp7t, MPEG v4 system, MPEG v7 XML=mp7b, MPEG v4 system, MPEG v7 binary XML=mpuf, Compliance with the MMT Processing Unit format=msdh, Media Segment conforming to ISO base media file format.=msix, Media Segment conforming to ISO base media file format.=mmp4, MPEG v4 system, 3GPP Mobilevideo/mp4=MPPI, Photo Player, MAF [ISO/IEC 23000-3]=mqt, Sony / Mobile QuickTime (.MQV) US Pat 7,477,830video/quicktime=MSNV, MPEG-4 (.MP4) for SonyPSPaudio/mp4=NDAS, MP4 v2 [ISO 14496-14] Nero Digital AAC Audioaudio/mp4=NDSC, MPEG-4 (.MP4) Nero Cinema Profilevideo/mp4=NDSH, MPEG-4 (.MP4) Nero HDTV Profilevideo/mp4=NDSM, MPEG-4 (.MP4) Nero Mobile Profilevideo/mp4=NDSP, MPEG-4 (.MP4) Nero Portable Profilevideo/mp4=NDSS, MPEG-4 (.MP4) Nero Standard Profilevideo/mp4=NDXC, H.264/MPEG-4 AVC (.MP4) Nero Cinema Profilevideo/mp4=NDXH, H.264/MPEG-4 AVC (.MP4) Nero HDTV Profilevideo/mp4=NDXM, H.264/MPEG-4 AVC (.MP4) Nero Mobile Profilevideo/mp4=NDXP, H.264/MPEG-4 AVC (.MP4) Nero Portable Profilevideo/mp4=NDXS, H.264/MPEG-4 AVC (.MP4) Nero Standard Profile=niko, Nikon Digital Cameravideo/mp4=odcf, OMA DCF DRM Format 2.0 (OMA-TS-DRM-DCF-V2_0-20060303-A)=opf2, OMA PDCF DRM Format 2.1 (OMA-TS-DRM-DCF-V2_1-20070724-C)=opx2, OMA PDCF DRM + XBS ext (OMA-TS-DRM_XBS-V1_0-20070529-C)=pana, Panasonic Digital Camera=piff, Protected Interoperable File Format=pnvi]b, Panasonic Video Intercom=qt, Apple QuickTime (.MOV/QT)video/quicktime= mif1, HEIF Imageimage/heif= msf1, HEIF Image Sequenceimage/heif-sequence=heic, HEIF Image HEVC Main or Main Still Picture Profileimage/heic=heix, HEIF Image HEVC Main 10 Profileimage/heic=hevc, HEIF Image Sequenz HEVC Main or Main Still Picture Profileimage/heic-sequence=hevx, HEIF Image Sequence HEVC Main 10 Profileimage/heic-sequence=heim, HEIF Image L-HEVCimage/heif=heis, HEIF Image L-HEVCimage/heif=avic, HEIF Image AVCimage/heif= hevm, HEIF Image Sequence L-HEVCimage/heif-sequence="hevs, HEIF Image Sequence L-HEVCimage/heif-sequence=$avcs, HEIF Image Sequence AVCimage/heif-sequence=(avif, AVIF Imageimage/avif=*avis, AVIF Image Sequenceimage/avif=,risx, Representation Index Segment for MPEG-2 TS Segments=-ROSS, Ross Video=.sdv, SD Memory Card Video=/ssc1, Samsung stereo, single stream (patent pending)=0ssc2, Samsung stereo, dual stream (patent pending)=1SEAU, Sony Home and Mobile Multimedia Platform (HMMP)=2SEBK, Sony Home and Mobile Multimedia Platform (HMMP)=3senv, Video contents Sony Entertainment Network=4sims, Media Segment for Sub-Indexed Media Segment format=5sisx, Single Index Segment forindex MPEG-2 TS=6ssss, Subsegment Index Segment used to index MPEG-2 Segments=7uvvu, UltraViolet file brand for DECE Common Format =ADIFMPEG ADIF, AACaudio/x-hx-aac-adif&& , VBR^ , CBR=, single stream= , 2 streams=!, 3 streams&", 4 or more streams&#, 8 or more streams&$, Copyrighted& %@, Original Source& & , Home Flag^'&(, VBR^), CBR=*, single stream=+, 2 streams=,, 3 streams&-, 4 or more streams&., 8 or more streams&/@, Original Stream(s)&0 , Home Source =DIFvideo/x-dv&(DVCPRO) movie file^(DV) movie file&(PAL)^(NTSC) =MNGMNG video data,video/x-mng!  CORRUPTED,=  x%d xx%d =JNGJNG video data,video/x-jng!  CORRUPTED,=  x%d xx%d =DNSVfNullsoft Video =IRED1REDCode Video =NAMVSMTV Multimedia File =dFILMSega FILM/CPK Multimedia,x e%d xxf%d =kTHPNintendo THP Multimedia =pBBCDBBC Dirac Video =DKIFDuck IVF video filevideo/x-ivf> , version %dx, codec %sx , %dx x%d> , %d frames = a.out little-endian 32-bit executable> not stripped= j(uses BSD/OS shared libs) = a.out little-endian 32-bit pure executable> not stripped= j(uses BSD/OS shared libs) =  a.out little-endian 32-bit demand paged pure executable> not stripped= j(uses BSD/OS shared libs) =&a.out big-endian 32-bit executable>'not stripped =)a.out big-endian 32-bit pure executable>*not stripped =, a.out big-endian 32-bit demand paged executable>-not stripped =PAR1Apache Parquet =lAPL workspace (Ken's original?) = AppleSingle encoded Macintosh file = AppleDouble encoded Macintosh file =2IMGApple ][ 2IMG Disk Imagex/=XGS!, XGS=CTKG, Catakig=ShIm, Sheppy's ImageMaker=SHEP, Sheppy's ImageMaker=WOOF, Sweet 16=B2TR, Bernie ][ the Rescue=!nfc, ASIMOV2=>BD<, Brutal Deluxe's Cadius=CdrP, CiderPress=Vi][, Virtual ][=PRFS, ProFUSE=FISH, FishWings=RVLW, Revival for Windowsxx, Creator tag "%-4.4s"= , DOS 3.3 sector order=, Volume 254x, Volume %u= , ProDOS sector order=@&DxE, Volume /%sx i, %u Blocks= , NIB data =dApple Mechanic font =caffCoreAudio Format audio file< version %dx =kychMac OS X Keychain File = Mac OS X Code Requirement=(opExpr)x- %d bytes = Mac OS X Code Requirement Set>containing %d itemsx- %d bytes = Mac OS X Code Directoryxversion %x> flags %#xx- %d bytes = Mac OS X Detached Code Signature (non-executable)x- %d bytes = Mac OS X Detached Code Signature>(%d elements)x- %d bytes = NXSBApple File System (APFS)x $, blocksize %u = 2mvery old 32-bit-int little-endian archive =3mvery old 32-bit-int big-endian archive = 9eold 32-bit-int little-endian archive= :__.SYMDEFrandom library =;eold 32-bit-int big-endian archive= <__.SYMDEFrandom library = APDP-11 old archive = BPDP-11 4.0 archive =Ilapl workspace =NSystem V Release 1 ar archiveapplication/x-archive = ARC archive data, dynamic LZWapplication/x-arc =  ARC archive data, squashedapplication/x-arc = ARC archive data, uncompressedapplication/x-arc = ARC archive data, packedapplication/x-arc = ARC archive data, squeezedapplication/x-arc = ARC archive data, crunchedapplication/x-arc =  PAK archive dataapplication/x-arc = ARC+ archive dataapplication/x-arc = HHYP archive dataapplication/x-arc =HPAKHPack archive data =3HFHAP archive data =MDmdMDCD archive data =LIMLIM archive data =BSABSArc archive datax version %d = PKReSOF archive data =XhDrX1 archive data = vCDC Codec archive data =SChFChArc archive data =-H2ODRY archive data =,AR7AR7 archive data =PPMZPPMZ archive data =MP3MP3-Archiver archive data =OZÝZET archive data =gWARQ archive data =Terse archive data =AB2ABComp archive data =]eInstallShield Z archive Data =eDBTS archive data =Ora ELI 5750 archive data =FCQFC archive data =QFQFC archive data =sTaCLZS221 archive data =IMP IMP archive data =sSquish archive data =0BSSBX archive data =ISc(InstallShieldapplication/x-installshield! setup headerhdr= CABcabx , version %#x! !, volume_info %#x! #, offset %#x! &, descriptor size %#x =,BHBlakHole archive data =.BIX0BIX archive data ==PPFT archive data =APPMD archive data =ESMMSXiE archive data =G00zyDeepFreezer archive data =I l%u files,=mfirst is type CPY=nfirst is type ASC=ofirst is type HSC=pfirst is type DIR=qfirst is type SPECIAL =tHPAKHPACK archive data =JRE~^RAR archive data ( 0X- file number %d =EET archiveapplication/x-eet =RZIPrzip compressed datax- version %dx.%dx(%d bytes) ={dar archive,xlabel "%.8xx%.8xx %.4x"=Tend slice=NNmulti-part=SNmulti-part, with -S = Symbian installation fileapplication/vnd.symbian.install= m(EPOC release 3/4/5)= :(EPOC release 6) = z Symbian installation file (Symbian OS 9.x)x-epoc/x-sisx-app =MPQMoPaQ (MPQ) archive = xar!xar archiveapplication/x-xarxar/pkg/xip> , header size %u> version %u,x compressed TOC: %llu,= no checksum= SHA-1 checksum= MD5 checksum= SHA-256 checksum= SHA-512 checksum> unknown %#x checksum= x  x  x x) , contains = x!  x#  x% x)' , contains =) x*  x,  x. x)/ , contains =1 x>2  x4  x6 x)7 , contains =; PAR2Parity Archive Volume Set = @ BB02Bacula volumex A , started %s =N 7kStZPAQ file(=] Norton GHost image=_ , first file=a , split filexc id=%#x=e , no compression=f , fast compression (Z1)=g , medium compression (Z2)>h <i , compression (Z%d-1)=j ! l , password protected!,m = o , sector copy=+q , boot track=,s , disc sector copy>u "%-.254s"=w `Ux)x ; contains =} Cr24Google Chrome extensionapplication/x-chrome-extensionx , version %u = ALZALZ archive dataalz = EGGAEGG archive data,eggx version %ux .%u=  "=  b$, split=  `$, solidx , unknown = pQ9PAQ9A archive =*STAAster*x= WORDWords Document= GRAPGraphic= SPRESpreadsheet= MACRMacro = 2278Aster*x Version 2=6Words Document=5Graphic=2Spreadsheet=8Macro = .sndSun/NeXT audio data:= 8-bit ISDN mu-law,audio/basic= 8-bit linear PCM [REF-PCM],audio/basic= 16-bit linear PCM,audio/basic= 24-bit linear PCM,audio/basic= 32-bit linear PCM,audio/basic= 32-bit IEEE floating point,audio/basic= 64-bit IEEE floating point,audio/basic= Fragmented sample data,=  DSP program,=  8-bit fixed point,=  16-bit fixed point,=  24-bit fixed point,= 32-bit fixed point,= 16-bit linear with emphasis,= !16-bit linear compressed,= "16-bit linear with emphasis and compression,= #Music kit DSP commands,= $8-bit ISDN mu-law compressed (CCITT G.721 ADPCM voice enc.),audio/x-adpcm= &compressed (8-bit CCITT G.722 ADPCM)= 'compressed (3-bit CCITT G.723.3 ADPCM),= (compressed (5-bit CCITT G.723.5 ADPCM),= )8-bit A-law (CCITT G.711),=*mono,=+stereo,=,quad,>-%d Hz = 1.sdDEC audio data:= 28-bit ISDN mu-law,audio/x-dec-basic= 48-bit linear PCM [REF-PCM],audio/x-dec-basic= 616-bit linear PCM,audio/x-dec-basic= 824-bit linear PCM,audio/x-dec-basic= :32-bit linear PCM,audio/x-dec-basic= <32-bit IEEE floating point,audio/x-dec-basic= >64-bit IEEE floating point,audio/x-dec-basic= @Fragmented sample data,= A DSP program,= B 8-bit fixed point,= C 16-bit fixed point,= D 24-bit fixed point,= E32-bit fixed point,= F16-bit linear with emphasis,= G16-bit linear compressed,= H16-bit linear with emphasis and compression,= IMusic kit DSP commands,= J8-bit ISDN mu-law compressed (CCITT G.721 ADPCM voice enc.),audio/x-dec-basic= Lcompressed (8-bit CCITT G.722 ADPCM)= Mcompressed (3-bit CCITT G.723.3 ADPCM),= Ncompressed (5-bit CCITT G.723.5 ADPCM),= O8-bit A-law (CCITT G.711),= Pmono,= Qstereo,= Rquad,> S%d Hz =VMThdStandard MIDI dataaudio/midixX(format %d)x Yusing %d track> Zsx [at 1/%d> \SMPTE =^CTMFCreative Music (CMF) dataaudio/x-unknown =jKRTNMultiTrack sound dataxk- version %d =oEMODExtended MOD sound data,xpversion %dxq.%d,x-r%d instruments=Ss(module)=St(song) =war.RealAudio sound fileaudio/x-pn-realaudio =,SCRMScreamTracker III Module sound data>Title: "%s"audio/x-s3m =UN05MikMod UNI format module sound data =8!PM!4-channel Protracker module sound dataaudio/x-mod>Title: "%s" =8M.K.4-channel Protracker module sound dataaudio/x-mod>Title: "%s" =8M!K!4-channel Protracker module sound dataaudio/x-mod>Title: "%s" =8FLT44-channel Startracker module sound dataaudio/x-mod>Title: "%s" =8FLT88-channel Startracker module sound dataaudio/x-mod>Title: "%s" =84CHN4-channel Fasttracker module sound dataaudio/x-mod>Title: "%s" =86CHN6-channel Fasttracker module sound dataaudio/x-mod>Title: "%s" =88CHN8-channel Fasttracker module sound dataaudio/x-mod>Title: "%s" =8CD818-channel Octalyser module sound dataaudio/x-mod>Title: "%s" =8OKTA8-channel Octalyzer module sound dataaudio/x-mod>Title: "%s" =816CN16-channel Taketracker module sound dataaudio/x-mod>Title: "%s" =832CN32-channel Taketracker module sound dataaudio/x-mod>Title: "%s" =PSIDPlaySID v2.2+ (AMIGA) sidtune>w/ header v%d,=single song,>%d songs,>default song: %d>name: "%s">6author: "%s">Vcopyright: "%s" = RSIDRSID sidtune PlaySID compatible> w/ header v%d,= single song,> %d songs,>default song: %d>name: "%s">6author: "%s">Vcopyright: "%s" =dIRCAM file (VAX little-endian) =dIRCAM file (VAX big-endian) =dIRCAM file (Sun big-endian) =dIRCAM file (Sun little-endian) =dIRCAM file (MIPS little-endian) =dIRCAM file (MIPS big-endian) =dIRCAM file (NeXT big-endian) =dIRCAM file (NeXT big-endian) =dIRCAM file (NeXT little-endian) =&2BITAudio Visual Research file,= 'mono,= (stereo,x)%d bits=*unsigned,=+signed,x,%d Hz,=-no loop,=.loop,</note %d,=0replay 5.485 KHz=1replay 8.084 KHz=2replay 10.971 KHz=3replay 16.168 KHz=4replay 21.942 KHz=5replay 32.336 KHz=6replay 43.885 KHz=7replay 47.261 KHz =SNSFEExtended NES Sound File=0Tauth>U("%s">Vby %s>W, copyright %s>X, ripped by %sxY), %d tracks,=Zdual PAL/NTSC=[=\PAL=]NTSC =iIMPMImpulse Tracker module sound data -audio/x-mod>k"%s"! (lcompatible w/ITv%x! *mcreated w/ITv%x =<pIM10Imago Orpheus module sound data ->q"%s" =wIMPSImpulse Tracker Sample&x16 bit^y8 bit&zstereo^{mono =|IMPIImpulse Tracker Instrument! }ITv%x!~%d samples =LSCRSScream Tracker Sample=sample=adlib melody>adlib drum&stereo^mono&16bit little endian^8bit=unpacked=packed =MMD0MED music file, version 0 =MMD1OctaMED Pro music file, version 1 =MMD3OctaMED Soundstudio music file, version 3 =SymMSymphonie SymMOD music file =DBM0DIGI Booster Pro Module>V%X.x%02X>, "%s" =FTMNFaceTheMusic module>d, "%s" =DDMFXtracker DMF Modulexv%i> Title: "%s">+Composer: "%s" =DSMDynamic Studio Module DSM =SONGDigiTrekker DTM Module =DMDLDigiTrakker MDL Module =PSMProtracker Studio PSM Module =,PTMFPoly Tracker PTM Module>Title: "%s" =MT20MadTracker 2.0 Module MT2 =RTMMRTM Module =MMMDYamaha SMAF file =fLaCFLAC audio bitstream dataaudio/flac>, unknown version==0, 4 bit=P, 6 bit=p, 8 bit=, 12 bit=, 16 bit=p, 24 bit=, mono=, stereo=, 3 channels=, 4 channels=, 5 channels= , 6 channels= , 7 channels=, 8 channels=, 11.025 kHz=, 16 kHz= b, 22.05 kHz=, 24 kHz=, 32 kHz= @ , 44.1 kHz=  , 48 kHz= , 64 kHz= , 88.2 kHz= p, 96 kHz=@, 128 kHz=+, 176.4 kHz=., 192 kHz=>, 256 kHz="V, 352.8 kHz=], 384 kHz>, >4G samples=>, %u samples=, length unknown =VBOXVBOX voice message data =RB40RBS Song file=ReBorncreated by ReBorn= % Propellerheadcreated by ReBirth =-MAC Monkey's Audio compressed formataudio/x-ape> /version %d = 0with fast compression = 1with normal compression = 2 with high compression = 3with extra high compression = 4with insane compression= 5, mono= 6, stereox 7, sample rate %d< 8version %d= 9with fast compression= :with normal compression= ; with high compression= <with extra high compression= =with insane compression= >, mono= ?, stereox @, sample rate %d =NCC2xCheeseCutter 2 song =XSAdTSurprise! Adlib TrackerxYVersion %d =[XAD!eXotic ADlib =_FMK!FM Kingtracker Song = SNDHSNDH Atari ST music =MPCKMusepack audio (MPCK)audio/x-musepack =<SONGSoundFX Module sound file =SCgfSuperCollider3 Synth Definition file,xversion %d =TTA1True Audio Lossless Audio =wvpkWavPack Lossless Audio =IBKIBK instrument data =2OPIBK instrument data, 2 operators =4OPIBK instrument data, 4 operators =ARSTMNintendo Wii BRSTM audio fileaudio/x-brstmbrstm=E=.Fnintendo-wii-brstm-fields= G=.H^nintendo-wii-brstm-fields =]CSTMNintendo 3DS BCSTM audio fileaudio/x-bcstmbcstm= a=.bnintendo-3ds-bcstm-fields=c=.d^nintendo-3ds-bcstm-fields =jFSTMNintendo Wii U BFSTM audio fileaudio/x-bfstmbfstm= o=.pnintendo-3ds-bcstm-fields=q=.r^nintendo-3ds-bcstm-fields =CWAVNintendo 3DS BCWAV audio fileaudio/x-bcwavbcwav= =.nintendo-3ds-bcwav-fields==.^nintendo-3ds-bcwav-fields = DSD DSDIFF audio bitstream dataaudio/x-dffdff=FVER=x, 1 bit=PROP=SND=CHNL=, mono ==SLFTSRGT, stereox, 2 channels == SLFTSRGTLFE , 2.1 stereo= SLFTSRGTC , 3.0 stereox, 3 channels ==MLFTMRGTLS RS , 4.0 surround=SLFTSRGTC LFE , 3.1 stereox, 4 channels ==MLFTMRGTC LS RS , 5.0 surround=MLFTMRGTLFE LS RS , 4.1 surroundx, 5 channels ==MLFTMRGTC LFE LS RS , 5.1 surroundx, 6 channels>, %u channels=FS x, =DxD"DSD %u"x%u Hz=CMPR=DSD , no compression=DST , DST compressionx, unknown compressionx=DIIN>, "edited master" metadata=ID3 =ID3, ID3 version 2x.%ux.%ux, ID3 missing (or unreachable)x, unknown version =DSD DSF audio bitstream dataaudio/x-dsfdsf=fmt  = x, 1 bit= , mono= , stereo= , 3.0 stereo= , 4.0 surround= , 3.1 stereo= , 5.0 surround= , 5.1 surroundxx , %u channelsx, =  Dx D"DSD %u" x %u Hzx= , no compressionx, unknown compressionx, ID3!=ID3version 2x.%ux.%uxunreachablexmissingx , unknown version =bFLTBFLT executablex - version %d= =$ ram=$ gotpic=$ gzip=$gzdata =TBISAMtools TBI (Tabix index format)= , with %d reference sequence> , with %d reference sequences& , using half-closed-half-open coordinates (BED style)^ = , using closed and one based coordinates (GFF style)= , using SAM format= , using VCF formatx , sequence name column: %dx , region start column: %d=  x !, region end column: %dx", comment character: %cx #, skip line count: %d =+BAMSAMtools BAM (Binary Sequence Alignment/Map)> ,= -^[@]HD .*VN:, with SAM header=.[0-9.]+ version %s> /, with %d reference sequences =6BAISAMtools BAI (BAM indexing format)> 7, with %d reference sequences ==CRAMCRAM>>version %d.>?%d>@(identified as %s) =ABF Biosig/Axon Binary formatbiosig/abf2 =ATF Biosig/Axon Text formatbiosig/atf =ADU1Biosig/Axona file formatbiosig/axona =ADU2Biosig/Axona file formatbiosig/axona =!AxGrBiosig/AXG ="axgxBiosig/AXGbiosig/axg =HDEMGBiosig/DEMGbiosig/demg =WIGORBiosig/IgorPro ITX filebiosig/igorpro =gNEX1Biosig/NEXbiosig/nex1 =jPLEXBiosig/Plexon v1.0 =n'Biosig/RHD2000: Intan RHD2000 format =Biosig/Walter Graphtek =Biosig/Walter Graphtek =UUBiosig/Walter Graphtekbiosig/walter-graphtek =68k Blit mpx/mux executable =bmBirtual Machinex , version %dx , program size %ux  , memory size %ux  , memory capacity %u = i960 b.out relocatable object>not stripped = 386 compact demand paged pure executable>  not stripped= j(uses shared libs) = SPARC demand paged&<shared library=dynamically linked executable>dynamically linked executable^executable>not stripped=$(uses shared libs) =SPARC pure&dynamically linked executable^executable>not stripped=$(uses shared libs) =SPARC&dynamically linked executable^executable> not stripped=$!(uses shared libs) =NEKONekoVM bytecodex  (%d global symbols,x  %d global fields,x %d bytecode ops)application/x-nekovm-bytecode =MLRResilient Logic bytecodeapplication/vnd.resilient.logicx, version %dx.%d@= +< namespace=6=^namespace[[:space:]]+[_[:alpha:]]{1,30}[[:space:]]*\{C++ source texttext/x-c++@= +Z protected=[^[[:space:]]*protected:C++ source texttext/x-c++ =eAD64 Image =e AD71 Image = D(D81 Image = dACX64 Image = PSURARC archive (c64) =LBWRAptor packer (c64) =GTS5GoatTracker 2 song>, "%s">$ by %s>D (C) %s>d, %u subsong(s) =rglTFglTF binary modelx s, version %dx t, length %d bytesmodel/gltf-binaryglb =ply PLY model,ply= format ascii ASCII,=[0-9.]+version %s= format binarybinary,=_little_endian little endian,=[0-9.]+version %s= _big_endian big endian,=[0-9.]+version %s =#X3DX3D (Extensible 3D) model, VRML format=V=[0-9.]+, version %smodel/x3d+vrmlx3dv =: JAR compressed with pack200,x;version %d.x<%dapplication/x-java-pack200 =@ JAR compressed with pack200,xAversion %d.xB%dapplication/x-java-pack200 = cisco IOS microcode> for '%s' = cisco IOS experimental microcode> for '%s'@=+ =|TCDDACT compressed data>}(version %i.>~%i.>%i)>, original size: %i bytes>, block size: %i bytes = 4UValve Pak filex , version %ux , %u entries =SLIBSoftlib archivex , version %dx (contains %d files) =bvx-lzfse encoded, no compression =bvx1lzfse compressed, uncompressed tables =bvx2lzfse compressed, compressed tables =bvxnlzfse encoded, lzvn compressed =1NESNES ROM image (iNES)application/x-nes-rom=.3nes-rom-image-ines =6SENNES ROM image (Wii U Virtual Console)application/x-nes-rom=.8nes-rom-image-ines =fTNESNES ROM image (Nintendo 3DS Virtual Console)application/x-nes-rom=hd: FDS,=. inintendo-fds-disk-info-block!jd: TNES mapper %uxk, %ux8k PRGxl, %ux8k CHR=m[WRAM]=n [H-mirror]=o [V-mirror]=p[VRAM] =(!Sega Dreamcast VMU game image =LCDiDream Animator file =&PSARSony PlayStation Archivepsarcx(, version %d.x)%d=*zlib, zlib compression=+lzma, LZMA compression=,, relative paths=-, absolute paths=., ignore case =2XBEHMicrosoft Xbox executableaudio/x-xbox-executablexbe= 6x 7: "%.40s"x 8(%cx 9%c-x :%03u)= `;, all regions ! `< > `=(regions: & `>NA & `?Japan & `@Rest_of_World & `AManufacturer> `B)= D = E= F, not signed> G > H> I, signed =MXIP0XIP, Microsoft Xbox data =NXTF0XTF, Microsoft Xbox data =mXEX2Microsoft Xbox 360 executableaudio/x-xbox360-executablexex=p=.qxbox-360-xex-execution-id=.xrxbox-360-xex-region-code =tXEX1Microsoft Xbox 360 executable (XEX1)audio/x-xbox360-executablexex=w=.xxbox-360-xex-execution-id=.Tyxbox-360-xex-region-code =CON Microsoft Xbox 360 package (console-signed)=.xbox-360-package =LYNXLynx cartridgeapplication/x-atari-lynx-romlnx> , bank 0 %dk> , bank 1 %dk> , "%.32s">*, "%.16s">:, rotation %u =BPS1BPS patch filebps =UPS1UPS patch fileups =-SMVSNES9x input recordingx ., version %d< 0x 1, recorded at %s> 2, rerecorded %d timesx 3, %d frames long>4, data for controller(s):&5#1&6#2&7#3&8#4&9#5^:, begins from snapshot&;, begins from reset^<, NTSC standard&=, PAL standard&>, settings:< @&AWIP1Timing&BLeft+Right&CVolumeEnvX&DFakeMute&E SyncSound> G&HNoCPUShutdown< I> J#! Kx L, metadata: "%s"> M>$N, port 1:=$Ojoypad=$Pmouse=$QSuperScope=$RJustifier=$Smultitap>$T, port 2:=%Ujoypad=%Vmouse=%WSuperScope=%XJustifier=%Ymultitap> ZC! @[x@\, metadata: "%s"&]@, ROM:x ^CRC32 %#08xx _"%s" =cSCVMScummVM savegame> d"%s" =}=3Nintendo GameCube disc image:application/x-gamecube-rom=.nintendo-gcn-disc-common =]Nintendo Wii disc image:=.nintendo-gcn-disc-common =WIANintendo=HGameCubeapplication/x-gamecube-rom=HWiiapplication/x-wii-romxHGameCube/WiixHdisc image (WIA format):=.Xnintendo-gcn-disc-common =RVZNintendo=HGameCubeapplication/x-gamecube-rom=HWiiapplication/x-wii-romxHGameCube/WiixHdisc image (RVZ format):=.Xnintendo-gcn-disc-common =-NCCHNintendo 3DS=.File Archive (CFA)=/Executable Image (CXI)>P0: "%.16s"=1x 2(Old3DS System Update v=.3nintendo-3ds-version-codex 4)=5x 6(New3DS System Update v=.7nintendo-3ds-version-codex 8)!9!:x;(v=.<nintendo-3ds-version-codex=)=>(New3DS only) =CSMDHNintendo 3DS SMDH file! DxE: "%.128s"! FxGby %.128s= H! IxJ: "%.128s"! KxLby %.128s =Q3DSXNintendo 3DS Homebrew Application (3DSX) =NSO0Nintendo Switch executable (NSO) =PFS0Nintendo Switch partition filesystem (PFS0)x , %d files = GConvex old-style object> not stripped =KConvex old-style demand paged executable>not stripped =MConvex old-style pre-paged executable>not stripped =OConvex old-style pre-paged, non-swapped executable>not stripped =WCore file =!mdump format, 4.2 or 4.3 BSD (IDC compatible) ="ndump format, Convex Storage Manager by-reference dump ='Convex SOFF=X(c1&X)c2&X*c2mp&X+parallel&X,intrinsic&X-demand paged&X.pre-paged&X/non-swapped&X0POSIX&T2executable&T3@object=T4 not stripped=T5native fpmode=T6ieee fpmode=T7undefined fpmode =9Convex SOFF core =;Convex SOFF checkpoint=X<c1&X=c2&X>c2mp&X?parallel&X@intrinsic&XAPOSIX=TCnative fpmode=TDieee fpmode=TEundefined fpmode = oncgGCC gcno coverage (-ftest-coverage),xversion %c.x%c ="oncgGCC gcno coverage (-ftest-coverage),x#version %c.x$%c (big-endian) = )adcgGCC gcda coverage (-fprofile-arcs),x*version %c.x+%c =.adcgGCC gcda coverage (-fprofile-arcs),x/version %c.x0%c (big-endian) = 1VwpCracklib password index, little endian>(%i words)=("64-bit")> (%i words) = 1VwpCracklib password index, big endian> (%i words) = Bitcoin= (reverse blockx  , size %ux blockx  , size %u=  x , BIP9 0x%x!  x , version 0x%xx L, %s UTC<X, txcount %u=Xx Y, txcount %u=Xx Y, txcount %u=XxY, txcount %lludat = Common Trace Format (CTF) trace data (LE) = Common Trace Format (CTF) trace data (BE) = WuCommon Trace Format (CTF) packetized metadata (LE)x#, v%dx$.%d =WuCommon Trace Format (CTF) packetized metadata (BE)x#, v%dx$.%d =ACMPMap file for the AssaultCube FPS game =CUBEMap file for cube and cube2 engine games =TCDDACT compressed data>(version %i.>$BS%i.> $BS%i)> $BS, original size: %i bytes> $BS, block size: %i bytes = ͚WGNU dbm 1.x or ndbm database, big endian, 32-bitapplication/x-gdbm =ΚWGNU dbm 1.x or ndbm database, big endian, oldapplication/x-gdbm =ϚWGNU dbm 1.x or ndbm database, big endian, 64-bitapplication/x-gdbm = ͚WGNU dbm 1.x or ndbm database, little endian, 32-bitapplication/x-gdbm = ΚWGNU dbm 1.x or ndbm database, little endian, oldapplication/x-gdbm = ϚWGNU dbm 1.x or ndbm database, little endian, 64-bitapplication/x-gdbm =GDBMGNU dbm 2.x databaseapplication/x-gdbm =#aBerkeley DBapplication/x-dbm=%>&1.86<'1.85>((Hash, version %d, native byte-order)=)>*1.86<+1.85>,(Hash, version %d, little-endian) =.aBerkeley DB=/>01.86<11.85>2(Hash, version %d, big-endian)=3>41.86<51.85>6(Hash, version %d, native byte-order) =8b1Berkeley DB 1.85/1.86>9(Btree, version %d, native byte-order) =:b1Berkeley DB 1.85/1.86>;(Btree, version %d, big-endian) = <b1Berkeley DB 1.85/1.86> =(Btree, version %d, little-endian) = ?aBerkeley DB>@(Hash, version %d, native byte-order) = AaBerkeley DB>B(Hash, version %d, big-endian) = CaBerkeley DB> D(Hash, version %d, little-endian) = Fb1Berkeley DB>G(Btree, version %d, native byte-order) = Hb1Berkeley DB>I(Btree, version %d, big-endian) = Jb1Berkeley DB> K(Btree, version %d, little-endian) = MS"Berkeley DB>N(Queue, version %d, native byte-order) = OS"Berkeley DB>P(Queue, version %d, big-endian) = QS"Berkeley DB> R(Queue, version %d, little-endian) = U Berkeley DB>V(Log, version %d, native byte-order) = W Berkeley DB>X(Log, version %d, big-endian) = Y Berkeley DB> Z(Log, version %d, little-endian) =_@RRDRRDTool DBx`@version %s! b16bit aligned=% c/%C+[big-endianxd32bit long (m68k)= f! g32bit aligned=% h/%C+[big-endian=i64bit long!j32bit long=& k/%C+[little-endian=l64bit long!m32bit long (i386)= nC+[/%middle-endian!o32bit long (arm)=q64bit aligned=%r/%C+[big-endian=s64bit long (s390x)!t32bit long (hppa/mips/ppc/s390/SPARC)=&u/%C+[little-endian=v64bit long (alpha/amd64/ia64)!w32bit long (armel/mipsel) = |SE Linux policyx v%d= MLSx %d symbolsx %d ocons =0FS21Zope Object Database File Storage v3 (data) =1FS30Zope Object Database File Storage v4 (data) =4ZEC3Zope Object Database Client Cache File (data) =7IDA1IDA (Interactive Disassembler) database =DBPFMaxis Database Packed Filex  , version: %u.x  %ux $ , files: %u!  , created: %s!  , modified: %sapplication/x-maxis-dbpfdbpf/package/dat/sc4 =%6srrdiff network-delta data ='6srrdiff network-delta signature datax((block length=%d,x)signature strength=%d) =2X image =Alnew-fs dump file (big endian),= .Bnew-dump-be =Dkold-fs dump file (big endian),= .Eold-dump-be = Lkold-fs dump file (little endian),= .M^old-dump-be =PTnew-fs dump file (ufs2, big endian),= .Qufs2-dump-be = STnew-fs dump file (ufs2, little endian),= .T^ufs2-dump-be =EEBML file=d@Bx, creator %.8s =@CT T602 document data,=0Kamenicky=1CP 852= 2KOI8-CS> 2unknown encoding = 7Psion Series 5=  9font file=  :printer driver=  ;clipboard=  Bmulti-bitmap imageimage/x-epoc-mbm= japplication information file= m= }Sketch imageimage/x-epoc-sketch= ~voice note= Word fileapplication/x-epoc-word= OPL program (TextEd)application/x-epoc-opl= Comms settings= Sheet fileapplication/x-epoc-sheet= EasyFax initialisation file= sOPO moduleapplication/x-epoc-opo= tOPL applicationapplication/x-epoc-app=  exported multi-bitmap image= !m= "Comms names = $APsion Series 5 ROM multi-bitmap image = &PPsion Series 5= 'mdatabase= (Agenda fileapplication/x-epoc-agenda= *Data fileapplication/x-epoc-data= , Jotter fileapplication/x-epoc-jotter= .ini file = 0yPsion Series 5 binary:= 1DLL= 2Icomms hardware library= 3Jcomms protocol library= 4]OPX= 5lapplication= 6DLL= 7logical device driver= 8physical device driver= 9file transfer protocol= :file transfer protocol= ;@printer definition= <Aprinter definition = >zPsion Series 5 executable = 'ESRI Shapefile== = = = x  version %dxlength %d= type Null Shape= type Point= type PolyLine= type Polygon= type MultiPoint=  type PointZ=  type PolyLineZ= type PolygonZ= type MultiPointZ= type PointM= type PolyLineM= type PolygonM= type MultiPointM= type MultiPatch =PC formatted floppy with no filesystem =FATXFATX filesystem data = 6Netboot image,= = mode 2= mode 3! unknown mode =OS/2OS/2 Boot Manager(= |pxelinux loader (version 2.13 or older)(= ff`pxelinux loader(= pxelinux loader (version 3.70 or newer)(= VNTFSbin= .!ntfs-sector2(= V$NTFSbin= .'ntfs-sector2 = \%PTUnix Fast File system [v1] (little-endian),=.Qffsv1 =\%STUnix Fast File system [v1] (big-endian),=TLBALApple UFS VolumexUnamed %s,xVvolume label version %d,x Wcreated on %s,=.X^ffsv1 = \n8 Unix Fast File system [v2ea] (little-endian)=.offsv2 = \qTUnix Fast File system [v2] (little-endian)=.rffsv2 =\t8 Unix Fast File system [v2ea] (little-endian)=.u^ffsv2 =\wTUnix Fast File system [v2] (big-endian)=.x^ffsv2 = \z8 Unix Fast File system [v2ea] (little-endian)=.{ffsv2 = \}TUnix Fast File system [v2] (little-endian)=.~ffsv2 =\8 Unix Fast File system [v2ea] (little-endian)=.^ffsv2 =\TUnix Fast File system [v2] (big-endian)=.^ffsv2 =  F2FS filesystemxl, UUID=%08xxp-%04xxr-%04xxt-%04xxv-%08xxz%04xx|, volume name "%s" =A SGI disk label (volume header) =BSFXSGI XFS filesystem datax(blksz %d,xhinosz %d,^d v1 dirs)&d v2 dirs) ='FAtari-ST Minix kernel image=  , 720k floppy=   , 360k floppy = E=(Linux Compressed ROM File System data, little endianx size %u& version #2& sorted_dirs& hole_supportx CRC %#x,x $edition %u,x (%u blocks,x ,%u files =E=(Linux Compressed ROM File System data, big endianxsize %u&version #2&sorted_dirs&hole_supportx CRC %#x,x$edition %u,x(%u blocks,x,%u files =V'u-boot legacy uImage,x %s,=Invalid os/=OpenBSD/=NetBSD/=FreeBSD/=4.4BSD/=Linux/=SVR4/=Esix/= Solaris/=  Irix/=  SCO/=  Dell/=  NCR/= LynxOS/=VxWorks/=pSOS/=QNX/=Firmware/=RTEMS/=ARTOS/=Unity OS/=INTEGRITY/=Invalid CPU,=Alpha,=ARM,=Intel x86,=IA64,=MIPS,=MIPS 64-bit,=PowerPC,=IBM S390,=  SuperH,=! Sparc,=" Sparc 64-bit,=# M68K,=$ Nios-32,=%MicroBlaze,=&Nios-II,='Blackfin,=(AVR32,=)STMicroelectronics ST200,=*Sandbox architecture,=+ANDES Technology NDS32,=,OpenRISC 1000,=-ARM 64-bit,=.DesignWare ARC,=/x86_64,=0Xtensa,=1RISC-V,=2Invalid Image=3Standalone Program=4OS Kernel Image=5RAMDisk Image=6Multi-File Image=7Firmware Image=8Script File=9Filesystem Image (any type)=:Binary Flat Device Tree BLOB=;(Not compressed),=<(gzip),==(bzip2),=>(lzma),x ?%d bytes,x @%s,xALoad Address: %#08X,xBEntry Point: %#08X,xCHeader CRC: %#08X,xDData CRC: %#08X =msqshSquashfs filesystem, big endian,=.nsquashfs =phsqsSquashfs filesystem, little endian,= .q^squashfs = DISODelta ISO data,x version %d =  bLFS filesystem image=  version 1,x  blocks %u,x  blocks per segment %u,=  version 2,x  fragments %u,x  bytes per segment %u,x  disk blocks %u,x  block size %u,x ! fragment size %u,x " fragments per block %u,x # start for free list %u,x $$ number of free blocks %d,x (% number of files %u,x ,& blocks available for writing %d,x 0' inodes in cache %d,x 4( inode file disk address %#x,x 8) inode file inode number %u,x <* address of last segment written %#x,x @+ address of next segment to write %#x,x D, address of current segment written %#x = SCO UnixWare BFS filesystem =  1SFBBE/OS BFS1 filesystemx $ , byte order %dx ( , block size %dx , , block shift %dx0 , total blocks %lldx8 , used blocks %lld = NeXTNeXT version 1 disklabel=.  next = dlV1NeXT version 2 disklabel=.  next = dlV2NeXT version 3 disklabel=. ! next = E EROFS filesystem> G , compat:& H SB_CHKSUM& I MTIMEx J , blocksize=%ux K , exslots=%ux10S , uuid=%s>@T 0, name=%s> PU , incompat:& PV LZ4_0PADDING& PW BIG_PCLUSTER& PX CHUNKED_FILE& PY DEVICE_TABLE& PZ ZTAILPACKING =% POWER Secure Boot Container,x&version %ux'container size %llu=+7zXZXZ compressed =,POWER boot firmware=-0 H(PHYP entry point) =6FLVMacromedia Flash Videovideo/x-flv =FLIFFLIF<Himage datax , %ux x%u= 1, 8-bit/color,= 2, 16-bit/color,= 1, grayscale, non-interlaced=3, RGB, non-interlaced=4, RGBA, non-interlaced=A, grayscale=C, RGB, interlaced=D, RGBA, interlaced>H, animation data<, %i framesx, %ux x%u=1, 8-bit/color=2, 16-bit/color=x, %i frames,x , %ux x%u=1, 8-bit/color=2, 16-bit/color=Q, grayscale, non-interlaced= S, RGB, non-interlaced=!T, RGBA, non-interlaced="a, grayscale=#c, RGB, interlaced=$d, RGBA, interlaced =fcpX11 Portable Compiled Font data,^ bit: LSB,& bit: MSB,^ byte: LSB first& byte: MSB first =YlibGrx font data,x %dxx %dx(%s =NOFDOS code page font data collectionfont/x-dos-cpicpi =AGEDOS code page font data =DIVDOS code page font data (from Linux?) =PFR1Portable Font Resource font data (new)>f0: %s =PFR0Portable Font Resource font data (old)>version %d =OTTOOpenType font dataapplication/vnd.ms-opentype =wOFFWeb Open Font Formatfont/woff=.woffx, version %dx.%d =wOF2Web Open Font Format (Version 2)font/woff2woff2=.woffx, version %dx.%d =. HPowerPC OpenFirmware FORTH Dictionary,x/Text length: %d bytes,x0Data length: %d bytes,x 1BSS length: %d bytes,x2Symbol Table length: %d bytes,x3Entry Point: %#08X,x4Text Relocation Table length: %d bytes,x5Data Relocation Table length: %d bytes = 7MIPS OpenFirmware FORTH Dictionary,x 8Text length: %d bytes,x 9Data length: %d bytes,x :BSS length: %d bytes,x ;Symbol Table length: %d bytes,x <Entry Point: %#08X,x =Text Relocation Table length: %d bytes,x >Data Relocation Table length: %d bytes =L XcForth 32-bit Dictionary,xMSerial: %#08X,xNDictionary Start: %#08X,x ODictionary Size: %d bytes,xPUser Area Start: %#08X,xQUser Area Size: %d bytes,xREntry Point: %#08X =/ R=Sdynamically linked executable=Texecutable> Unot stripped = WFreeBSD/i386 pure< X&Yshared library=Z@PIC object=[object> \=]dynamically linked executable=^executable> _not stripped = a FreeBSD/i386 demand paged< b&cshared library=d@PIC object=eobject> f=gdynamically linked executable=hexecutable> inot stripped = kFreeBSD/i386 compact demand paged< l&mshared library=n@PIC object=oobject> p=qdynamically linked executable=rexecutable> snot stripped = iHDLld.so hints file (Little Endian> , version %d)<) =iHDLld.so hints file (Big Endian>, version %d)<) =IDP2Quake II 3D Model file,x %u skin(s),x (%u xx %u),x( %u frame(s),x Frame size %u bytes,x%u vertices/frame,x%u texture coordinates,x %u triangles/frame =IBSPQuake=&II Map file (BSP)=.III Map file (BSP) =IDS2Quake II SP2 sprite file =IWADdoom main IWAD datax containing %d lumps =PWADdoom patch PWAD datax containing %d lumps =HM3WWarcraft III map file = 4*Unreal Engine package (little-endian)xxx/tfc/upk/me1/u! 6, version %u! 7/%03u= .8upk_header =:*Unreal Engine package (big-endian)xxx/tfc!<, version %u!=/%03u= .>^upk_header =CIV6Sid Meier's Civilization VI saved game =f Syzygy DTZ tablebaseapplication/syzygy =q#]Syzygy WDL tablebaseapplication/syzygy(= KGTA1 map layout (CMP),=Level 1=Level 2=Level 3 =GBMPGTA2/GBH map layout (GMP),x version %d(= "GTA1 style data (GRX), 8 bit editor graphics(= EGTA1 style data (GRY), 8 bit in-game graphics(= PGTA1 style data (G24), 24 bit in-game graphics =GBSTGTA2/GBH style data (STY), in-game graphics,x version %d(= RenderWare data, v3.1.0.0, used in GTA III on PS2,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.1.0.1, used in GTA III on PC/PS2,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.2.0.0, used in GTA III on PC,= texture archive (TXD)= 3D models (DFF)(=  RenderWare data, v3.3.0.0,= texture archive (TXD)= 3D models (DFF)(=  RenderWare data, v3.3.0.2, used in GTA III PC and GTA VC PS2,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.4.0.0,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.4.0.3, used in GTA VC PC,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.4.0.5, used in GTA III/VC on Android,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.5.0.0, used in GTA III/VC on Xbox,= texture archive (TXD)= 3D models (DFF)(= RenderWare data, v3.6.0.3, used in GTA SA,= texture archive (TXD)= 3D models (DFF) =@bnryGTA Item Placement data (IPL), used in GTA SA/IV,x %d items =TKEYGTA in-game text (GXT), version 2, used in GTA III = TABLGTA in-game text (GXT), version 3, used in GTA VC/LS/VCS =(VER2GTA archive (IMG), version 2, used in GTA SA,x )%d items(= 0TRiGTA Drawable data (WDR), model and weapon data, used in GTA IV(= 18RiGTA Windows Frag Type (WFT), vehicle models, used in GTA IV(= 2SiGTA Ped and LOD models (WDD), used in GTA IV(= 3SiGTA Windows Texture Dictionary (WTD), used in GTA IV =7TABLGTA in-game text (GXT),x 8version %d, used in GTA SA/IV =92GXTGTA in-game text (GXT2), used in GTA V(= =SCR GTA script (SCO), unencrypted, used in GTA IV,x >%d code bytes,x ?%d static variables,x @%d global variables(= AscrGTA script (SCO), encrypted, used in GTA IVx B%d code bytes,x C%d static variables,x D%d global variables(= HR*NGTA archive (IMG),x Iversion %d, used in GTA IV,x J%d items =gMTSMMinetest Schematicmtsxi, version %dxj, size [%dxk, %dx l, %d] =gpchGCC precompiled headerx (version %cx %cx %c)=Cfor C=ofor Objective-C=+for C++=Ofor Objective-C++ = $ gconv module configuration cache data =KEB Knudsen seismic KEL binary (KEB) -= [-A-Z0-9]+Software: %s= V[0-9]+\.[0-9]+version %s =h$HSFXSE multibeam =vHDCSCaris multibeam sonar related data =DSBBSurfer 6 binary grid filex , %dx x%dx&, minx=%gx&, maxx=%gx&, miny=%gx& , maxy=%gx&(, minz=%gx&0, maxz=%g =LASFLIDAR point data records>, version %u>.%u>, SYSID %s>:, Generating Software %s =SEGEOS=(executable=(VMFile=( binary=( directory label<( unknown>( unknown> , name "%s" =/GPATGIMP pattern data,x0%simage/x-gimp-patpat =9GIMPGIMP brush dataimage/x-gimp-gbrgbr =  glibc locale file LC_CTYPE = glibc locale file LC_NUMERIC = glibc locale file LC_TIME = glibc locale file LC_COLLATE = glibc locale file LC_MONETARY = glibc locale file LC_MESSAGES = glibc locale file LC_ALL = glibc locale file LC_PAPER = glibc locale file LC_NAME = glibc locale file LC_ADDRESS = glibc locale file LC_TELEPHONE = glibc locale file LC_MEASUREMENT = glibc locale file LC_IDENTIFICATION =$ GStreamer binary registryx%, version %s =GNU message catalog (little endian),x revisionapplication/x-gettext-translationgmo/mox %u.x %ux , %u message>  s= &! ', at %#x string table> )! *0, at %#x string tablex $2, %u sysdep message> $3s > O x PxR, %s > T x U!V xW'%s'=Y  !Z x['%s' =] x^'%s' =`GNU message catalog (big endian),application/x-gettext-translationgmo/moxmrevision %d.>n%d,xo%d messages,x$p%d sysdep messages=q%d,xr%d messages =wgpgGPG key trust databasexxversion %d = #Khronos SPIR-V binary, big-endianx , version %#08xx , generator %#08x = #Khronos SPIR-V binary, little-endianx , version %#08xx , generator %#08x =0 TML 0123 byte-order format =1 TML 1032 byte-order format =2 TML 2301 byte-order format =3 TML 3210 byte-order format =5PA-RISC1.1 relocatable object =6PA-RISC1.1 executable&7dynamically linked=80Ndynamically linked>`9- not stripped =;PA-RISC1.1 shared executable=<dynamically linked==0Ndynamically linked>`>- not stripped =@ PA-RISC1.1 demand-load executable=Adynamically linked=B0Ndynamically linked>`C- not stripped =EPA-RISC1.1 shared library>`F- not stripped =H PA-RISC1.1 dynamic load library>`I- not stripped =LPA-RISC2.0 relocatable object =NPA-RISC2.0 executable&Odynamically linked=P0Ndynamically linked>`Q- not stripped =SPA-RISC2.0 shared executable&Tdynamically linked=U0Ndynamically linked>`V- not stripped =X PA-RISC2.0 demand-load executable&Ydynamically linked=Z0Ndynamically linked>`[- not stripped =]PA-RISC2.0 shared library>`^- not stripped =` PA-RISC2.0 dynamic load library>`a- not stripped =d PA-RISC1.0 relocatable object =f PA-RISC1.0 executable=gdynamically linked=h0Ndynamically linked>`i- not stripped =k PA-RISC1.0 shared executable=ldynamically linked=m0Ndynamically linked>`n- not stripped =p  PA-RISC1.0 demand-load executable=qdynamically linked=r0Ndynamically linked>`s- not stripped =u PA-RISC1.0 shared library>`v- not stripped =x  PA-RISC1.0 dynamic load library>`y- not stripped =|HP s500 relocatable executable>}- version %d =HP s500 executable>- version %d =HP s500 pure executable>- version %d = HP s200 pure executable>- version %d&save fp regs&@dynamically linked& debuggable>$not stripped = HP s200 executable>- version %d&save fp regs&@dynamically linked& debuggable>$not stripped =  HP s200 demand-load executable>- version %d&save fp regs&@dynamically linked& debuggable>$not stripped = HP s200 relocatable executable>- version %d>- highwater %d&save fp regs& debuggable&PIC = HP s200 (2.x release) pure executable>- version %d>$not stripped = HP s200 (2.x release) executable>- version %d>$not stripped = HP s200 shared library>- version %d>- highwater %d>$not stripped =  HP s200 dynamic load library>- version %d>- highwater %d>$not stripped =eHP old archive =e HP s200 old archive =e HP s200 old archive =eHP s500 old archive =!XHP core file =MHP-WINDOWS font>- version %d =  compiled Lisp =HPHPHP=4848 binary=4949 binary>@- Rev %c= )(ADR)= 3)(REAL)= U)(LREAL)= w)(COMPLX)= )(LCOMPLX)= )(CHAR)= )(ARRAY)=  *(LNKARRAY)= ,*(STRING)= N*(HXS)= t*(LIST)= *(DIR)= *(ALG)= *(UNIT)= *(TAGGED)= +(GROB)= @+(LIB)= b+(BACKUP)= +(LIBDATA)= -(PROG)= -(CODE)= H.(GNAME)= m.(LNAME)= .(XLIB) =AIX compiled message catalog =k AIX backup/restore format file =o AIX backup/restore format file = FORMIFF data=AIFF, AIFF audioaudio/x-aiff=AIFC, AIFF-C compressed audioaudio/x-aiff=8SVX, 8SVX 8-bit sampled sound voiceaudio/x-aiff=16SV, 16SV 16-bit sampled sound voice=SAMP, SAMP sampled audio=MAUD, MAUD MacroSystem audio=SMUS, SMUS simple music=CMUS, CMUS complex music=ILBMBMHD, ILBM interleaved imagex, %d xx%d=RGBN, RGBN 12-bit RGB image= RGB8, RGB8 24-bit RGB image=!DEEP, DEEP TVPaint/XiPaint image="DR2D, DR2D 2-D object=#TDDD, TDDD 3-D rendering=$LWOB, LWOB 3-D object=%LWO2, LWO2 3-D object, v2=&LWLO, LWLO 3-D layered object='REAL, REAL Real3D rendering=(MC4D, MC4D MaxonCinema4D rendering=)ANIM, ANIM animation=*YAFA, YAFA animation=+SSA , SSA super smooth animation=,FANT, Fantavision animation=-ACBM, ACBM continuous image=.FAXX, FAXX fax image=/STFX, ST-Fax image=0IMAGIHDR, CD-i image=2FTXT, FTXT formatted text=3CTLG, CTLG message catalog=4PREF, PREF preferences=5DTYP, DTYP datatype description=6PTCH, PTCH binary patch=7AMFF, AMFF AmigaMetaFile format=8WZRD, WZRD StormWIZARD resource=9DOC , DOC desktop publishing document=:SWRT, SWRT Final Copy/Writer document=;WORD, ProWrite document=<WTXT, WTXT Wordworth document==WOWO, WOWO Wordworth document=>WVQA, Westwood Studios VQA Multimedia,x ?%d video frames,x @%d xx A%d=BMOVE, Wing Commander III Video= C_PC_, PC version= D3DO_, 3DO version=MIFRS, Blorb Interactive Fiction=NExecwith executable chunk=OIFZS, Z-machine or Glulx saved game file (Quetzal)application/x-blorb =.MDAMicroDesign data=0version 2=3version 3 = .MDPMicroDesign page data= 0version 2= 3version 3 =IIN1NIFF image dataimage/x-niff =MM+Big TIFF image data, big-endianimage/tiff =II+Big TIFF image data, little-endianimage/tiff =%@CMU window manager raster image data> &%d x> '%d,> (%d-bit =Q$BArtisan image data=R, rectangular 24-bit=S, rectangular 8-bit with colormap=T, rectangular 32-bit (24-bit with matte) ={FIGDeskMate Drawingimage/x-deskmate-figfig =GKSMGKS Metafile=SunGKS, SunGKS =Sfffstructured fax file(=jYSun raster image data>, %d x>%d,> %d-bit,=old format,=compressed,=RGB,= TIFF,= IFF,= reserved for testing,= no colormap= RGB colormap=raw colormap ="IT01FIT image datax#, %d xx$%d xx %%d ='IT02FIT image datax(, %d xx)%d xx *%d =LDICMDICOM medical imaging dataapplication/dicomdcm/dicom/dic =PDS_PDS image data =pM85Atari ST STAD bitmap image data (hor)=(white background)=(black background) =pM86Atari ST STAD bitmap image data (vert)=(white background)=(black background) =NITFNational Imagery Transmission Format>dated %.14s(= GEM Metafile datax version %d =KiSSKISS/GS=colorx%d bitx %d colorsx %d groups= cellx%d bitx %d xx %dx +%dx !+%d =OfSqueak image data(= ih:DCX multi-pageimage/x-dcxdcxx o, at %#x x) p(= {*_Cineon image data>|, %d x>}%d =MRMMinolta Dimage camera raw image data(= v/1OpenEXR image data,image/x-exrx version %d,^ storage: scanline& storage: tiled= compression, compression: =none =rle =zips =zip =piz =pxr24 =b44 =b44a =dwaa = dwab > unknown= dataWindow, dataWindow: x (%d x %d)-x (%d x %d)=displayWindow, displayWindow: x (%d x %d)-x (%d x %d)= lineOrder, lineOrder: =increasing y =decreasing y =random y >unknown =SDPXDPX image data, big-endian,image/x-dpx=.dpx_info =XPDSDPX image data, little-endian,image/x-dpx= .^dpx_info(= Common Data Format (Version 3 or later) dataapplication/x-cdf(= `Common Data Format (Version 2.6 or 2.7) dataapplication/x-cdf(= Common Data Format (Version 2.5 or earlier) dataapplication/x-cdf(= Hierarchical Data Format (version 4) dataapplication/x-hdfhdf/hdf4/h4 =: CPCCartesian Perceptual Compression imageimage/x-cpicpi/cpc =F C565OLPC firmware icon image datax G %u xx H %u =L Cytovision Metaphases file =M Cytovision Karyotype file =N Cytovision FISH Probe file =O ھCytovision FLEX file =P Cytovision FLEX file =Q Cytovision RATS file =_ @PCO-PCO B16 image datax ` , %dxx a %d= b , short header= c , extended header= d , grayscale= $e linear LUT= $f logarithmic LUTx g [%dx h ,%d]= i , color= @j linear LUT= @k logarithmic LUTx (l r[%dx ,m ,%d]x 0n g[%dx 4o ,%d]x 8p b[%dx <q ,%d] = XcurX11 cursor = MMOROlympus ORF raw image data, big-endianimage/x-olympus-orf = IIROOlympus ORF raw image data, little-endianimage/x-olympus-orf = IIRSOlympus ORF raw image data, little-endianimage/x-olympus-orf = FOVbFoveon X3F raw image dataimage/x-x3fx  , version %d.x  %dx  , %dxx  %d = PDN3Paint.NET image dataimage/x-paintnet =$ FMRISO/IEC 19794-2 Format Minutiae Record (FMR) =^ BPGBPG (Better Portable Graphics)image/bpg =c icnsMac OS X iconimage/x-icns????icnsicns>g xi , %d bytesxk , "%4.4s" type(= `MDEC video stream,x  %dxx  %d =2 GVRTSega GVR image:=.3 sega-gvr-image-header =^ ARRIARRI ARI image data,= _ 4Vxlittle-endian,= ` xV4big-endian,x a version %d,x b %dxx c %d = VTFValve Texture Formatx  v%ux  .%ux  , %u>  x %u= > ? x %u>  , %u framesx8 , mipmaps: %u> 4 ,=.4 vtf-image-format = VTF3Valve Texture Format (PS3)x , %ux x %u= , DXT1= , DXT5(= \ASTCx %ux x%u> x%ux texture, %ux x %u> x %u =DanMicrosoft Paint image data (version 1.x)x (%dx x %d) = LinSMicrosoft Paint image data (version 2.0)x !(%dx "x %d) =tPVRPowerVR 3.0 texture:x u%u xx v%u> wx %uxx,= y=.zpvr3-pixel-format! {!|%c! }%u! ~%c! %u! %c!%u! %c!%u= , sRGB= , premultiplied alpha =RVPPowerVR 3.0 texture: BE,x%u xx%u> x %ux,= =.pvr3-pixel-format! ! %c!%u! %c!%u! %c! %u!%c! %u=, sRGB=, premultiplied alpha =XPR0Microsoft Xbox XPR0 texturex, format:=.xbox-xpr-pixel-format =ILDAILDA Image Data Transfer Format=3D Coordinates with Indexed Color=2D Coordinates with Indexed Color=Color Palette=3D Coordinates with True Color=2D Coordinates with True Color>0, palette %s>0, company %s>, number of records %dx, palette number %d>, number of frames %d>, projector number %d(=ZLepton image filex(version %d) =qktkApple QuickTake 100 Raw Image= .quicktake(=deLWCorel Draw Pictureapplication/vnd.corel-drawcdr=le, version 1.0=qm, version 2.0(=zJxHCrunch compressed texture:x {%u xx|%u=}, DXT1=~, DXT3=, DXT5=, DXT5 CCxY=, DXT5 xGxR=, DXT5 xGBR=, DXT5 AGBR=, DXn XY=, DXn YX= , DXT5 Alpha= , ETC1>, %u images>, %u faces =qoifQOI image dataimage/x-qoiqoix%uxx%u,= s= RGB= RGBAx x *bad channels %u*= (linear alpha)= = RGB= RGBA= (all channels linear)x x *bad colorspace %u* =GDSTGodot 3 texture:image/x-godot-stexstexx "%u xx #%u= $,! %=.&godot-rescale-display-w=. 'godot-rescale-display-hx (,! )has mipmaps,= *lossless encoding= + lossy encoding= ,0=.-godot-pixel-format =6GST2Godot 4 textureimage/x-godot-stexstexx 9v%u:x (:%u xx *;%u=.<godot-rescale-display-w=. =godot-rescale-display-hx >,> ,?%u mipmaps,=.0@godot-pixel-format= $A, embedded PNG image= $B, embedded WebP image= $C, Basis Universal =oRIX3ColoRIX Image= .prix-header =rRIX7ColoRIX Slideshow = ZIntel serial flash for ICH/PCH ROM <= 5 or 3400 series A-step = ZIntel serial flash for PCH ROM =OPSInterleaf saved data =:ISPLispellx;hash file version %d,x<lexletters %d,x =lexsize %d,x>hashsize %d,x?stblsize %d =IsZ!ISO Zipped filex, header size %ux, version %ux  , serial %u> , password protected = Java KeyStoreapplication/x-java-keystore =Java JCE KeyStoreapplication/x-java-jce-keystore = MJJava jmod module version 1.0application/x-java-jmod =%Java module image (big endian)>&, version %dx'.%dapplication/x-java-image = *Java module image (little endian)> +, version %dx ,.%dapplication/x-java-image@=+module(\.|\[["'])exports.*=JavaScript sourceapplication/javascriptjs = JPEG-LS image dataimage/jlsjls=.jpeg =nhsi1JPEG image data, HSI proprietaryimage/x-hsihsi/jpg =QOJPEG 2000 codestreamimage/x-jp2-codestreamjpc/j2c/j2k = ٢Keepass password database=  eK1.x KDB> 0 , %d groups> 4, %d entries= , SHA-256= , AES= , RC4= , Twofish> x, %d key transformation rounds= gK2.x KDBX =,Kerberos Keytab file= .-keytab_entry =lectDEC SRC Virtual Paper Lectern file = dLinux/i386 impure executable (OMAGIC)= , stripped = dLinux/i386 pure executable (NMAGIC)= , stripped =  dLinux/i386 demand-paged executable (ZMAGIC)= , stripped = dLinux/i386 demand-paged executable (QMAGIC)= , stripped =Linux-8086 impure executable!not stripped = Linux-8086 executable!not stripped =!Linux-8086 object file =#Minix-386 impure executable!$not stripped =% Minix-386 executable!&not stripped ='Minix-386 NSYM/GNU executable!(not stripped =1LILOLinux/i386 LILO boot/chain loader =Linux kernel=Loadingversion 1.3.79 or older=Loadingfrom prehistoric times =MOOOUser-mode Linux COW file<, version %d>, backing file %s>, version %d> , backing file %s =Linux=SKLEELKS Kernel!SKLEstyle boot sector = $(oLinux kernel ARM boot executable zImage!0(little-endian)img/bin=0(big-endian) =$(oLinux kernel ARM boot executable zImage (big-endian) = 8ARMdLinux kernel ARM64 boot executable Image^ , little-endian& , big-endian& , 4K pages& , 16K pages& , 32K pages = Linux-Dev86 executable, headerless=.> , libc version %s = Linux-8086 executable! , unmapped zero page=  , impure! !, A_EXEC!, A_PAL!, A_NSYM!, A_STAND!@, A_PURE!, A_TOVLY!, not stripped=%.>$, libc version %s = !=SYSLINUX' LSS16 image dataimage/x-lss16x $, width %dx %, height %d ='OOOMUser-Mode-Linux's Copy-On-Write disk imagex(version %d = ,|SE Linux policyx -v%d= .MLSx /%d symbolsx 0%d ocons =bSnApLVM Snapshot (CopyOnWrite store)! c- valid,= d- invalid,x eversion %d,x fchunk_size %d = i|SE Linux policyx jv%d= kMLSx l%d symbolsx m%d ocons =  locale archivex %d strings = N+Linux Software RAIDx version 1.2 (%d)= .linuxraid = N+Linux Software RAIDx version 1.1 (%d)= .linuxraid = *$1Eiproute2 routes dump = +"6Giproute2 addresses dump = 0CVTCRIU image file v1.1 = 1@YUCRIU service file = 211XCRIU inventory =FҋvpCLISP memory image data =GpvCLISP memory image data, other endian =JMIT scheme (library?) =llvmLLVM byte-codes, uncompressed = CPCHLLVM Pre-compiled header file =  LLVM bitcode, wrapper= x86_64= i386= ppc= ppc64=  arm =BCLLVM IR bitcode =LuaLua bytecode,=#version 2.4=%version 2.5/3.0=1version 3.1=2version 3.2=@version 4.0=Pversion 5.0=Qversion 5.1=Rversion 5.2=Sversion 5.3=Tversion 5.4 =/SIT!StuffIt Archive (data)application/x-stuffitSIT!SIT!x2: %s =3SITDStuffIt Deluxe (data)x4: %s =SPSS Portable Filex(%s =$FL2SPSS System Filex%s =$FL3SPSS System Filex%s = >magic binary file for file(1) cmdapplication/x-filemgcx B(version %d) (little endian) =Cmagic binary file for file(1) cmdapplication/x-filemgcxG(version %d) (big endian) = 8x>"Transport Neutral Encapsulation Format (TNEF)application/vnd.ms-tneftnef/dat!@, 1st level %#2.2x!B, 1st id %#8.8x=C! E, TnefVersion length %x! G, version %#8.8x! I, checksum %#4.4x!K, level %#2.2x=M, OEM codepage= Ox Q%u! "Sand %ux &U(checksum %#x)!(W, level %u=)Y, MessageAttributex -^"%s" =iJAMJAM message area header file> j(%d messages) = .FITFIT Map data= x# , unit id %dx ' , serial %ux+L%, %sx /, manufacturer %d= / (garmin)x 1, product %dx5, type %d=5 (Device)=5 (Settings)=5 (Sports/Cycling)=5 (Activity)=5 (Elevations)=5 (Totals) =BKpGrGarmin update! Ddx Ed, version %ux Fd.%u= .Hgarmin-entry x  J= .Kgarmin-entry x  Mx N= .Ogarmin-entryx Q= :UGARMIN BITMAP= image/x-garmin-exeexex)Xx:Z= application/x-garmin-rgnrgn=:^KpGrdx)_=:aPKx)b =[$Maple something=`EAn old revision=aRThe latest save = HG10Mercurial changeset bundle= UN(uncompressed)= GZ(gzip compressed)= BZ(bzip2 compressed) =zMirage Assembler m.out executable =qMDMPMini DuMP crash reportapplication/x-dmpdmp/mdmp! w, version %#4.4xx y, %d streams! { , %#8.8x RVA! }, CheckSum %#8.8xx , %sx , %#x type = ͫMLSSA datafile,x algorithm %d,x %d samples =MMDF mailbox =BRMD1raw modem data>C(%s />Dcompression type %#04x) =*`Atari ST M68K contiguous executablex+(txt=%d,x,dat=%d,x -bss=%d,x.sym=%d) =/`Atari ST M68K non-contig executablex0(txt=%d,x1dat=%d,x 2bss=%d,x3sym=%d) =!PKMozilla archive omni.jaapplication/x-zipja =@ۥ-Microsoft WinWord 2.0 Documentapplication/msword = @ۥ-Microsoft WinWord 2.0 Documentapplication/msword =-s=x>zLotusapplication/vnd.lotus-1-2-3????L123= 1-2-3 CoNFiguration, version 2.x (PGRAPH.CNF)cnf=  1-2-3 CoNFiguration, version 2.4Jcnf= 1-2-3 CoNFiguration, version 1-2.1cnf= Symphony CoNFigurationcnf= 1-2-3 CoNFiguration, version 2.2cnf=  1-2-3 CoNFiguration, version 2.3-2.4cnf= 1-2-3 CoNFiguration, version 3.xcnf= P1-2-3 CoNFiguration, version 4.xcnf= 1-2-3 WorKSheet, version 1wks= Symphony WoRksheet, version 1.0wrk/wr1= 1-2-3/Symphony worksheet, version 2wk1/wr1= 1-2-3 WorKsheet, version 1.xJwj1= 1-2-3 worksheet, version 2.4Jwj3= 1-2-3 ForMaTting data, version 2.xfmt/fj3= 1-2-3 FoRMatting data, version 2.0frmxunknown worksheet or configurationcnfx , revision %#x= .lotus-cells= .  lotus-cells =@ Windows metafile=.wmf-head =DCU1Borland Delphi .DCU file = pkTurboC BGI file = PKTurboC Font file =PMCCWindows 3.x .GRP file(= *4DH4DOS help filex+, version %-4.4s =U@ISc(InstallShield Cabinet archive data=V`version 6,!W`version 4/5,x  (X%u files =MSVC .bsc =@KSCCKSS music file v1.03==, soundchips: AY-3-8910, SCC(+)=, soundchip(s): SN76489=stereo=, YM2413=, Y8950 =@KSSXKSS music file v1.20= =!@, 60Hz="@@, 50Hz=#, soundchips: AY-3-8910, SCC(+)=$, soundchips: SN76489=%stereo=&,='YM2413=(YM2413, Y8950=)YM2413+Y8950 pseudostereo=*, Majyutsushi DAC = RSRCNational Instruments,=LVLabVIEW File,= SBCode Resource File, data= INVirtual Instrument Program, data= ARVI Library, data=LMNULBVWPortable File Names, data=rscResources File, data =VMAPNational Instruments, VXI File, data =9 a.out NetBSD/i386 demand paged= .:netbsd-4096 =<a.out NetBSD/i386 pure= .=netbsd-pure =?a.out NetBSD/i386= .@netbsd-normal =BGa.out NetBSD/i386 core= .Cnetbsd-core =E a.out NetBSD/m68k demand paged= .F^netbsd-8192 =Ha.out NetBSD/m68k pure= .I^netbsd-pure =Ka.out NetBSD/m68k=.L^netbsd-normal =NGa.out NetBSD/m68k core= .O^netbsd-core =Q a.out NetBSD/m68k4k demand paged= .R^netbsd-4096 =Ta.out NetBSD/m68k4k pure= .U^netbsd-pure =Wa.out NetBSD/m68k4k=.X^netbsd-normal =ZGa.out NetBSD/m68k4k core= .[^netbsd-core =] a.out NetBSD/ns32532 demand paged= .^netbsd-4096 =`a.out NetBSD/ns32532 pure= .anetbsd-pure =ca.out NetBSD/ns32532= .dnetbsd-normal =fGa.out NetBSD/ns32532 core= .gnetbsd-core =iGa.out NetBSD/powerpc core= .jnetbsd-core =l a.out NetBSD/SPARC demand paged= .m^netbsd-8192 =oa.out NetBSD/SPARC pure= .p^netbsd-pure =ra.out NetBSD/SPARC=.s^netbsd-normal =uGa.out NetBSD/SPARC core= .v^netbsd-core =x a.out NetBSD/pmax demand paged= .ynetbsd-4096 ={a.out NetBSD/pmax pure= .|^netbsd-pure =~a.out NetBSD/pmax= .netbsd-normal =Ga.out NetBSD/pmax core= .netbsd-core = a.out NetBSD/vax 1k demand paged= .netbsd-4096 =a.out NetBSD/vax 1k pure= .netbsd-pure =a.out NetBSD/vax 1k= .netbsd-normal =Ga.out NetBSD/vax 1k core= .netbsd-core = a.out NetBSD/vax 4k demand paged= .netbsd-4096 =a.out NetBSD/vax 4k pure= .netbsd-pure =a.out NetBSD/vax 4k= .netbsd-normal =Ga.out NetBSD/vax 4k core= .netbsd-core = ECOFF NetBSD/alpha binary= not stripped= stripped =Ga.out NetBSD/alpha core> from '%s'! (signal %d) = a.out NetBSD/mips demand paged= .^netbsd-8192>not stripped =a.out NetBSD/mips pure= .netbsd-pure =a.out NetBSD/mips= .netbsd-normal =Ga.out NetBSD/mips core= .netbsd-core = a.out NetBSD/arm32 demand paged= .netbsd-4096 =a.out NetBSD/arm32 pure= .netbsd-pure =a.out NetBSD/arm32= .netbsd-normal =Ga.out NetBSD/arm core= .netbsd-core =ʏNetBSD kernel core file=, Unknown=, sun 68010/68020=, sun 68020=d, 386 PC=, i386 BSD=, m68k BSD (8K pages)=, m68k BSD (4K pages)=, ns32532 BSD=, SPARC/32 BSD=, pmax BSD=, vax BSD (1K pages)=, alpha BSD=, mips BSD (Big Endian)=, arm6 BSD=, m68k BSD (2K pages)=, sh3 BSD=, ppc BSD (Big Endian)=, vax BSD (4K pages)=, mips1 BSD=, mips2 BSD=, m88k BSD=, parisc BSD=, sh5/64 BSD=, SPARC/64 BSD=, amd64 BSD=, sh5/32 BSD=, ia64 BSD=, aarch64 BSD=, or1k BSD=, Risk-V BSD=, hp200 BSD=,, hp300 BSD= , hp800 HP-UX= , hp200/hp300 HP-UX=, CPU=, DATA=, STACKx , (headersize = %dx , segmentsize = %dx , segments = %d) = BINetscape Communicator address book =D)zNeWS bitmap font = G)zNeWS font family = P)zscalable OpenFont binary = Q)zencrypted scalable OpenFont binary = E+zX11/NeWS bitmap font = H+zX11/NeWS font family =X n+1NIfTI-1 neuroimaging data,image/x.niftinii=. nifti1 =Xni1NIfTI-1 neuroimaging data header,image/x.niftihdr=.nifti1 =NPFFNItpicker Flow FilexV%d.x%dx  started: %sx stopped: %sx Bytes: %ux Bytes1: %ux Flows: %uxPkts: %u =OLFOLF=invalid class=32-bit=64-bit=invalid os=OpenBSD=NetBSD=FreeBSD=4.4BSD=Linux=SVR4=esix=Solaris= Irix= SCO= Dell= NCR=invalid byte order= LSB= !no file type,= "relocatable,= #executable,= $shared object,= 'core file>8(of '%s'> 8)(signal %d),& *processor-specific,= +no machine,= ,AT&T WE32100 - invalid byte order,= -SPARC - invalid byte order,= .Intel 80386,= /Motorola 68000 - invalid byte order,= 0Motorola 88000 - invalid byte order,= 1Intel 80486,= 2Intel 80860,= 3MIPS R3000_BE - invalid byte order,= 4 Amdahl - invalid byte order,= 5 MIPS R3000_LE,= 6 RS6000 - invalid byte order,= 7PA-RISC - invalid byte order,= 8nCUBE,= 9VPP500,= :SPARC32PLUS,= ;PowerPC,= <&Alpha,= =invalid version= >version 1= $?MathCoPro/FPU/MAU Required>@(%s)=AMSB=Bno file type,=Crelocatable,=Dexecutable,=Eshared object,=Fcore file,>8Gof '%s'>8H(signal %d),&Iprocessor-specific,=Jno machine,=KAT&T WE32100,=LSPARC,=MIntel 80386 - invalid byte order,=NMotorola 68000,=OMotorola 88000,=PIntel 80486 - invalid byte order,=QIntel 80860,=RMIPS R3000_BE,=S Amdahl,=T MIPS R3000_LE - invalid byte order,=U RS6000,=VPA-RISC,=WnCUBE,=XVPP500,=YSPARC32PLUS,=ZPowerPC or cisco 4500,=[cisco 7500,=\cisco SVIP,=]cisco 7200,=^$cisco 12000,=_&Alpha,=`invalid version=aversion 1=$bMathCoPro/FPU/MAU Required =~OpenFst binary FST datax , fst type: %sx , arc type: %sx , version: %dx , num states: %lld> , num arcs: %lld = \QVOpenFst binary FAR data, far type: stlistx, version: %d =\~OpenFst binary FAR data, far type: sttablex, version: %d = $Oric tape,= BASIC,= memory block,> autorun,x "%.15s"(=wWarpIN Installerapplication/x-os2-wpiwpix, created by %sxF, '%s'x, URL %s =OSF/Rose object =<zTXTA GutenPalm zTXT e-book>"%s"=NxN(v0.%02d)=NxN(v1.%02d)>N <N - 1 bookmark>N - %d bookmarks>N<N- 1 annotation>N- %d annotations>N(v%d.xN%02d) =<ptchPalm OS operating system patch data>"%s" = mPDP-11 single precision APL workspace = lPDP-11 double precision APL workspace =@pst0perl Storable (v0.7) data>A&B(network-ordered)=C(major 2)=D(major 2)>E(minor %d) ={ PGP RSA encrypted session key -x|keyid: %08Xx}%08X= ~RSA (Encrypt or Sign) 2048b= RSA Encrypt-Only 2048b= = = = = = = = =. =PGP RSA encrypted session key -xkeyid: %08Xx%08X= RSA (Encrypt or Sign) 3072b= RSA Encrypt-Only 3072b= = = = = = = = =. = PGP RSA encrypted session key -xkeyid: %08Xx%08X= RSA (Encrypt or Sign) 4096b= RSA Encrypt-Only 4096b= = = = = = = = =. = PGP RSA encrypted session key -xkeyid: %08Xx%08X= RSA (Encrypt or Sign) 8192b= RSA Encrypt-Only 8192b= = = = = = = = =. =PGP Elgamal encrypted session key -xkeyid: %08Xx%08X= Elgamal Encrypt-Only 1024b.= = = = = = = =  =PGP Elgamal encrypted session key -xkeyid: %08Xx%08X= Elgamal Encrypt-Only 2048b.= = = = = = = =  =PGP Elgamal encrypted session key -xkeyid: %08Xx%08X= Elgamal Encrypt-Only 3072b.= = = = = = = = =Plan 9 executable, Motorola 68k =Plan 9 executable, AT&T Hobbit = Plan 9 executable, Intel 386 = GPlan 9 executable, Intel 960 = Plan 9 executable, SPARC = Plan 9 executable, MIPS R3000 = Plan 9 executable, AT&T DSP 3210 =Plan 9 executable, MIPS R4000 BE =Plan 9 executable, AMD 29000 =GPlan 9 executable, ARM 7-something =Plan 9 executable, PowerPC =Plan 9 executable, MIPS R4000 LE =KPlan 9 executable, DEC Alpha =<:Plan 9 object file, MIPS R3000 =< CPlan 9 object file, AT&T Hobbit =2MPlan 9 object file, Motorola 68k =<tPlan 9 object file, SPARC =E~Plan 9 object file, Intel 386 =RastRST-format raster font data>-0face %s = Pulsar POP3 daemon mailbox cache file.x Version: %d.x %d =PWS3Password Safe V3 database =PPyramid 90x family executable = PPyramid 90x family pure executable> not stripped = PPyramid 90x family demand paged pure executable> not stripped = python 1.0 byte-compiledapplication/x-bytecode.python = python 1.1/1.2 byte-compiledapplication/x-bytecode.python = .python 1.3 byte-compiledapplication/x-bytecode.python = python 1.4 byte-compiledapplication/x-bytecode.python = Npython 1.5 byte-compiledapplication/x-bytecode.python = python 1.6 byte-compiledapplication/x-bytecode.python = python 1.6 byte-compiledapplication/x-bytecode.python = Ƈpython 2.0 byte-compiledapplication/x-bytecode.python = ƈpython 2.0 byte-compiledapplication/x-bytecode.python = *python 2.1 byte-compiledapplication/x-bytecode.python =! +python 2.1 byte-compiledapplication/x-bytecode.python =# -python 2.2 byte-compiledapplication/x-bytecode.python =% .python 2.2 byte-compiledapplication/x-bytecode.python =' ;python 2.3 byte-compiledapplication/x-bytecode.python =) <python 2.3 byte-compiledapplication/x-bytecode.python =+ Epython 2.3 byte-compiledapplication/x-bytecode.python =- Ypython 2.4 byte-compiledapplication/x-bytecode.python =/ cpython 2.4 byte-compiledapplication/x-bytecode.python =1 mpython 2.4 byte-compiledapplication/x-bytecode.python =3 npython 2.4 byte-compiledapplication/x-bytecode.python =5 wpython 2.5 byte-compiledapplication/x-bytecode.python =7 python 2.5 byte-compiledapplication/x-bytecode.python =9 python 2.5 byte-compiledapplication/x-bytecode.python =; python 2.5 byte-compiledapplication/x-bytecode.python == python 2.5 byte-compiledapplication/x-bytecode.python =? python 2.5 byte-compiledapplication/x-bytecode.python =A python 2.5 byte-compiledapplication/x-bytecode.python =C python 2.5 byte-compiledapplication/x-bytecode.python =E python 2.5 byte-compiledapplication/x-bytecode.python =G python 2.6 byte-compiledapplication/x-bytecode.python =I python 2.6 byte-compiledapplication/x-bytecode.python =K python 2.6 byte-compiledapplication/x-bytecode.python =M python 2.7 byte-compiledapplication/x-bytecode.python =O python 2.7 byte-compiledapplication/x-bytecode.python =Q python 2.7 byte-compiledapplication/x-bytecode.python =S python 2.7 byte-compiledapplication/x-bytecode.python =U python 2.7 byte-compiledapplication/x-bytecode.python =W python 2.7 byte-compiledapplication/x-bytecode.python =Y PyPy2.7 byte-compiledapplication/x-bytecode.python =[ python 3.0 byte-compiledapplication/x-bytecode.python =] python 3.0 byte-compiledapplication/x-bytecode.python =_ python 3.0 byte-compiledapplication/x-bytecode.python =a python 3.0 byte-compiledapplication/x-bytecode.python =c python 3.0 byte-compiledapplication/x-bytecode.python =e python 3.0 byte-compiledapplication/x-bytecode.python =g python 3.0 byte-compiledapplication/x-bytecode.python =i python 3.0 byte-compiledapplication/x-bytecode.python =k python 3.0 byte-compiledapplication/x-bytecode.python =m python 3.0 byte-compiledapplication/x-bytecode.python =o python 3.0 byte-compiledapplication/x-bytecode.python =q python 3.0 byte-compiledapplication/x-bytecode.python =s python 3.0 byte-compiledapplication/x-bytecode.python =u 'python 3.0 byte-compiledapplication/x-bytecode.python =w ;python 3.0 byte-compiledapplication/x-bytecode.python =y Epython 3.1 byte-compiledapplication/x-bytecode.python ={ Opython 3.1 byte-compiledapplication/x-bytecode.python =} Xpython 3.2 byte-compiledapplication/x-bytecode.python = bpython 3.2 byte-compiledapplication/x-bytecode.python = lpython 3.2 byte-compiledapplication/x-bytecode.python = vpython 3.3 byte-compiledapplication/x-bytecode.python = python 3.3 byte-compiledapplication/x-bytecode.python = python 3.3 byte-compiledapplication/x-bytecode.python = python 3.3 byte-compiledapplication/x-bytecode.python = python 3.3 byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.4 byte-compiledapplication/x-bytecode.python = python 3.5.1- byte-compiledapplication/x-bytecode.python = python 3.5.1- byte-compiledapplication/x-bytecode.python = python 3.5.1- byte-compiledapplication/x-bytecode.python = python 3.5.1- byte-compiledapplication/x-bytecode.python = python 3.5.2+ byte-compiledapplication/x-bytecode.python = python 3.6 byte-compiledapplication/x-bytecode.python = !python 3.6 byte-compiledapplication/x-bytecode.python = *python 3.6 byte-compiledapplication/x-bytecode.python = +python 3.6 byte-compiledapplication/x-bytecode.python = ,python 3.6 byte-compiledapplication/x-bytecode.python = -python 3.6 byte-compiledapplication/x-bytecode.python = /python 3.6 byte-compiledapplication/x-bytecode.python = 0python 3.6 byte-compiledapplication/x-bytecode.python = 1python 3.6 byte-compiledapplication/x-bytecode.python = 2python 3.6 byte-compiledapplication/x-bytecode.python = 3python 3.6 byte-compiledapplication/x-bytecode.python = >python 3.7 byte-compiledapplication/x-bytecode.python = ?python 3.7 byte-compiledapplication/x-bytecode.python = ?Conary changeset data =*tOcGit pack index=+, version 2 =/DIRCGit index>0, version %d>1, %d entries =5HG10Mercurial bundle,=6UNuncompressed=7BZbzip2 compressed =RIFFRIFF (little-endian) data=PAL , paletteapplication/x-riffpalx , %u bytes= plth, extended= datax , data size %ux , %u entries x x, extra bytes>%#8.8x=RDIB, device-independent bitmaprdi/dib=BM=  , OS/2 1.x formatx ", %d xx $%d= @, OS/2 2.x formatx ", %d xx $%d= (, Windows 3.x formatx ", %d xx & %d xx , %d= RMID, MIDIaudio/midrmi=RMMP, multimedia movievideo/x-mmmmmm=RMP3, MPEG Layer 3 audio=WAVE, WAVE audioaudio/x-wavwav/wave> "= . #riff-walk= %= &='=.(tr500-call-recorder-header=+cdr!-CDRXcont= ./corel-draw=2CDRXcont, Corel Clipartapplication/x-corel-ccxccxx 7, %u bytes=<CDT= .=corel-draw=?CDST= .@corel-draw=BPAT= .Ccorel-draw=GDES!HDESC= .Icorel-des=KDESC=ONUNDROOT, Steinberg CuBase=WIDF LIST, MIDI Instrument Definition Fileaudio/x-idfidfx0`"%s"=1binstbyx$d"%s"=gAVI , AVIvideo/x-msvideoavi/divx= mLIST=nhdrlavihx $o, %u xx (p%u,> q@B<1 fps,= r@B1.00 fps,= s 2.00 fps,= t3.00 fps,= u4.00 fps,= v@ 5.00 fps,= w 6.00 fps,= x .7.00 fps,= yH8.00 fps,= z9.00 fps,= {10.00 fps,< }> ~‚! ~10 fps,= E12.00 fps,< BH> B! E~12 fps,= k15.00 fps,< *> ! k~15 fps,= P20.00 fps,= 23.98 fps,= â24.00 fps,< q> ! ! â~24 fps,= @25.00 fps,< > ! @~25 fps,= W29.97 fps,= 530.00 fps,< > ǁ! W! 5~30 fps,< }>30 fps,=XLIST=`strlstrh=lvidsvideo:= uncompressed= hlstrf= hRLE 8bpp= hanimIntel RDX= haur2AuraVision Aura 2= hauraAuraVision Aura= hbt20Brooktree MediaStream= hbtcvBrooktree Composite Video= hcc12Intel YUV12= hcdvcCanopus DV= hchamWinnov Caviara Cham= hcljrProprietary YUV 4 pixels= hcmykCommon Data Format in Printing= hcplaWeitek 4:2:0 YUV Planar= hcvidCinepak= hcwltMicrosoft Color WLT DIB= hcyuvCreative Labs YUV= hd261H.261= hd263H.263= hduckTrueMotion 1.0= hdve2DVE-2 Videoconferencing= hfljpField Encoded Motion JPEG= hfvf1Fractal Video Frame= hgwltMicrosoft Greyscale WLT DIB= hh260H.260= hh261H.261= hh262H.262= hh263H.263= hh264H.264= hh265H.265= hh266H.266= hh267H.267= hh268H.268= hh269H.269= hi263Intel I.263= hi420Intel Indeo 4= hianIntel RDX= hiclbCellB Videoconferencing Codec= hilvcIntel Layered Video= hilvrITU-T H.263+= hirawIntel YUV Uncompressed= hiv30Intel Indeo 3= hiv31Intel Indeo 3.1= hiv32Intel Indeo 3.2= hiv33Intel Indeo 3.3= hiv34Intel Indeo 3.4= hiv35Intel Indeo 3.5= hiv36Intel Indeo 3.6= hiv37Intel Indeo 3.7= hiv38Intel Indeo 3.8= hiv39Intel Indeo 3.9= hiv40Intel Indeo 4.0= hiv41Intel Indeo 4.1= hiv42Intel Indeo 4.2= hiv43Intel Indeo 4.3= hiv44Intel Indeo 4.4= hiv45Intel Indeo 4.5= hiv46Intel Indeo 4.6= hiv47Intel Indeo 4.7= hiv48Intel Indeo 4.8= hiv49Intel Indeo 4.9= hiv50Intel Indeo 5.0= hmpegMPEG 1 Video Frame= hmjpgMotion JPEG= hmp42Microsoft MPEG-4 v2= hmp43Microsoft MPEG-4 v3= hmrcaMR Codec= hmrleRun Length Encoding= hmsvcMicrosoft Video 1= hphmoPhotomotion= hqpeqQPEG 1.1 Format Video= hrgbtRGBT= hrle4Run Length Encoded 4= hrle8Run Length Encoded 8= hrt21Intel Indeo 2.1= hrvxIntel RDX= hsdccSun Digital Camera Codec= hsfmcCrystal Net SFM Codec= hsmscSMSC= hsmsdSMSD= hsplcSplash Studios ACM Audio Codec= hsqz2Microsoft VXtreme Video Codec= hsv10Sorenson Video R1= htlmsTeraLogic Motion Intraframe Codec A= htlstTeraLogic Motion Intraframe Codec B= htm20TrueMotion 2.0= htmicTeraLogic Motion Intraframe Codec 2= htmotTrueMotion Video Compression= htr20TrueMotion RT 2.0= hultiUltimotion= huyvyUYVY 4:2:2 byte ordering= hv42224-bit YUV 4:2:2 format= hv65516-bit YUV 4:2:2 format= hvcr1ATI VCR 1.0= hvcr2ATI VCR 2.0= hvcr3ATI VCR 3.0= h vcr4ATI VCR 4.0= h vcr5ATI VCR 5.0= h vcr6ATI VCR 6.0= h vcr7ATI VCR 7.0= h vcr8ATI VCR 8.0= hvcr9ATI VCR 9.0= hvdctVideo Maker Pro DIB= hvidsYUV 4:2:2 CCIR 601 for V422= hvivoVivo H.263= hvixlVIXL= hvlv1VLCAP.DRV= hwbvcW9960= hx263mmioFOURCC('X','2','6','3')= hxlv0XL Video Decoder= hy211YUV 2:1:1 Packed= hy411YUV 4:1:1 Packed= hy41bYUV 4:1:1 Planar= hy41pPC1 4:1:1= hy41tPC1 4:1:1 with transparency= hy42bYUV 4:2:2 Planar= hy42tPC1 4:2:2 with transparency= hyc12Intel YUV12 Codec= hyuv8Winnov Caviar YUV8= h yuv9YUV9= h!yuy2YUY2 4:2:2 byte ordering packed= h"yuyvBI_YUYV, Canopus= h#fmp4FFMpeg MPEG-4= h$div3DivX 3=p%div3Low-Motion=p&div4Fast-Motion= h'divxDivX 4= h(dx50DivX 5= h)xvidXviD= h*h264H.264= h+wmv3Windows Media Video 9= h,h264X.264 or H.264= h-= \`0LIST= \h1strlstrh= \t2auds, audio:= \4strf= \5uncompressed PCM= \6ADPCM= \7aLaw= \8uLaw= \9PMPEG-1 Layer 1 or 2= \:UMPEG-1 Layer 3= \; Dolby AC3= \<aDivX= \>(mono,= \?(stereo,> \@(%d channels,x \A%d Hz)= \Cstrf= \Duncompressed PCM= \EADPCM= \FUMPEG-1 Layer 3= \G Dolby AC3= \HaDivX= \J(mono,= \K(stereo,> \L(%d channels,x \M%d Hz)=SVDRM, VirtualDub linkvideo/x-vdrvdr= VPATH, PATHx X%s=]ACON, animated cursorapplication/x-navi-animationani=cINAMx d"%s" =  fTRAIx g%s=jsfbk, SoundFont/Bankaudio/x-sfbksf2=oCDXA, wrapped MPEG-1 (CDXA)video/x-cdxampg/dat=s4XMV, 4X Movie filevideo/x-4xmv4xm/4xa=wAMV , AMVvideo/x-amvamv=}WEBP, Web/P imageimage/webpwebp= . riff-walk=MIDS, MIDI Streamaudio/x-midsmds=TRID, TrID defs packageapplication/x-trid-trdtrd =RIFXRIFF (big-endian) data=PAL, palettex, version %dx, %d entries=RDIB, device-independent bitmap= BM=  , OS/2 1.x formatx" , %d xx$ %d= @, OS/2 2.x formatx", %d xx$%d=(, Windows 3.x formatx", %d xx&%d xx,%d=RMID, MIDI=RMMP, multimedia movie=WAVE, WAVE audio= , Microsoft PCM> ", %d bit=, mono=, stereo>, %d channels>%d Hz=#CDR= .$^corel-draw='AVI , AVI=)ACON, animated cursor=+NIFF, Notation Interchange File Format=-sfbkSoundFont/Bank =%URaspberry PI EEPROMapplication/x-raspberry-eeprombinx+, offset %8.8x!., length %x> 00, "%s"=2!4, 2nd MAGIC=%8.8x =RPMapplication/x-rpmx v%dx .%d= src= bin= i386/x86_64=Alpha/Sparc64=Sparc=MIPS=PowerPC=68000=SGI=RS6000= IA64= Sparc64= MIPSel= ARM= MiNT=S/390=S/390x=PowerPC64=SuperH=Xtensa=noarchx %s =#drpmDelta RPMapplication/x-rpmx %%s=& MIPSel=' ARM=( MiNT=)S/390=*S/390x=+PowerPC64=,SuperH=-Xtensax .%s = MTZ MTZ reflection file =MAP CCP4 Electron Density Map= , Big-endian=!", VAX format="D, Little-endian=#U, Convex native =GDSII Stream file=xversion %d.0>version %dx.%d =Sun 'jks' Java Keystore File data = |SE Linux modular policyx version %d,x %d sections,= |x   mod version %d,=   Not MLS,=   MLS,=   >  /module name %s=  base = BALANCE NS32000 .o>  not stripped> | version %d = BALANCE NS32000 executable (0 @ 0)>  not stripped> | version %d =  BALANCE NS32000 executable (invalid @ 0)> not stripped> |version %d = 0BALANCE NS32000 standalone executable> not stripped> |version %d =@=srlSereal data packetapplication/sereal=.sereal =@=rlSereal data packetapplication/sereal=.sereal =MFCSIRIS Showcase filex- version %d =MFCTIRIS Showcase templatex- version %d =IRIX Parallel Arena>- version %d ="IRIX core dump=#of>$'%s' =&@IRIX 64-bit core dump='of>('%s' =*IRIX N32 core dump=+of>,'%s' =JPmNsPCP compiled namespace (V.0) =M&PPCP archivexN(V.%d)=Otemporal index=Pmetadata=Qlog volume #0>Rlog volume #%d>Shost: %s =T&P(PCP archivexU(V.%d)=Vtemporal index=Wmetadata=Xlog volume #0>Ylog volume #%d>$Zhost: %s =mPcPhPCP Help=n1Index=o2Text>p(V.%1.1s) = }SpeedShop data file = b9mdbm file, version 0 (obsolete) =mdbmmdbm file,xversion %d,x2^%d pages,xpagesize 2^%d,xhash %d,x dataformat %d =CIMGAlias Maya Image File =DEEPAlias Maya Image File@=` (named: %s = RTSSNetMon capture filex - version %dx.%d= (Unknown)= (Ethernet)= (Token Ring)= (FDDI)= (ATM)> (type %d) =GMBUNetMon capture filex- version %dx.%d= (Unknown)= (Ethernet)= (Token Ring)= (FDDI)=  (ATM)= !(IP-over-IEEE 1394)= "(802.11)= #(Raw IP)= $(Raw IP)= % (Raw IP)> & (type %d) =EXCPNetXRay capture file>F- version %s= ,G(Ethernet)= ,H(Token Ring)= ,I(FDDI)= ,J(WAN)= ,K(ATM)= ,L (802.11)(=òpcap capture file, microseconds ts (big-endian)application/vnd.tcpdump.pcap=.pcap-be(= òpcap capture file, microsecond ts (little-endian)application/vnd.tcpdump.pcap=.!^pcap-be(=$M<pcap capture file, nanosecond ts (big-endian)application/vnd.tcpdump.pcap=.&pcap-be(= 'M<pcap capture file, nanosecond ts (little-endian)application/vnd.tcpdump.pcap=.)^pcap-be(=.4Ͳpcap capture file, microsecond ts, extensions (big-endian)=./pcap-be(= 04Ͳpcap capture file, microsecond ts, extensions (little-endian)=.1^pcap-be =NetSNetStumbler log filex , %d stations found =verEtherPeek/AiroPeek/OmniPeek capture file =VNFVisual Networks traffic capture file =&X hpSoftQuad troff Context intermediate for HP LaserJet =(X psSoftQuad troff Context intermediate for PostScript =specSPEC= .cpuCPU< :%.4s= .raw result text =RZX!Spectrum .RZX dataxversion %dx.%d =ZXSTzx-state snapshotxversion %dx.%d=16k ZX Spectrum=48k ZX Spectrum/ZX Spectrum+=ZX Spectrum 128=ZX Spectrum +2=ZX Spectrum +2A/+2B=ZX Spectrum +3=ZX Spectrum +3e=Pentagon 128=Timex Sinclair TC2048= Timex Sinclair TC2068= Scorpion ZS-256= ZX Spectrum SE= Timex Sinclair TS2068= Pentagon 512=Pentagon 1024=48k ZX Spectrum (NTSC)=ZX Spectrum 12Ke=(alternate timings) =+MySQL ISAM index filex,Version %d =-MySQL ISAM compressed data filex.Version %d =/MySQL MyISAM index filex0Version %dx1, %d key partsx2, %d unique key partsx3, %d keysx4, %lld recordsx$5, %lld deleted records =6MySQL MyISAM compressed data filex7Version %d =8 MySQL Maria index filex9Version %d =: MySQL Maria compressed data filex;Version %d =?binMySQL replication log,x @server id %d=A= BE, MySQL V3.2.3xC, server version %s= DK, MySQL V4.0.2-V4.1xE, server version %s=FMySQL V5+,xGserver version %s=HMARIALOGMySQL Maria transaction log filexIVersion %d =7SQLite Write-Ahead Log,sqlite-wal/db-walxversion %d =DUCKDuckDB database filex , version %lld = a.out SunOS SPARC demand paged& <shared library=dynamically linked executable>dynamically linked executable^executable>not stripped =a.out SunOS SPARC pure&dynamically linked executable^executable>not stripped =a.out SunOS SPARC&dynamically linked executable^executable>not stripped = a.out SunOS mc68020 demand paged&< shared library=!dynamically linked executable>"dynamically linked executable^#executable>$not stripped =&a.out SunOS mc68020 pure&'dynamically linked executable^(executable>)not stripped =+a.out SunOS mc68020&,dynamically linked executable^-executable>.not stripped =0 a.out SunOS mc68010 demand paged&1<2shared library=3dynamically linked executable>4dynamically linked executable^5executable>6not stripped =8a.out SunOS mc68010 pure&9dynamically linked executable^:executable>;not stripped ==a.out SunOS mc68010&>dynamically linked executable^?executable>@not stripped =FVSunOS core file=G(SPARC)>Hfrom '%s'=tI(quit)=tJ(illegal instruction)=tK(trace trap)=tL(abort)=tM(emulator trap)=tN(arithmetic exception)=tO (kill)=tP (bus error)=tQ (segmentation violation)=tR (bad argument to system call)=tS(resource lost)xxT(T=%dK,x|UD=%dK,xVS=%dK)=W:(68K)>Xfrom '%s'=Y(SPARC 4.x BCP)>Zfrom '%s' =\3SunPC 4.0 Hard Disk =CRfsCOBALT boot rom data (Flat boot rom or file system) =SMD1SymbOS driverx, name: %cx%cx%cx%cx%cx%cx%cx%cx%cx%cx%cx%cx%c =T707Roland TR-707 Data =?PDCPDCurses screen image =n#LyXLyX document text =TZiftimezone data =3 TZif(slim)=.3!timezonex3"(fat)=.#timezone = UF2 UF2 firmware imageuf2& , not main flash& , file container&  , family= iST STM32L4xx=  $ST STM32L5xx= 6WMicrochip (Atmel) ATmega32=  xQMicrochip (Atmel) SAML21= !_tWNordic NRF52= "!_ESP32= #-CST STM32L1xx= $:. ST STM32L0xx= %F!ST STM32WLxx= &w*NXP LPC55xx= '3V0ST STM32G0xx= ((1GD32F350= ) $qLST STM32G4xx= *ղONXP i.MX RT10XX= +SST STM32F7xx= ,`DUMicrochip (Atmel) SAMD51= -WZuWST STM32F401= .ZCypress FX2= /. ]ST STM32F2xx= 0r^ST STM32F103= 1$xdST STM32F0xx= 2+hMicrochip (Atmel) SAMD21= 3akST STM32F3xx= 4" mST STM32F407= 5`mST STM32H7xx= 6SfpST STM32WBxx= 7a~ESP8266= 8NXP KL32L2x= 9`ST STM32F407VG= :@(Nordic NRF52840= ;NݿESP32-S2= <gW~ESP32-S3= =l+ESP32-C3= >VRaspberry Pi RP2040xAx B%#08x= C , file sizex D%#08x& E@, MD5 checksum present& F, extension tags presentx G, address %#08xx H, %u total blocks =+/v8Unicode text, UTF-7 = +/v9Unicode text, UTF-7 = +/v+Unicode text, UTF-7 = +/v/Unicode text, UTF-7 = sfsUnicode text, UTF-8-EBCDIC = Unicode text, UTF-32, big-endian =Unicode text, UTF-32, little-endian = unknown demand paged pure executable>!not stripped ="unknown readable demand paged pure executable =UTE+uterus file=v, versionx %c= ..x %c= <>, big-endian> , slut size %u=><, little-endian> , slut size %u& , compressed =TXUltrix core file>Xfrom '%s' =gmonGNU prof performance datax- version %d = HRBHarbour HRB filex !version %d =#HBVHarbour variable dump filex $version %d = ,~ST40 component image format>-, name '%s' = oVAX single precision APL workspace = nVAX double precision APL workspace = a.out VAX demand paged (first page unmapped) pure executable> not stripped =@COWDVMWare3=disk imagex (%d/x $%d/x (%d)=undoable disk image> (%s) =@VMDKVMware4 disk image =@KDMVVMware4 disk image =@QFIQEMU QCOW Imageapplication/x-qemu-diskx(v%d)> , has backing file (> path %s> , mtime %s)x)x, %lld bytes=$, AES-encrypted=(v2)>, has backing file> (path %s)x , %lld bytes= , AES-encrypted= (v3)>, has backing file> (path %s)x, %lld bytes= , AES-encryptedx(unknown version) =@QEVMQEMU suspend to disk image ="@QEDQEMU QED Image(= @(ھVirtualBox Disk Image> D), major %u> F*, minor %u>+(%s)xp,, %lld bytes = 2ΊFBochs Sparse disk image =Virtutech CRAFFxv%d= uncompressed= bzipp2ed= gzipped= not clean =0VMS VAX executable=PK, Info-ZIP SFX archive v5.12 w/decryption =NVRMVMware nvram =OggSOgg data!UNKNOWN REVISION %u==FLAC, FLAC audioaudio/ogg="theora, Theora videovideo/ogg= %kate, Kate (Karaoke and Text)application/oggx%'v%ux&(.%u,=()utf8 encoding,!(*unknown character encoding,><+language %s,=<,no language set,>L-category %s=L.no category set=0fishead, Skeletonvideo/oggx $2v%ux (3.%u=5Speex , Speex audioaudio/ogg= 8video, OGM videovideo/ogg=%:div3(DivX 3)=%;divx(DivX 4)=%<dx50(DivX 5)=%=xvid(XviD)=?vorbis, Vorbis audio,audio/ogg! #AUNKNOWN VERSION %u,= #C='Dmono,='Estereo,>'F%u channels,x (G%u Hz< 0I,! 4K! 4O! 4Px 4Q<%u! 0Rx 0S~%u! ,T! ,U! ,Vx ,W>%u< 0Xbps=TU`vorbis=T`aXiphophorus libVorbis I, created by: Xiphophorus libVorbis I>Txb00000000<Txd20000508(Txf20000508<Txg20001031(beta2-3)=Txh20001031(1.0 beta 3)>Txi20001031<Txj20010225(beta3-4)=Txk20010225(1.0 beta 4)>Txl20010225<Txm20010615(beta4-RC1)=Txn20010615(1.0 RC1)=Txo20010813(1.0 RC2)=Txp20010816(RC2 - Garf tuned v1)=Txq20011014(RC2 - Garf tuned v2)=Txr20011217(1.0 RC3)=Txs20011231(1.0 RC3)>Txu20011231(pre-1.0 CVS)=T`wXiph.Org libVorbis I, created by: Xiph.Org libVorbis I>Tux00000000<Tuy20020717(pre-1.0 CVS)=Tuz20020717(1.0)=Tu{20030909(1.0.1)=Tu|20040629(1.1.0 RC1)=Tu}20050304(1.1.2)=Tu~20070622(1.2.0)=Tu20090624(1.2.2)=Tu20090709(1.2.3)=Tu20100325(1.3.1)=Tu20101101(1.3.2)=Tu20120203(1.3.3)=Tu20140122(1.3.4)=Tu20150105(1.3.5)=OpusHead, Opus audio,audio/ogg>$UNKNOWN VERSION %u,!$version 0.%u,>.!.unknown channel mapping family %u,x%%u channels=.=%mono=%stereo=.=%mono=%stereo=%linear surround=%quadraphonic=%5.0 surround=%5.1 surround=%6.1 surround=%7.1 surround! (, %u Hz (Input Sample Rate) =  N,+GVXL data file,> schema version no %d = asmWebAssembly (wasm) binary module= version %#x (MVP)application/wasmwasm> version %#x(=C MS Outlook Nickfileapplication/x-ms-nickfilenk2/dat/bakx K, probably version %ux M.%ux O, %u itemsx Q, %u entriesx S, value type %#4.4xx U, entry type %#4.4x= [x $], %u bytesx(_"%s" =PMCCMS Windows 3.1 group files =`tfMRMS Windows help Full Text Search indexapplication/x-winhelp-ftsfts>cfor "%s" =regfMS Windows registry file, NT/2000 or above =CREGMS Windows 95/98/ME registry file =1giMWindows Easy Transfer migration dataapplication/x-ms-migmig=MRTSwithout passwordx 8, at %#x  x 8x)!MRTSwith password=@MRTSx, 1st %-s =ID;PMicrosoft SYLK program>0, created by %sslk/sylk(= ɸInstallShield Scriptapplication/x-installshield-insinsx "%s"=!SRCDIR, variable names:x #%ux %sx #%ux %sx #%ux %sx... =RGDBCRDA wireless regulatory database file=(Version 1) =CSBKTed Neslson's CosmicBook hypertext file =EYWRAmigaWriter file =\1cwChiWriter file =Adobe InDesign=DOCUMENTDocument(= <gfxboot compiled html help file =kSGA3StarOffice Gallery thumbnailsapplication/x-stargallery-sdgsdg = wsdlPHP WSDL cache,x version %#02xx  , created %s< x , uri: "%s"< x , source: "%s"< x , target_ns: "%s" = VCDIFF binary diff =corecore file (Xenix) = Vb.out& Woverlay& Xseparate& Ypure& Zsegmented& [standalone& \executable^ ]object file& ^@V2.3& _V3.0&`86&a 186&b 286&c)286&d 386& eLarge Text& fLarge Data& gHuge Objects Enabled =Uznaxo65 object,x  version %d,=  with debug info=  no debug info =naUzxo65 library,x version %d = Jaleo XFS filex- version %dx- [%d -x%dxx%dx=YUV422]=RGB24] = XcurXcursor dataimage/x-xcursorx "version %dx #.%d = object file (z8000 a.out) = pure object file (z8000 a.out) = separate object file (z8000 a.out) = overlay object file (z8000 a.out)@=+E template=2F^[[:space:]]*template[[:space:]]*<.*>[[:space:]]*$C++ source texttext/x-c++@=+2^(import|export) ["']\./JavaScript sourceapplication/javascriptjs@=+6^require\(["']JavaScript sourceapplication/javascriptjs@=+#! /usr/local/bin/pythonPython script text executabletext/x-script.python@=+I virtual=3J^[[:space:]]*virtual[[:space:]]+.*[};][[:space:]]*$C++ source texttext/x-c++@=+V private=W^[[:space:]]*private:C++ source texttext/x-c++@=+*\((async )?function[( ]JavaScript sourceapplication/javascriptjs@=+ require=-^[[:space:]]*require[[:space:]]'[A-Za-z_/.]+'=def [a-z]| do$=&^[[:space:]]*end([[:space:]]+[;#].*)?$Ruby script texttext/x-ruby@=+\&